BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780149|ref|YP_003064562.1| hypothetical protein CLIBASIA_00140 [Candidatus Liberibacter asiaticus str. psy62] (67 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done Results from round 1 >gi|254780149|ref|YP_003064562.1| hypothetical protein CLIBASIA_00140 [Candidatus Liberibacter asiaticus str. psy62] gi|38195602|gb|AAR13465.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|140063956|gb|ABO82468.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|254039826|gb|ACT56622.1| hypothetical protein CLIBASIA_00140 [Candidatus Liberibacter asiaticus str. psy62] gi|255957546|dbj|BAH96609.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957842|dbj|BAH96816.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957852|dbj|BAH96825.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957862|dbj|BAH96834.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957872|dbj|BAH96843.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957882|dbj|BAH96852.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957892|dbj|BAH96861.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957902|dbj|BAH96870.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957912|dbj|BAH96879.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957922|dbj|BAH96888.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957932|dbj|BAH96897.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957942|dbj|BAH96906.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957952|dbj|BAH96915.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957962|dbj|BAH96924.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957972|dbj|BAH96933.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957982|dbj|BAH96942.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957992|dbj|BAH96951.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958002|dbj|BAH96960.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958012|dbj|BAH96969.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958022|dbj|BAH96978.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958032|dbj|BAH96987.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958042|dbj|BAH96996.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958052|dbj|BAH97005.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958062|dbj|BAH97014.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958072|dbj|BAH97023.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958082|dbj|BAH97032.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958092|dbj|BAH97041.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958102|dbj|BAH97050.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958112|dbj|BAH97059.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958122|dbj|BAH97068.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|283362132|dbj|BAI65919.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362142|dbj|BAI65928.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362152|dbj|BAI65937.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362162|dbj|BAI65946.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362172|dbj|BAI65955.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362182|dbj|BAI65964.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362192|dbj|BAI65973.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362202|dbj|BAI65982.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362212|dbj|BAI65991.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362222|dbj|BAI66000.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362232|dbj|BAI66009.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 67 Score = 130 bits (326), Expect = 9e-29, Method: Compositional matrix adjust. Identities = 67/67 (100%), Positives = 67/67 (100%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH Sbjct: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 Query: 61 FILGIGR 67 FILGIGR Sbjct: 61 FILGIGR 67 >gi|315122751|ref|YP_004063240.1| hypothetical protein CKC_05015 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496153|gb|ADR52752.1| hypothetical protein CKC_05015 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 67 Score = 79.7 bits (195), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 47/66 (71%), Positives = 57/66 (86%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M VN L+++NFFKQV+ E K+IFWPSR+EVL+SV+VVIIMLSISS+F L IDQ IGW MH Sbjct: 1 MRVNGLSIVNFFKQVKVEFKRIFWPSRNEVLISVVVVIIMLSISSMFLLAIDQLIGWFMH 60 Query: 61 FILGIG 66 F+L IG Sbjct: 61 FLLNIG 66 >gi|133872294|gb|ABO40214.1| preprotein translocase [Candidatus Liberibacter americanus] Length = 65 Score = 69.3 bits (168), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 35/60 (58%), Positives = 48/60 (80%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 +A+L+F K V+ E KKI WPSR+EV+VS I+V+IML +SSVFFL++D IG +M FIL + Sbjct: 5 MALLDFLKNVKIEVKKIIWPSRNEVVVSAILVMIMLVVSSVFFLMVDHFIGSIMSFILYV 64 >gi|220921884|ref|YP_002497185.1| preprotein translocase subunit SecE [Methylobacterium nodulans ORS 2060] gi|219946490|gb|ACL56882.1| preprotein translocase, SecE subunit [Methylobacterium nodulans ORS 2060] Length = 103 Score = 67.8 bits (164), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 26/63 (41%), Positives = 46/63 (73%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R+ F +QVRDE +K+ WP+R E L++ ++V +M+ ++S+FF+V+DQ + +L+ +L Sbjct: 40 KRVGPFEFLQQVRDEGRKVTWPTRKETLITTLMVFVMVVLASLFFVVVDQVLRYLVTLVL 99 Query: 64 GIG 66 GIG Sbjct: 100 GIG 102 >gi|170738718|ref|YP_001767373.1| preprotein translocase, SecE subunit [Methylobacterium sp. 4-46] gi|168192992|gb|ACA14939.1| preprotein translocase, SecE subunit [Methylobacterium sp. 4-46] Length = 101 Score = 67.4 bits (163), Expect = 5e-10, Method: Compositional matrix adjust. Identities = 26/63 (41%), Positives = 46/63 (73%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R+ F +QVRDE +K+ WP+R E L++ ++V +M+ ++S+FF+V+DQ + +L+ +L Sbjct: 38 KRVGPFEFLQQVRDEGRKVTWPTRKETLITTLMVFVMVVLASLFFVVVDQVLRYLVTLVL 97 Query: 64 GIG 66 GIG Sbjct: 98 GIG 100 >gi|222085662|ref|YP_002544192.1| protein-export translocase protein [Agrobacterium radiobacter K84] gi|221723110|gb|ACM26266.1| protein-export translocase protein [Agrobacterium radiobacter K84] Length = 66 Score = 65.1 bits (157), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 26/59 (44%), Positives = 41/59 (69%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 L F +QVR E+ KI WPSR E ++S ++V++M+ +S+FF DQ IGW++ ++L G Sbjct: 8 LAFLQQVRSETSKITWPSRRETMISTVMVLVMVVFASLFFFAADQLIGWILGYVLNTGN 66 >gi|304321356|ref|YP_003854999.1| hypothetical protein PB2503_09019 [Parvularcula bermudensis HTCC2503] gi|303300258|gb|ADM09857.1| hypothetical protein PB2503_09019 [Parvularcula bermudensis HTCC2503] Length = 112 Score = 64.3 bits (155), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 27/64 (42%), Positives = 47/64 (73%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 ++ + FF+QVRDE+ K+ W SR+E LVS I+V+IM++++S+FFL++D + W++ Sbjct: 47 AAKKVGPIQFFRQVRDEALKVTWTSRNETLVSTIMVLIMVALASMFFLLVDTVLRWIVPI 106 Query: 62 ILGI 65 IL + Sbjct: 107 ILSV 110 >gi|163759400|ref|ZP_02166486.1| translocase [Hoeflea phototrophica DFL-43] gi|162283804|gb|EDQ34089.1| translocase [Hoeflea phototrophica DFL-43] Length = 66 Score = 63.5 bits (153), Expect = 9e-09, Method: Compositional matrix adjust. Identities = 25/57 (43%), Positives = 41/57 (71%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E +S ++V++M+ ++S+FF DQ++GW++ IL IG Sbjct: 9 TFIQQVRSETAKVKWPSRRETSISTVMVLVMVLLASIFFFAADQALGWVISLILNIG 65 >gi|240140813|ref|YP_002965293.1| Preprotein translocase subunit SecE-like protein [Methylobacterium extorquens AM1] gi|254563323|ref|YP_003070418.1| SecE subunit of protein translocation complex preprotein [Methylobacterium extorquens DM4] gi|240010790|gb|ACS42016.1| Preprotein translocase subunit SecE-like protein [Methylobacterium extorquens AM1] gi|254270601|emb|CAX26604.1| Putative SecE subunit of protein translocation complex preprotein, (across inner membrane), (General Secretory Pathway) [Methylobacterium extorquens DM4] Length = 100 Score = 62.4 bits (150), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 25/63 (39%), Positives = 43/63 (68%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R+ + F +VRDE +K+ WP+R E V+ I+V IM+ ++S+FF+ +DQ + + + +L Sbjct: 37 KRVGPVEFLGEVRDEGRKVTWPTRKETTVTTIMVFIMVVVASLFFVAVDQVMRFAVSLVL 96 Query: 64 GIG 66 GIG Sbjct: 97 GIG 99 >gi|163853395|ref|YP_001641438.1| preprotein translocase, SecE subunit [Methylobacterium extorquens PA1] gi|218532253|ref|YP_002423069.1| preprotein translocase, SecE subunit [Methylobacterium chloromethanicum CM4] gi|163665000|gb|ABY32367.1| preprotein translocase, SecE subunit [Methylobacterium extorquens PA1] gi|218524556|gb|ACK85141.1| preprotein translocase, SecE subunit [Methylobacterium chloromethanicum CM4] Length = 126 Score = 62.0 bits (149), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 25/63 (39%), Positives = 43/63 (68%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R+ + F +VRDE +K+ WP+R E V+ I+V IM+ ++S+FF+ +DQ + + + +L Sbjct: 63 KRVGPVEFLGEVRDEGRKVTWPTRKETTVTTIMVFIMVVVASLFFVAVDQVMRFAVSLVL 122 Query: 64 GIG 66 GIG Sbjct: 123 GIG 125 >gi|302382911|ref|YP_003818734.1| preprotein translocase subunit SecE [Brevundimonas subvibrioides ATCC 15264] gi|302193539|gb|ADL01111.1| preprotein translocase, SecE subunit [Brevundimonas subvibrioides ATCC 15264] Length = 103 Score = 61.6 bits (148), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 27/64 (42%), Positives = 42/64 (65%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R + F QV+ E++KI WPSR E ++ ++V IM++I+ VFF +D ++GWL IL Sbjct: 40 KRTSPGQFISQVQAEARKIVWPSRKETWITSVMVFIMVAIAVVFFWAVDTALGWLSTIIL 99 Query: 64 GIGR 67 IG+ Sbjct: 100 AIGQ 103 >gi|83858579|ref|ZP_00952101.1| putative preprotein translocase sece subunit transmembrane [Oceanicaulis alexandrii HTCC2633] gi|83853402|gb|EAP91254.1| putative preprotein translocase sece subunit transmembrane [Oceanicaulis alexandrii HTCC2633] Length = 94 Score = 61.6 bits (148), Expect = 4e-08, Method: Compositional matrix adjust. Identities = 26/58 (44%), Positives = 43/58 (74%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 L FF +VR E +K+ W SR+E LVS I+V++M S +++FF +D IG++++ +LG+G Sbjct: 36 LKFFSEVRQEGRKVTWTSRNETLVSTIMVVVMASFAALFFFGVDSIIGFVVNLLLGLG 93 >gi|298291419|ref|YP_003693358.1| preprotein translocase, SecE subunit [Starkeya novella DSM 506] gi|296927930|gb|ADH88739.1| preprotein translocase, SecE subunit [Starkeya novella DSM 506] Length = 65 Score = 60.8 bits (146), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 25/59 (42%), Positives = 44/59 (74%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + FF+QVR E++K+ WP+R E L++ +V +M+ ++S+FFLV DQ + +++ +L IGR Sbjct: 7 VEFFQQVRAEARKVTWPTRRETLITTAMVFVMVVLASLFFLVADQILSFVIAQVLQIGR 65 >gi|144900867|emb|CAM77731.1| Protein secE/sec61-gamma protein [Magnetospirillum gryphiswaldense MSR-1] Length = 66 Score = 60.8 bits (146), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 25/57 (43%), Positives = 39/57 (68%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F KQVR E+ K+ WPSR E VS ++V +M+ +++VFFL++DQ + F+ G+G Sbjct: 9 QFVKQVRQEAAKVTWPSRKETTVSTMMVFVMVVLAAVFFLLVDQVFATAVKFVFGLG 65 >gi|188583666|ref|YP_001927111.1| preprotein translocase, SecE subunit [Methylobacterium populi BJ001] gi|179347164|gb|ACB82576.1| preprotein translocase, SecE subunit [Methylobacterium populi BJ001] Length = 126 Score = 60.8 bits (146), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 24/63 (38%), Positives = 44/63 (69%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R+ + F +VRDE++K+ WP+R E ++ ++V IM+ ++S+FF+ +DQ + + + IL Sbjct: 63 KRVGPVEFLGEVRDEARKVTWPTRKETTITTVMVFIMVVVASLFFVAVDQVMRFGVGLIL 122 Query: 64 GIG 66 GIG Sbjct: 123 GIG 125 >gi|222148351|ref|YP_002549308.1| preprotein translocase subunit SecE [Agrobacterium vitis S4] gi|221735339|gb|ACM36302.1| secretion protein [Agrobacterium vitis S4] Length = 66 Score = 60.5 bits (145), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 24/57 (42%), Positives = 39/57 (68%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 F +QVR E+ K+ WPSR E ++S ++V+ M+ +S+FF DQ IGW++ +L +G Sbjct: 10 FLQQVRSETSKVTWPSRRETVISTLMVLAMVIFASLFFFAADQVIGWVLSLVLNLGN 66 >gi|307946269|ref|ZP_07661604.1| preprotein translocase, SecE subunit [Roseibium sp. TrichSKD4] gi|307769933|gb|EFO29159.1| preprotein translocase, SecE subunit [Roseibium sp. TrichSKD4] Length = 63 Score = 60.5 bits (145), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 26/57 (45%), Positives = 41/57 (71%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F +QVR E K+ WP+R E V+ ++V IM+ I+S+FFL+ DQ +GW + ++LG+ Sbjct: 7 LTFIQQVRSEVAKVTWPTRRETAVTTVMVFIMVVIASIFFLLADQLMGWGIGWMLGV 63 >gi|118591200|ref|ZP_01548599.1| hypothetical protein SIAM614_16277 [Stappia aggregata IAM 12614] gi|118436276|gb|EAV42918.1| hypothetical protein SIAM614_16277 [Stappia aggregata IAM 12614] Length = 65 Score = 60.1 bits (144), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 24/58 (41%), Positives = 42/58 (72%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F ++VR E+ K+ WP+R E V+ ++V IM+ I+++FFLV DQ +G+ + ++LG+G Sbjct: 7 FKFIQEVRAETSKVTWPTRKETAVTTVMVFIMVVIAAIFFLVADQLMGFGIGYLLGVG 64 >gi|148260035|ref|YP_001234162.1| preprotein translocase, SecE subunit [Acidiphilium cryptum JF-5] gi|326403009|ref|YP_004283090.1| putative protein translocase subunit SecE/Sec61 [Acidiphilium multivorum AIU301] gi|146401716|gb|ABQ30243.1| protein translocase subunit secE/sec61 gamma [Acidiphilium cryptum JF-5] gi|325049870|dbj|BAJ80208.1| putative protein translocase subunit SecE/Sec61 [Acidiphilium multivorum AIU301] Length = 64 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 27/57 (47%), Positives = 38/57 (66%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F + VR E+ K WPSR E LV+ VV+ M+ ++ VFFLV+DQ IG+ M + G+G Sbjct: 7 KFLRDVRSEASKTTWPSRKETLVTTGVVLAMVVVTIVFFLVVDQVIGFGMRLLFGVG 63 >gi|91977670|ref|YP_570329.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris BisB5] gi|91684126|gb|ABE40428.1| protein translocase subunit secE/sec61 gamma [Rhodopseudomonas palustris BisB5] Length = 62 Score = 59.7 bits (143), Expect = 1e-07, Method: Compositional matrix adjust. Identities = 25/57 (43%), Positives = 41/57 (71%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++VR E+ K+ WPSR EV ++ I+V +M++++S+FF V DQ I L+ F+LG+ Sbjct: 6 FKFLQEVRSETAKVTWPSRREVTITTIMVFVMVALASIFFFVADQVIRVLITFVLGV 62 >gi|319899062|ref|YP_004159155.1| preprotein translocase, SecE subunit [Bartonella clarridgeiae 73] gi|319403026|emb|CBI76581.1| preprotein translocase, SecE subunit [Bartonella clarridgeiae 73] Length = 70 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 23/53 (43%), Positives = 41/53 (77%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG 56 +R+ ++ F KQVR E+ K+ WP+R E +VS I+V+++ +++SVFF V+DQ++ Sbjct: 3 SRINLITFLKQVRAETAKVKWPTRRETVVSTIIVLVLTALASVFFFVVDQAVN 55 >gi|115525608|ref|YP_782519.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris BisA53] gi|115519555|gb|ABJ07539.1| protein translocase subunit secE/sec61 gamma [Rhodopseudomonas palustris BisA53] Length = 63 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 27/57 (47%), Positives = 39/57 (68%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++VR E+ K+ WPSR E ++ I+V IM+++SS+FF DQ I L+ FILGI Sbjct: 6 FKFLQEVRSETAKVTWPSRRETTITTIMVFIMVALSSIFFFFADQFIRLLVTFILGI 62 >gi|260469688|ref|ZP_05813850.1| preprotein translocase, SecE subunit [Mesorhizobium opportunistum WSM2075] gi|259028547|gb|EEW29861.1| preprotein translocase, SecE subunit [Mesorhizobium opportunistum WSM2075] Length = 67 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 26/57 (45%), Positives = 38/57 (66%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 F +QVR E+ K+ WPSR E ++S ++V+ I+ VFF DQ +G+ + ILGIGR Sbjct: 11 FLQQVRSETAKVTWPSRRETMISTVMVLAFAVIAMVFFFTADQLMGFAVEQILGIGR 67 >gi|299135274|ref|ZP_07028465.1| preprotein translocase, SecE subunit [Afipia sp. 1NLS2] gi|298590251|gb|EFI50455.1| preprotein translocase, SecE subunit [Afipia sp. 1NLS2] Length = 63 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 23/57 (40%), Positives = 41/57 (71%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++VR E+ K+ WP+R E +++ I+V ++++++S+FF V DQ I L+ F+LGI Sbjct: 6 FKFLQEVRSETSKVVWPTRRETMITTIMVFVLVAVASIFFFVTDQVIRMLITFVLGI 62 >gi|86749395|ref|YP_485891.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris HaA2] gi|86572423|gb|ABD06980.1| protein translocase subunit secE/sec61 gamma [Rhodopseudomonas palustris HaA2] Length = 63 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 25/57 (43%), Positives = 40/57 (70%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++VR E+ K+ WPSR EV ++ I+V IM++++S+FF DQ I L+ F+LG+ Sbjct: 7 FKFLQEVRSETAKVTWPSRREVTITTIMVFIMVALASIFFFAADQVIRILITFVLGV 63 >gi|312115371|ref|YP_004012967.1| preprotein translocase, SecE subunit [Rhodomicrobium vannielii ATCC 17100] gi|311220500|gb|ADP71868.1| preprotein translocase, SecE subunit [Rhodomicrobium vannielii ATCC 17100] Length = 65 Score = 58.5 bits (140), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 26/63 (41%), Positives = 40/63 (63%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R + +QVR E+ K+ WPSR E +V+ I+V+IM ++SVFFL+ DQ W + +L Sbjct: 3 RTGPFEYLQQVRAETAKVVWPSRRETIVTTIMVVIMAVLASVFFLLADQIFSWGIAHLLR 62 Query: 65 IGR 67 +G Sbjct: 63 LGH 65 >gi|114704470|ref|ZP_01437378.1| translocase [Fulvimarina pelagi HTCC2506] gi|114539255|gb|EAU42375.1| translocase [Fulvimarina pelagi HTCC2506] Length = 65 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 23/57 (40%), Positives = 38/57 (66%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E +S I+V IM++++S+F DQ +G+++ I+ G Sbjct: 8 TFLQQVRSETSKVTWPSRRETTISTIMVFIMVALASIFLFAADQVLGYVVGLIMNAG 64 >gi|254420849|ref|ZP_05034573.1| preprotein translocase, SecE subunit, putative [Brevundimonas sp. BAL3] gi|196187026|gb|EDX82002.1| preprotein translocase, SecE subunit, putative [Brevundimonas sp. BAL3] Length = 99 Score = 58.2 bits (139), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 24/62 (38%), Positives = 42/62 (67%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R + +F+KQV E +KI WPSR E ++ ++V IM+ I+++FF V+D +G+ +I+ Sbjct: 37 RTSPSDFYKQVMAEGRKIVWPSRKETWITSVMVFIMVVIAAIFFWVVDTGLGFAFRYIIA 96 Query: 65 IG 66 +G Sbjct: 97 LG 98 >gi|182678324|ref|YP_001832470.1| preprotein translocase, SecE subunit [Beijerinckia indica subsp. indica ATCC 9039] gi|182634207|gb|ACB94981.1| preprotein translocase, SecE subunit [Beijerinckia indica subsp. indica ATCC 9039] Length = 63 Score = 57.8 bits (138), Expect = 4e-07, Method: Compositional matrix adjust. Identities = 23/58 (39%), Positives = 42/58 (72%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 F + VR E+ K+ WPSR E L++ ++VI+M+ ++S+FF+ +DQ++ ++ FIL +G Sbjct: 6 QFLQDVRTEATKVTWPSRRETLITTLLVILMVLVASLFFVSVDQALRLIVTFILSLGH 63 >gi|209964024|ref|YP_002296939.1| preprotein translocase subunit SecE [Rhodospirillum centenum SW] gi|209957490|gb|ACI98126.1| Preprotein translocase SecE subunit, putative [Rhodospirillum centenum SW] Length = 71 Score = 57.4 bits (137), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 25/57 (43%), Positives = 39/57 (68%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F ++VR E K+ WP+R E VS ++V +M+ +++VFFL+ DQ I + + ILGIG Sbjct: 14 EFMREVRREVAKVTWPTRKETTVSTVMVFVMVILAAVFFLLADQFISFAIRLILGIG 70 >gi|227821741|ref|YP_002825711.1| preprotein translocase subunit SecE [Sinorhizobium fredii NGR234] gi|227340740|gb|ACP24958.1| putative preprotein translocase, SecE subunit [Sinorhizobium fredii NGR234] Length = 66 Score = 57.4 bits (137), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 26/57 (45%), Positives = 38/57 (66%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E +S ++V +M+S ++ FF DQ +GWLM IL +G Sbjct: 9 TFLQQVRSETSKVTWPSRRETTISTLMVFVMVSFAAAFFFGADQLMGWLMSLILNVG 65 >gi|319783302|ref|YP_004142778.1| preprotein translocase, SecE subunit [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317169190|gb|ADV12728.1| preprotein translocase, SecE subunit [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 67 Score = 57.4 bits (137), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 25/57 (43%), Positives = 37/57 (64%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 F +QVR E+ K+ WPSR E ++S ++V+ I+ +FF DQ +G + ILGIGR Sbjct: 11 FLQQVRAETAKVTWPSRRETMISTVMVLAFAVIAMIFFFTADQLMGLAVEQILGIGR 67 >gi|154253164|ref|YP_001413988.1| preprotein translocase subunit SecE [Parvibaculum lavamentivorans DS-1] gi|154157114|gb|ABS64331.1| preprotein translocase, SecE subunit [Parvibaculum lavamentivorans DS-1] Length = 66 Score = 57.0 bits (136), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 40/58 (68%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 L F +QVR E+ K+ WP+R E +++ ++V IM++ + VFF + D ++ +++ +LG G Sbjct: 7 LEFIQQVRSETAKVTWPTRRETIITTVMVFIMVAFAMVFFFLADTALSYIVSLVLGFG 64 >gi|159184992|ref|NP_354937.2| preprotein translocase subunit SecE [Agrobacterium tumefaciens str. C58] gi|159140266|gb|AAK87722.2| secretion protein [Agrobacterium tumefaciens str. C58] Length = 66 Score = 57.0 bits (136), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 26/58 (44%), Positives = 40/58 (68%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 F +QVR E+ KI WPSR E ++S +V++M+ +++FF DQ IGWL+ +L +GR Sbjct: 9 TFLQQVRAEASKITWPSRRETMISTAMVLVMVIFAALFFFAADQLIGWLLSLVLNVGR 66 >gi|153009271|ref|YP_001370486.1| preprotein translocase subunit SecE [Ochrobactrum anthropi ATCC 49188] gi|161619205|ref|YP_001593092.1| preprotein translocase subunit SecE [Brucella canis ATCC 23365] gi|163843514|ref|YP_001627918.1| preprotein translocase subunit SecE [Brucella suis ATCC 23445] gi|189024396|ref|YP_001935164.1| Protein secE/sec61-gamma protein [Brucella abortus S19] gi|225852746|ref|YP_002732979.1| preprotein translocase subunit SecE [Brucella melitensis ATCC 23457] gi|254689466|ref|ZP_05152720.1| preprotein translocase subunit SecE [Brucella abortus bv. 6 str. 870] gi|254693951|ref|ZP_05155779.1| preprotein translocase subunit SecE [Brucella abortus bv. 3 str. Tulya] gi|254697603|ref|ZP_05159431.1| preprotein translocase subunit SecE [Brucella abortus bv. 2 str. 86/8/59] gi|254701989|ref|ZP_05163817.1| preprotein translocase subunit SecE [Brucella suis bv. 5 str. 513] gi|254704531|ref|ZP_05166359.1| preprotein translocase subunit SecE [Brucella suis bv. 3 str. 686] gi|254706573|ref|ZP_05168401.1| preprotein translocase subunit SecE [Brucella pinnipedialis M163/99/10] gi|254710317|ref|ZP_05172128.1| preprotein translocase subunit SecE [Brucella pinnipedialis B2/94] gi|254714314|ref|ZP_05176125.1| preprotein translocase subunit SecE [Brucella ceti M644/93/1] gi|254717751|ref|ZP_05179562.1| preprotein translocase subunit SecE [Brucella ceti M13/05/1] gi|254719304|ref|ZP_05181115.1| preprotein translocase subunit SecE [Brucella sp. 83/13] gi|254730495|ref|ZP_05189073.1| preprotein translocase subunit SecE [Brucella abortus bv. 4 str. 292] gi|256031811|ref|ZP_05445425.1| preprotein translocase subunit SecE [Brucella pinnipedialis M292/94/1] gi|256044896|ref|ZP_05447800.1| preprotein translocase subunit SecE [Brucella melitensis bv. 1 str. Rev.1] gi|256061328|ref|ZP_05451476.1| preprotein translocase subunit SecE [Brucella neotomae 5K33] gi|256113804|ref|ZP_05454604.1| preprotein translocase subunit SecE [Brucella melitensis bv. 3 str. Ether] gi|256159984|ref|ZP_05457699.1| preprotein translocase subunit SecE [Brucella ceti M490/95/1] gi|256255212|ref|ZP_05460748.1| preprotein translocase subunit SecE [Brucella ceti B1/94] gi|256257713|ref|ZP_05463249.1| preprotein translocase subunit SecE [Brucella abortus bv. 9 str. C68] gi|256263767|ref|ZP_05466299.1| protein secE/sec61-gamma protein [Brucella melitensis bv. 2 str. 63/9] gi|260168945|ref|ZP_05755756.1| preprotein translocase subunit SecE [Brucella sp. F5/99] gi|260546705|ref|ZP_05822444.1| secE/sec61-gamma protein [Brucella abortus NCTC 8038] gi|260565502|ref|ZP_05835986.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260566225|ref|ZP_05836695.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260754990|ref|ZP_05867338.1| preprotein translocase subunit SecE [Brucella abortus bv. 6 str. 870] gi|260758206|ref|ZP_05870554.1| preprotein translocase subunit SecE [Brucella abortus bv. 4 str. 292] gi|260762033|ref|ZP_05874376.1| preprotein translocase subunit SecE [Brucella abortus bv. 2 str. 86/8/59] gi|260884000|ref|ZP_05895614.1| preprotein translocase subunit SecE [Brucella abortus bv. 9 str. C68] gi|261314032|ref|ZP_05953229.1| preprotein translocase subunit SecE [Brucella pinnipedialis M163/99/10] gi|261317881|ref|ZP_05957078.1| preprotein translocase subunit SecE [Brucella pinnipedialis B2/94] gi|261325333|ref|ZP_05964530.1| preprotein translocase subunit SecE [Brucella neotomae 5K33] gi|261752557|ref|ZP_05996266.1| preprotein translocase subunit SecE [Brucella suis bv. 5 str. 513] gi|261755215|ref|ZP_05998924.1| preprotein translocase subunit SecE [Brucella suis bv. 3 str. 686] gi|261758438|ref|ZP_06002147.1| protein secE/sec61-gamma protein [Brucella sp. F5/99] gi|265984305|ref|ZP_06097040.1| preprotein translocase subunit SecE [Brucella sp. 83/13] gi|265988910|ref|ZP_06101467.1| preprotein translocase subunit SecE [Brucella pinnipedialis M292/94/1] gi|265991324|ref|ZP_06103881.1| preprotein translocase subunit SecE [Brucella melitensis bv. 1 str. Rev.1] gi|265995161|ref|ZP_06107718.1| preprotein translocase subunit SecE [Brucella melitensis bv. 3 str. Ether] gi|265998374|ref|ZP_06110931.1| preprotein translocase subunit SecE [Brucella ceti M490/95/1] gi|294852585|ref|ZP_06793258.1| preprotein translocase [Brucella sp. NVSL 07-0026] gi|306838949|ref|ZP_07471774.1| preprotein translocase, SecE subunit [Brucella sp. NF 2653] gi|306844154|ref|ZP_07476748.1| preprotein translocase, SecE subunit [Brucella sp. BO1] gi|151561159|gb|ABS14657.1| preprotein translocase, SecE subunit [Ochrobactrum anthropi ATCC 49188] gi|161336016|gb|ABX62321.1| preprotein translocase, SecE subunit [Brucella canis ATCC 23365] gi|163674237|gb|ABY38348.1| preprotein translocase, SecE subunit [Brucella suis ATCC 23445] gi|189019968|gb|ACD72690.1| Protein secE/sec61-gamma protein [Brucella abortus S19] gi|225641111|gb|ACO01025.1| preprotein translocase, SecE subunit [Brucella melitensis ATCC 23457] gi|260095755|gb|EEW79632.1| secE/sec61-gamma protein [Brucella abortus NCTC 8038] gi|260151570|gb|EEW86664.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260155743|gb|EEW90823.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260668524|gb|EEX55464.1| preprotein translocase subunit SecE [Brucella abortus bv. 4 str. 292] gi|260672465|gb|EEX59286.1| preprotein translocase subunit SecE [Brucella abortus bv. 2 str. 86/8/59] gi|260675098|gb|EEX61919.1| preprotein translocase subunit SecE [Brucella abortus bv. 6 str. 870] gi|260873528|gb|EEX80597.1| preprotein translocase subunit SecE [Brucella abortus bv. 9 str. C68] gi|261297104|gb|EEY00601.1| preprotein translocase subunit SecE [Brucella pinnipedialis B2/94] gi|261301313|gb|EEY04810.1| preprotein translocase subunit SecE [Brucella neotomae 5K33] gi|261303058|gb|EEY06555.1| preprotein translocase subunit SecE [Brucella pinnipedialis M163/99/10] gi|261738422|gb|EEY26418.1| protein secE/sec61-gamma protein [Brucella sp. F5/99] gi|261742310|gb|EEY30236.1| preprotein translocase subunit SecE [Brucella suis bv. 5 str. 513] gi|261744968|gb|EEY32894.1| preprotein translocase subunit SecE [Brucella suis bv. 3 str. 686] gi|262552842|gb|EEZ08832.1| preprotein translocase subunit SecE [Brucella ceti M490/95/1] gi|262766274|gb|EEZ12063.1| preprotein translocase subunit SecE [Brucella melitensis bv. 3 str. Ether] gi|263002108|gb|EEZ14683.1| preprotein translocase subunit SecE [Brucella melitensis bv. 1 str. Rev.1] gi|263093878|gb|EEZ17829.1| protein secE/sec61-gamma protein [Brucella melitensis bv. 2 str. 63/9] gi|264661107|gb|EEZ31368.1| preprotein translocase subunit SecE [Brucella pinnipedialis M292/94/1] gi|264662897|gb|EEZ33158.1| preprotein translocase subunit SecE [Brucella sp. 83/13] gi|294821174|gb|EFG38173.1| preprotein translocase [Brucella sp. NVSL 07-0026] gi|306275597|gb|EFM57329.1| preprotein translocase, SecE subunit [Brucella sp. BO1] gi|306405982|gb|EFM62236.1| preprotein translocase, SecE subunit [Brucella sp. NF 2653] gi|326409271|gb|ADZ66336.1| Protein secE/sec61-gamma protein [Brucella melitensis M28] Length = 66 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 26/59 (44%), Positives = 43/59 (72%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + FF+QVR E+ K+ WP+R E ++S I+V+IM +++ FF + DQ + + + FILG+GR Sbjct: 8 ITFFQQVRAETAKVTWPTRRETVISTIMVVIMAFLAAAFFFLADQLMAYGVEFILGLGR 66 >gi|261214244|ref|ZP_05928525.1| preprotein translocase subunit SecE [Brucella abortus bv. 3 str. Tulya] gi|261219595|ref|ZP_05933876.1| preprotein translocase subunit SecE [Brucella ceti M13/05/1] gi|261222408|ref|ZP_05936689.1| preprotein translocase subunit SecE [Brucella ceti B1/94] gi|261322090|ref|ZP_05961287.1| preprotein translocase subunit SecE [Brucella ceti M644/93/1] gi|260915851|gb|EEX82712.1| preprotein translocase subunit SecE [Brucella abortus bv. 3 str. Tulya] gi|260920992|gb|EEX87645.1| preprotein translocase subunit SecE [Brucella ceti B1/94] gi|260924684|gb|EEX91252.1| preprotein translocase subunit SecE [Brucella ceti M13/05/1] gi|261294780|gb|EEX98276.1| preprotein translocase subunit SecE [Brucella ceti M644/93/1] gi|326538980|gb|ADZ87195.1| preprotein translocase, SecE subunit [Brucella melitensis M5-90] Length = 74 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 26/59 (44%), Positives = 43/59 (72%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + FF+QVR E+ K+ WP+R E ++S I+V+IM +++ FF + DQ + + + FILG+GR Sbjct: 16 ITFFQQVRAETAKVTWPTRRETVISTIMVVIMAFLAAAFFFLADQLMAYGVEFILGLGR 74 >gi|158422505|ref|YP_001523797.1| putative translocation complex protein [Azorhizobium caulinodans ORS 571] gi|158329394|dbj|BAF86879.1| putative translocation complex protein [Azorhizobium caulinodans ORS 571] Length = 139 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 26/58 (44%), Positives = 42/58 (72%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + FF+QVR E+ K+ WPSR E L++ +V +M+ ++S+FFLV+DQ + + + IL IG Sbjct: 81 VEFFQQVRTETAKVTWPSRRETLITTAMVFVMVLLASIFFLVVDQILRFGVSQILSIG 138 >gi|13470536|ref|NP_102104.1| preprotein translocase subunit SecE [Mesorhizobium loti MAFF303099] gi|14021277|dbj|BAB47890.1| secretion protein; SecE [Mesorhizobium loti MAFF303099] Length = 67 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 25/57 (43%), Positives = 37/57 (64%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 F +QVR E+ K+ WPSR E ++S ++V+ I+ +FF DQ +G + ILGIGR Sbjct: 11 FLQQVRSETAKVTWPSRRETMISTVMVLAFAVIAMIFFFSADQLMGLAIEQILGIGR 67 >gi|17987026|ref|NP_539660.1| preprotein translocase subunit SecE [Brucella melitensis bv. 1 str. 16M] gi|23502127|ref|NP_698254.1| preprotein translocase subunit SecE [Brucella suis 1330] gi|62290160|ref|YP_221953.1| preprotein translocase subunit SecE [Brucella abortus bv. 1 str. 9-941] gi|82700082|ref|YP_414656.1| preprotein translocase subunit SecE [Brucella melitensis biovar Abortus 2308] gi|225627718|ref|ZP_03785755.1| preprotein translocase, SecE subunit [Brucella ceti str. Cudo] gi|237815668|ref|ZP_04594665.1| preprotein translocase, SecE subunit [Brucella abortus str. 2308 A] gi|256369672|ref|YP_003107182.1| translocase [Brucella microti CCM 4915] gi|297248554|ref|ZP_06932272.1| preprotein translocase SecE subunit [Brucella abortus bv. 5 str. B3196] gi|306840284|ref|ZP_07473057.1| preprotein translocase, SecE subunit [Brucella sp. BO2] gi|17982680|gb|AAL51924.1| protein translocase subunit sece [Brucella melitensis bv. 1 str. 16M] gi|23348089|gb|AAN30169.1| preprotein translocase, SecE subunit [Brucella suis 1330] gi|62196292|gb|AAX74592.1| SecE, preprotein translocase, SecE subunit [Brucella abortus bv. 1 str. 9-941] gi|82616183|emb|CAJ11226.1| Protein secE/sec61-gamma protein:SecE subunit of protein translocation complex [Brucella melitensis biovar Abortus 2308] gi|225617723|gb|EEH14768.1| preprotein translocase, SecE subunit [Brucella ceti str. Cudo] gi|237788966|gb|EEP63177.1| preprotein translocase, SecE subunit [Brucella abortus str. 2308 A] gi|255999834|gb|ACU48233.1| translocase [Brucella microti CCM 4915] gi|297175723|gb|EFH35070.1| preprotein translocase SecE subunit [Brucella abortus bv. 5 str. B3196] gi|306289739|gb|EFM60925.1| preprotein translocase, SecE subunit [Brucella sp. BO2] Length = 79 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 26/59 (44%), Positives = 43/59 (72%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + FF+QVR E+ K+ WP+R E ++S I+V+IM +++ FF + DQ + + + FILG+GR Sbjct: 21 ITFFQQVRAETAKVTWPTRRETVISTIMVVIMAFLAAAFFFLADQLMAYGVEFILGLGR 79 >gi|46202851|ref|ZP_00052494.2| COG0690: Preprotein translocase subunit SecE [Magnetospirillum magnetotacticum MS-1] Length = 65 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 26/56 (46%), Positives = 37/56 (66%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 FFKQVR E K+ WP+R E VS +V +M+ I++VFFLV+DQ + + G+G Sbjct: 9 FFKQVRQEVAKVTWPTRRETTVSTGMVFVMVVIAAVFFLVVDQIFAASVKLLFGLG 64 >gi|319404388|emb|CBI77991.1| preprotein translocase, SecE subunit [Bartonella rochalimae ATCC BAA-1498] Length = 70 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 22/54 (40%), Positives = 41/54 (75%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG 56 V+++ + F KQVR E+ K+ WPSR E ++S ++V+++ +++SVFF V+DQ++ Sbjct: 2 VSKINPITFLKQVRAETAKVKWPSRRETVISTVMVLVVTALASVFFFVVDQTVN 55 >gi|148559680|ref|YP_001259168.1| preprotein translocase subunit SecE [Brucella ovis ATCC 25840] gi|148370937|gb|ABQ60916.1| preprotein translocase, SecE subunit [Brucella ovis ATCC 25840] Length = 79 Score = 56.2 bits (134), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 26/65 (40%), Positives = 45/65 (69%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + FF+QVR E+ K+ WP+R E ++S I+V+IM +++ FF + DQ + + + FI Sbjct: 15 ASKTNPIPFFQQVRAETAKVTWPTRRETVISTIMVVIMAFLAAAFFFLADQLMAYGVEFI 74 Query: 63 LGIGR 67 LG+GR Sbjct: 75 LGLGR 79 >gi|150396193|ref|YP_001326660.1| preprotein translocase subunit SecE [Sinorhizobium medicae WSM419] gi|150027708|gb|ABR59825.1| preprotein translocase, SecE subunit [Sinorhizobium medicae WSM419] Length = 66 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 25/57 (43%), Positives = 38/57 (66%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E +S ++V +M+S ++ FF DQ +GW+M IL +G Sbjct: 9 TFLQQVRSETSKVTWPSRRETTISTLMVFVMVSFAAAFFFGADQLLGWVMSLILNVG 65 >gi|154247286|ref|YP_001418244.1| preprotein translocase, SecE subunit [Xanthobacter autotrophicus Py2] gi|154161371|gb|ABS68587.1| preprotein translocase, SecE subunit [Xanthobacter autotrophicus Py2] Length = 65 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 23/59 (38%), Positives = 42/59 (71%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + FF+QVR E+ K+ WP+R E L++ +V +M+ ++S+FFLV+DQ + + + +L +G Sbjct: 7 VEFFQQVRAETAKVTWPTRRETLITTAMVFVMVFLASIFFLVVDQVLRFGVSTLLTLGH 65 >gi|86357291|ref|YP_469183.1| preprotein translocase subunit SecE [Rhizobium etli CFN 42] gi|86281393|gb|ABC90456.1| protein-export translocase protein [Rhizobium etli CFN 42] Length = 66 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 24/56 (42%), Positives = 40/56 (71%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW++ F+L G Sbjct: 10 FLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWVLSFVLNTG 65 >gi|19110416|gb|AAL82791.1| translocase SecE [Rickettsia typhi] Length = 66 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 25/60 (41%), Positives = 41/60 (68%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + FF+QV+ E+ K+FWP+R E++ S +VV+ + I S+ LV+D SI +M +L IG+ Sbjct: 7 IYKFFEQVKQETYKVFWPNRKELIASTLVVVAAVFIFSLICLVLDYSIHNIMQLLLTIGK 66 >gi|300022528|ref|YP_003755139.1| preprotein translocase subunit SecE [Hyphomicrobium denitrificans ATCC 51888] gi|299524349|gb|ADJ22818.1| preprotein translocase, SecE subunit [Hyphomicrobium denitrificans ATCC 51888] Length = 76 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 23/58 (39%), Positives = 42/58 (72%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + F ++VR E K+ WP EV ++ ++V+IM++ +SVFFL++DQ + ++ F+LG+G Sbjct: 18 ITFIQEVRQEVSKVTWPKWKEVWITTLMVLIMVAFASVFFLLVDQVLSHIVRFVLGVG 75 >gi|15965095|ref|NP_385448.1| preprotein translocase subunit SecE [Sinorhizobium meliloti 1021] gi|307314830|ref|ZP_07594423.1| preprotein translocase, SecE subunit [Sinorhizobium meliloti BL225C] gi|307322129|ref|ZP_07601503.1| preprotein translocase, SecE subunit [Sinorhizobium meliloti AK83] gi|15074275|emb|CAC45921.1| Putative preprotein translocase SecE subunit transmembrane [Sinorhizobium meliloti 1021] gi|306892214|gb|EFN23026.1| preprotein translocase, SecE subunit [Sinorhizobium meliloti AK83] gi|306898944|gb|EFN29591.1| preprotein translocase, SecE subunit [Sinorhizobium meliloti BL225C] Length = 66 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 25/56 (44%), Positives = 38/56 (67%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E +S ++V +M+S ++ FF DQ +GW+M IL +G Sbjct: 10 FLQQVRAETSKVTWPSRRETTISTLMVFVMVSFAAAFFFGADQLLGWVMSLILNVG 65 >gi|239832137|ref|ZP_04680466.1| preprotein translocase, SecE subunit [Ochrobactrum intermedium LMG 3301] gi|239824404|gb|EEQ95972.1| preprotein translocase, SecE subunit [Ochrobactrum intermedium LMG 3301] Length = 183 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 26/65 (40%), Positives = 45/65 (69%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + FF+QVR E+ K+ WP+R E ++S I+V+IM +++ FF + DQ + + + FI Sbjct: 119 ASKTNPITFFQQVRAETAKVTWPTRRETVISTIMVVIMAFLAAAFFFLADQLMAYGVEFI 178 Query: 63 LGIGR 67 LG+GR Sbjct: 179 LGLGR 183 >gi|83594033|ref|YP_427785.1| preprotein translocase subunit SecE [Rhodospirillum rubrum ATCC 11170] gi|83576947|gb|ABC23498.1| protein translocase subunit secE/sec61 gamma [Rhodospirillum rubrum ATCC 11170] Length = 65 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 25/57 (43%), Positives = 39/57 (68%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E K+ WPSR E ++S ++V IM S+++VFFL++D + + FI G+G Sbjct: 8 QFVRQVRQEIGKVTWPSRKETVISTVMVFIMASLAAVFFLLVDWILAEGVQFIFGLG 64 >gi|319405862|emb|CBI79494.1| preprotein translocase, SecE subunit [Bartonella sp. AR 15-3] Length = 70 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 40/53 (75%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG 56 +++ + F KQVR E+ K+ WP+R E ++S ++V+I+ +++SVFF V+DQ++ Sbjct: 3 SKINPITFLKQVRAETAKVKWPTRRETVISTVMVLIVTALASVFFFVVDQTVN 55 >gi|315499730|ref|YP_004088533.1| preprotein translocase, sece subunit [Asticcacaulis excentricus CB 48] gi|315417742|gb|ADU14382.1| preprotein translocase, SecE subunit [Asticcacaulis excentricus CB 48] Length = 100 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 22/64 (34%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R + FF +VR E++KI W SR E ++ ++V IM+ ++ FF ++D +G+ ++ ++ Sbjct: 37 KRTSPAKFFSEVRQEARKITWTSRKETWITTVMVFIMVVVACAFFYIVDGGLGFAVNSLI 96 Query: 64 GIGR 67 IGR Sbjct: 97 NIGR 100 >gi|325293352|ref|YP_004279216.1| preprotein translocase subunit secE [Agrobacterium sp. H13-3] gi|325061205|gb|ADY64896.1| probable preprotein translocase subunit secE [Agrobacterium sp. H13-3] Length = 66 Score = 55.5 bits (132), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 25/58 (43%), Positives = 40/58 (68%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 F +QVR E+ KI WPSR E ++S +V++M+ +++FF DQ IGW++ +L +GR Sbjct: 9 TFLQQVRAEASKITWPSRRETMISTAMVLVMVIFAALFFFAADQLIGWVLSLVLNVGR 66 >gi|218677876|ref|ZP_03525773.1| preprotein translocase subunit SecE [Rhizobium etli CIAT 894] Length = 68 Score = 55.5 bits (132), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/56 (42%), Positives = 40/56 (71%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW++ F+L G Sbjct: 12 FLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWVLSFVLNTG 67 >gi|190891341|ref|YP_001977883.1| protein-export translocase protein [Rhizobium etli CIAT 652] gi|218512770|ref|ZP_03509610.1| preprotein translocase subunit SecE [Rhizobium etli 8C-3] gi|190696620|gb|ACE90705.1| protein-export translocase protein [Rhizobium etli CIAT 652] gi|327194520|gb|EGE61378.1| protein-export translocase protein [Rhizobium etli CNPAF512] Length = 66 Score = 55.5 bits (132), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/56 (42%), Positives = 40/56 (71%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW++ F+L G Sbjct: 10 FLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWVLSFVLNTG 65 >gi|218463230|ref|ZP_03503321.1| preprotein translocase subunit SecE [Rhizobium etli Kim 5] Length = 65 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/56 (42%), Positives = 40/56 (71%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW++ F+L G Sbjct: 10 FLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWVLSFVLNTG 65 >gi|209884792|ref|YP_002288649.1| preprotein translocase, SecE subunit [Oligotropha carboxidovorans OM5] gi|209872988|gb|ACI92784.1| preprotein translocase, SecE subunit [Oligotropha carboxidovorans OM5] Length = 63 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 40/57 (70%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F ++V E+ K+ WP+R E L++ ++V +++ ++++FF V DQ I L+ F+LGI Sbjct: 6 LKFLQEVNSETSKVIWPTRRETLITTVMVFVLVIVAALFFFVTDQVIRMLITFVLGI 62 >gi|51473333|ref|YP_067090.1| preprotein translocase subunit SecE [Rickettsia typhi str. Wilmington] gi|81610831|sp|Q68XN4|SECE_RICTY RecName: Full=Preprotein translocase subunit secE gi|51459645|gb|AAU03608.1| preprotein translocase SecE subunit [Rickettsia typhi str. Wilmington] Length = 66 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 25/58 (43%), Positives = 40/58 (68%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 FF+QV+ E+ K+FWP+R E++ S +VV+ + I S+ LV+D SI +M +L IG+ Sbjct: 9 KFFEQVKQETYKVFWPNRKELIASTLVVVAAVFIFSLICLVLDYSIHNIMQLLLTIGK 66 >gi|316933505|ref|YP_004108487.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris DX-1] gi|315601219|gb|ADU43754.1| preprotein translocase, SecE subunit [Rhodopseudomonas palustris DX-1] Length = 62 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 38/56 (67%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++VR E+ K+ WP+R E ++ I+V +M++++S+FF DQ I L+ +LG+ Sbjct: 7 KFLQEVRSETAKVTWPTRRETSITTIMVFVMVALASIFFFAADQVISLLIRLVLGV 62 >gi|241204151|ref|YP_002975247.1| preprotein translocase subunit SecE [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240858041|gb|ACS55708.1| preprotein translocase, SecE subunit [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 66 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/57 (42%), Positives = 39/57 (68%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW + F+L G Sbjct: 9 TFLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWALSFVLNTG 65 >gi|116251525|ref|YP_767363.1| preprotein translocase subunit SecE [Rhizobium leguminosarum bv. viciae 3841] gi|115256173|emb|CAK07254.1| putative transmembrane translocase SecE subunit [Rhizobium leguminosarum bv. viciae 3841] Length = 71 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/56 (42%), Positives = 39/56 (69%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW + F+L G Sbjct: 15 FLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWALSFVLNTG 70 >gi|209548921|ref|YP_002280838.1| preprotein translocase subunit SecE [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209534677|gb|ACI54612.1| preprotein translocase, SecE subunit [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 66 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 24/56 (42%), Positives = 39/56 (69%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW + F+L G Sbjct: 10 FLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWALSFVLNTG 65 >gi|90424963|ref|YP_533333.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris BisB18] gi|90106977|gb|ABD89014.1| protein translocase subunit secE/sec61 gamma [Rhodopseudomonas palustris BisB18] Length = 63 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 23/57 (40%), Positives = 38/57 (66%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++VR E+ K+ WPSR E ++ I+V +M++++S+FF DQ I + F+LGI Sbjct: 6 FKFLQEVRTETSKVTWPSRRETTITTIMVFVMVALASIFFFFADQIIRLFITFLLGI 62 >gi|217979959|ref|YP_002364106.1| preprotein translocase, SecE subunit [Methylocella silvestris BL2] gi|217505335|gb|ACK52744.1| preprotein translocase, SecE subunit [Methylocella silvestris BL2] Length = 63 Score = 55.1 bits (131), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 42/58 (72%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 F ++VR E+ K+ WP+R E +++ +VI+M+ +S+FF+ +DQ++ + + ++G+GR Sbjct: 6 QFIQEVRTEAGKVTWPTRRETMITTGLVILMVLFASLFFVAVDQTLRFAVTLLMGLGR 63 >gi|75675536|ref|YP_317957.1| preprotein translocase subunit SecE [Nitrobacter winogradskyi Nb-255] gi|74420406|gb|ABA04605.1| protein translocase subunit secE/sec61 gamma [Nitrobacter winogradskyi Nb-255] Length = 63 Score = 55.1 bits (131), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 23/57 (40%), Positives = 38/57 (66%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++VR E+ K+ WPSR E V+ I+V +M++++S+FF DQ I + F+LG+ Sbjct: 6 FKFLQEVRTETAKVTWPSRRETTVTTIMVFVMVALASIFFFFTDQIIRVFITFVLGL 62 >gi|67459544|ref|YP_247168.1| preprotein translocase subunit SecE [Rickettsia felis URRWXCal2] gi|67005077|gb|AAY62003.1| Preprotein translocase SecE subunit [Rickettsia felis URRWXCal2] Length = 98 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 24/60 (40%), Positives = 41/60 (68%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L IG+ Sbjct: 39 IYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMQLLLNIGK 98 >gi|157964200|ref|YP_001499024.1| preprotein translocase subunit SecE [Rickettsia massiliae MTU5] gi|157843976|gb|ABV84477.1| Preprotein translocase SecE subunit [Rickettsia massiliae MTU5] Length = 102 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 24/60 (40%), Positives = 41/60 (68%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L IG+ Sbjct: 43 IYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMQLLLNIGK 102 >gi|15892098|ref|NP_359812.1| preprotein translocase subunit SecE [Rickettsia conorii str. Malish 7] gi|15619222|gb|AAL02713.1| preprotein translocase SecE subunit [Rickettsia conorii str. Malish 7] Length = 84 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 24/60 (40%), Positives = 41/60 (68%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L IG+ Sbjct: 25 IYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMQLLLNIGK 84 >gi|238650691|ref|YP_002916544.1| preprotein translocase subunit SecE [Rickettsia peacockii str. Rustic] gi|238624789|gb|ACR47495.1| preprotein translocase subunit SecE [Rickettsia peacockii str. Rustic] Length = 84 Score = 54.7 bits (130), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 24/60 (40%), Positives = 41/60 (68%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L IG+ Sbjct: 25 IYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMQLLLNIGK 84 >gi|15604010|ref|NP_220525.1| preprotein translocase subunit SecE [Rickettsia prowazekii str. Madrid E] gi|1711361|sp|P50054|SECE_RICPR RecName: Full=Preprotein translocase subunit secE gi|987967|emb|CAA90885.1| SecE protein [Rickettsia prowazekii] gi|3860701|emb|CAA14602.1| unknown (secE) [Rickettsia prowazekii] gi|292571728|gb|ADE29643.1| Preprotein translocase SecE subunit [Rickettsia prowazekii Rp22] Length = 66 Score = 54.3 bits (129), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 24/60 (40%), Positives = 41/60 (68%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + FF+QV+ E+ K+FWP++ E++ S +VV+ + I S+ LV+D SI +M +L IG+ Sbjct: 7 IYKFFEQVKQETYKVFWPNKKELIASTLVVVATVFIFSLICLVLDYSIHNIMQLLLTIGK 66 >gi|34580871|ref|ZP_00142351.1| preprotein translocase SecE subunit [Rickettsia sibirica 246] gi|229586373|ref|YP_002844874.1| preprotein translocase subunit SecE [Rickettsia africae ESF-5] gi|75442741|sp|Q7B6T4|SECE_RICSI RecName: Full=Preprotein translocase subunit secE gi|75444377|sp|Q7WWR6|SECE_RICPA RecName: Full=Preprotein translocase subunit secE gi|75448064|sp|Q8KHU8|SECE_RICRH RecName: Full=Preprotein translocase subunit secE gi|124053381|sp|Q92J92|SECE_RICCN RecName: Full=Preprotein translocase subunit secE gi|124053382|sp|Q4UKC8|SECE_RICFE RecName: Full=Preprotein translocase subunit secE gi|22087295|gb|AAM90916.1|AF502171_2 preprotein translocase SecE subunit [Rickettsia parkeri] gi|22087299|gb|AAM90918.1|AF502172_2 preprotein translocase SecE subunit [Rickettsia sibirica] gi|22087303|gb|AAM90920.1|AF502173_2 preprotein translocase SecE subunit [Rickettsia rhipicephali] gi|28262256|gb|EAA25760.1| preprotein translocase SecE subunit [Rickettsia sibirica 246] gi|228021423|gb|ACP53131.1| Preprotein translocase SecE subunit [Rickettsia africae ESF-5] Length = 66 Score = 54.3 bits (129), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 24/64 (37%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L Sbjct: 3 KEYKIYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMQLLL 62 Query: 64 GIGR 67 IG+ Sbjct: 63 NIGK 66 >gi|92117078|ref|YP_576807.1| preprotein translocase subunit SecE [Nitrobacter hamburgensis X14] gi|91799972|gb|ABE62347.1| protein translocase subunit secE/sec61 gamma [Nitrobacter hamburgensis X14] Length = 63 Score = 54.3 bits (129), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 23/57 (40%), Positives = 38/57 (66%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++VR E+ K+ WPSR E V+ I+V +M++++S+FF DQ I + F+LG+ Sbjct: 6 FKFLQEVRTETAKVTWPSRRETTVTTIMVFVMVALASLFFFFTDQIIRIFITFVLGL 62 >gi|85715150|ref|ZP_01046134.1| SecE subunit of protein translocation complex [Nitrobacter sp. Nb-311A] gi|85698065|gb|EAQ35938.1| SecE subunit of protein translocation complex [Nitrobacter sp. Nb-311A] Length = 63 Score = 54.3 bits (129), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 23/57 (40%), Positives = 38/57 (66%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++VR E+ K+ WPSR E V+ I+V +M++++S+FF DQ I + F+LG+ Sbjct: 6 FKFLQEVRTETAKVSWPSRRETTVTTIMVFVMVALASIFFFFTDQIIRVFITFVLGL 62 >gi|157803321|ref|YP_001491870.1| preprotein translocase subunit SecE [Rickettsia canadensis str. McKiel] gi|157784584|gb|ABV73085.1| preprotein translocase subunit SecE [Rickettsia canadensis str. McKiel] Length = 87 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 24/60 (40%), Positives = 41/60 (68%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L IG+ Sbjct: 28 IYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMKLLLNIGK 87 >gi|262277082|ref|ZP_06054875.1| preprotein translocase, SecE subunit [alpha proteobacterium HIMB114] gi|262224185|gb|EEY74644.1| preprotein translocase, SecE subunit [alpha proteobacterium HIMB114] Length = 60 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 25/56 (44%), Positives = 39/56 (69%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +NFF+ V+ E+ KI WPSR E L+ + VI M I+S+FFL++DQ + + F++G Sbjct: 5 INFFRSVKQEAFKITWPSRKETLMGSVTVIFMAIIASLFFLLLDQIFKFGLGFLIG 60 >gi|192292064|ref|YP_001992669.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris TIE-1] gi|192285813|gb|ACF02194.1| preprotein translocase, SecE subunit [Rhodopseudomonas palustris TIE-1] Length = 62 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 38/56 (67%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++VR E+ K+ WP+R E ++ I+V +M++++S+FF DQ I L+ +LG+ Sbjct: 7 KFLQEVRSETAKVTWPTRRETSITTIMVFVMVALASIFFFAADQVISVLIRLLLGV 62 >gi|157828049|ref|YP_001494291.1| preprotein translocase subunit SecE [Rickettsia rickettsii str. 'Sheila Smith'] gi|165932746|ref|YP_001649535.1| preprotein translocase subunit SecE [Rickettsia rickettsii str. Iowa] gi|75448743|sp|Q8KTC0|SECE_RICRI RecName: Full=Preprotein translocase subunit secE gi|22087291|gb|AAM90914.1|AF502170_2 preprotein translocase SecE subunit [Rickettsia rickettsii] gi|157800530|gb|ABV75783.1| preprotein translocase subunit SecE [Rickettsia rickettsii str. 'Sheila Smith'] gi|165907833|gb|ABY72129.1| protein translocase subunit [Rickettsia rickettsii str. Iowa] Length = 66 Score = 53.9 bits (128), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 24/64 (37%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L Sbjct: 3 KEYKIYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLTCLVLDYSIHNIMQLLL 62 Query: 64 GIGR 67 IG+ Sbjct: 63 NIGK 66 >gi|254470305|ref|ZP_05083709.1| preprotein translocase, SecE subunit [Pseudovibrio sp. JE062] gi|211960616|gb|EEA95812.1| preprotein translocase, SecE subunit [Pseudovibrio sp. JE062] Length = 63 Score = 53.9 bits (128), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 22/55 (40%), Positives = 37/55 (67%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F +QVR E+ K+ WP+R E V+ ++V IM+ ++++FFL DQ + W + +LG Sbjct: 8 TFIQQVRSETAKVTWPTRKETGVTTLMVFIMVFLAAMFFLAADQLMSWGISLVLG 62 >gi|329890178|ref|ZP_08268521.1| preprotein translocase, SecE subunit [Brevundimonas diminuta ATCC 11568] gi|328845479|gb|EGF95043.1| preprotein translocase, SecE subunit [Brevundimonas diminuta ATCC 11568] Length = 99 Score = 53.9 bits (128), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 22/64 (34%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ F +VR E++KI WPSR E ++ ++V IM+ I++ FF ++D +G+ IL Sbjct: 36 KKTSIPQFISEVRAEARKIVWPSRKETWITSVMVFIMVLIAAAFFWIVDTGLGFASRIIL 95 Query: 64 GIGR 67 +G+ Sbjct: 96 SLGQ 99 >gi|39936338|ref|NP_948614.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris CGA009] gi|39650193|emb|CAE28716.1| preprotein translocase, SecE subunit [Rhodopseudomonas palustris CGA009] Length = 83 Score = 53.5 bits (127), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 38/56 (67%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++VR E+ K+ WP+R E ++ I+V +M++++S+FF DQ I L+ +LG+ Sbjct: 28 KFLQEVRSETAKVTWPTRRETSITTIMVFVMVALTSIFFFAADQVISVLIRLLLGV 83 >gi|114771285|ref|ZP_01448705.1| translocase [alpha proteobacterium HTCC2255] gi|114548210|gb|EAU51097.1| translocase [alpha proteobacterium HTCC2255] Length = 65 Score = 53.5 bits (127), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 25/62 (40%), Positives = 38/62 (61%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R L F +QVR E K+ WP+R E ++ ++V IM ++ ++FF DQ I ++ ILG Sbjct: 3 RTNPLQFMQQVRAEVSKVVWPNRRETTITTVMVFIMATLVAIFFFGADQIIKLGLNIILG 62 Query: 65 IG 66 IG Sbjct: 63 IG 64 >gi|146340038|ref|YP_001205086.1| putative preprotein translocase secE subunit [Bradyrhizobium sp. ORS278] gi|146192844|emb|CAL76849.1| putative preprotein translocase secE subunit [Bradyrhizobium sp. ORS278] Length = 52 Score = 53.5 bits (127), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 23/50 (46%), Positives = 36/50 (72%) Query: 16 RDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 R E+ K+ WPSR EV ++ I+V +M++++SVFF DQ I +L+ +LGI Sbjct: 2 RSETAKVSWPSRREVTITTIMVFVMVALASVFFFAADQIIRYLITLVLGI 51 >gi|148256409|ref|YP_001240994.1| protein translocase subunit secE/sec61 gamma [Bradyrhizobium sp. BTAi1] gi|146408582|gb|ABQ37088.1| protein translocase subunit secE/sec61 gamma [Bradyrhizobium sp. BTAi1] Length = 52 Score = 53.5 bits (127), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 36/50 (72%) Query: 16 RDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 R E+ K+ WPSR EV ++ I+V +M++++S+FF DQ I +L+ +LGI Sbjct: 2 RSETAKVTWPSRREVTITTIMVFVMVALASIFFFAADQIIRYLITLVLGI 51 >gi|75448742|sp|Q8KTB5|SECE_RICMO RecName: Full=Preprotein translocase subunit secE gi|22087307|gb|AAM90922.1|AF502174_2 preprotein translocase SecE subunit [Rickettsia montanensis] Length = 66 Score = 53.5 bits (127), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 24/64 (37%), Positives = 40/64 (62%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S LV+D SI +M +L Sbjct: 3 KEYKIYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSPICLVLDYSIHNIMQLLL 62 Query: 64 GIGR 67 IG+ Sbjct: 63 NIGK 66 >gi|319407389|emb|CBI81040.1| preprotein translocase, SecE subunit [Bartonella sp. 1-1C] Length = 70 Score = 53.5 bits (127), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 20/53 (37%), Positives = 39/53 (73%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG 56 +++ + F KQVR E+ K+ WPSR E ++S ++V+++ +++SV F V+DQ++ Sbjct: 3 SKINPITFLKQVRAETAKVKWPSRRETVISTVMVLVVTALASVLFFVVDQTVN 55 >gi|260432411|ref|ZP_05786382.1| preprotein translocase, SecE subunit [Silicibacter lacuscaerulensis ITI-1157] gi|260416239|gb|EEX09498.1| preprotein translocase, SecE subunit [Silicibacter lacuscaerulensis ITI-1157] Length = 65 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 23/56 (41%), Positives = 38/56 (67%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QVR E K+ WP+R EVL++ ++V IM ++++VFF ++D I + ILG Sbjct: 7 IQFIQQVRAEVAKVVWPTRREVLLTTVMVFIMAALTAVFFALVDLGIRGGLQLILG 62 >gi|329850797|ref|ZP_08265642.1| preprotein translocase, SecE subunit [Asticcacaulis biprosthecum C19] gi|328841112|gb|EGF90683.1| preprotein translocase, SecE subunit [Asticcacaulis biprosthecum C19] Length = 105 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 38/58 (65%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + FF +VR E++KI W SR E V+ + V+IM+ ++ FF ++D ++GW ++ +G Sbjct: 47 MKFFSEVRQEARKITWTSRKETWVTTVFVMIMVVLAGFFFFIVDAALGWGSSWLTKLG 104 >gi|254500990|ref|ZP_05113141.1| preprotein translocase, SecE subunit [Labrenzia alexandrii DFL-11] gi|222437061|gb|EEE43740.1| preprotein translocase, SecE subunit [Labrenzia alexandrii DFL-11] Length = 53 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 23/51 (45%), Positives = 36/51 (70%) Query: 16 RDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 R E+ K+ WP+R E V+ ++V IM+ I+S+FFLV DQ + + +ILG+G Sbjct: 2 RSETSKVTWPTRKETAVTTVMVFIMVMIASIFFLVADQLMSLGIGYILGVG 52 >gi|254509620|ref|ZP_05121687.1| preprotein translocase, SecE subunit [Rhodobacteraceae bacterium KLH11] gi|221533331|gb|EEE36319.1| preprotein translocase, SecE subunit [Rhodobacteraceae bacterium KLH11] Length = 65 Score = 52.8 bits (125), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 38/56 (67%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QVR E K+ WP+R EVL++ ++V IM ++++VFF ++D I + +LG Sbjct: 7 IQFIQQVRAEVAKVVWPTRREVLLTTVMVFIMAALTAVFFALVDLGIRGGLQLVLG 62 >gi|126732294|ref|ZP_01748094.1| preprotein translocase, SecE subunit [Sagittula stellata E-37] gi|126707163|gb|EBA06229.1| preprotein translocase, SecE subunit [Sagittula stellata E-37] Length = 79 Score = 52.8 bits (125), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 26/57 (45%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Query: 2 GVNRLAVLN---FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 G +R+A N F +QVR E KI WP+R EV ++ I+V IM S+++VFF ++D +I Sbjct: 9 GHSRMATTNPLTFIQQVRAEVAKIVWPTRREVTLTSIMVFIMASLTAVFFALVDLAI 65 >gi|304391358|ref|ZP_07373300.1| preprotein translocase, SecE subunit [Ahrensia sp. R2A130] gi|303295587|gb|EFL89945.1| preprotein translocase, SecE subunit [Ahrensia sp. R2A130] Length = 63 Score = 52.8 bits (125), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 21/61 (34%), Positives = 39/61 (63%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +R F +QVR E K+ WP+R E +V+ I+ +I++ ++++FF V+DQ + + F+ Sbjct: 3 SRTNPFTFLQQVRAEVSKVVWPTRKETVVTTIMTLILVFLTAIFFFVVDQLLSYGTGFLF 62 Query: 64 G 64 G Sbjct: 63 G 63 >gi|319408377|emb|CBI82032.1| preprotein translocase, SecE subunit [Bartonella schoenbuchensis R1] Length = 71 Score = 52.4 bits (124), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 21/48 (43%), Positives = 35/48 (72%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG 56 + FFKQV E+ K+ WP+R E +VS ++V+++ + +S+FF V+DQ I Sbjct: 8 ITFFKQVFAETAKVKWPTRRETVVSTVIVLVLAAFASIFFFVVDQVIN 55 >gi|209543488|ref|YP_002275717.1| preprotein translocase subunit SecE [Gluconacetobacter diazotrophicus PAl 5] gi|209531165|gb|ACI51102.1| preprotein translocase, SecE subunit [Gluconacetobacter diazotrophicus PAl 5] Length = 76 Score = 52.0 bits (123), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 23/57 (40%), Positives = 36/57 (63%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F + VR E+ K+ WP+R LV+ V+ M +++SVFF V+DQ IG + + G+G Sbjct: 19 KFVQDVRAEAGKVTWPTRRATLVTTGAVLAMAAMTSVFFFVVDQIIGLGVRELFGLG 75 >gi|296117261|ref|ZP_06835853.1| preprotein translocase, SecE subunit [Gluconacetobacter hansenii ATCC 23769] gi|295976214|gb|EFG83000.1| preprotein translocase, SecE subunit [Gluconacetobacter hansenii ATCC 23769] Length = 99 Score = 52.0 bits (123), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 37/57 (64%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F ++VR E+KK+ WP+R L++ V+ M ++SVFF ++D+ IG + + G+G Sbjct: 42 KFVEEVRAEAKKVTWPTRRATLMTTGAVLAMAGLASVFFFLVDEVIGLGVRKLFGLG 98 >gi|162146513|ref|YP_001600972.1| putative preprotein translocase secE subunit [Gluconacetobacter diazotrophicus PAl 5] gi|161785088|emb|CAP54632.1| putative preprotein translocase secE subunit [Gluconacetobacter diazotrophicus PAl 5] Length = 94 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 23/57 (40%), Positives = 36/57 (63%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F + VR E+ K+ WP+R LV+ V+ M +++SVFF V+DQ IG + + G+G Sbjct: 37 KFVQDVRAEAGKVTWPTRRATLVTTGAVLAMAAMTSVFFFVVDQIIGLGVRELFGLG 93 >gi|110634175|ref|YP_674383.1| preprotein translocase subunit SecE [Mesorhizobium sp. BNC1] gi|9957207|gb|AAG09264.1| SecE [EDTA-degrading bacterium BNC1] gi|110285159|gb|ABG63218.1| protein translocase subunit secE/sec61 gamma [Chelativorans sp. BNC1] Length = 67 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 24/57 (42%), Positives = 38/57 (66%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WPSR E L+S ++V+ +++++FF DQ + W + ILGIG Sbjct: 10 TFLQQVRSETAKVTWPSRRETLISTVMVLAFAALAAIFFFAADQLMAWAIELILGIG 66 >gi|56698339|ref|YP_168712.1| preprotein translocase subunit SecE [Ruegeria pomeroyi DSS-3] gi|56680076|gb|AAV96742.1| preprotein translocase, SecE subunit [Ruegeria pomeroyi DSS-3] Length = 77 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 24/66 (36%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Query: 3 VNRLAVLN---FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 V +A +N F +QVR E K+ WP+R EVL++ ++V IM +++++FF ++D SI + Sbjct: 10 VRHMATINPIQFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALTAIFFALVDLSIRGGL 69 Query: 60 HFILGI 65 + G+ Sbjct: 70 QLLFGM 75 >gi|295688155|ref|YP_003591848.1| preprotein translocase subunit SecE [Caulobacter segnis ATCC 21756] gi|295430058|gb|ADG09230.1| preprotein translocase, SecE subunit [Caulobacter segnis ATCC 21756] Length = 94 Score = 51.6 bits (122), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 21/63 (33%), Positives = 43/63 (68%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R + + FF++VR E++KI W +R E ++ ++V IM+ ++S+FFL +D +G+ ++ +L Sbjct: 29 KRTSPVQFFREVRAEARKITWTTRKETWITSVMVFIMVVMASLFFLAVDGGLGFAVNQLL 88 Query: 64 GIG 66 + Sbjct: 89 KLA 91 >gi|58039758|ref|YP_191722.1| protein translocase subunit SecE [Gluconobacter oxydans 621H] gi|58002172|gb|AAW61066.1| Protein translocase subunit SecE [Gluconobacter oxydans 621H] Length = 83 Score = 51.6 bits (122), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 38/56 (67%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + + VR E+K++ WP+R L++ V++M++++ +FF ++DQ IG + + G+G Sbjct: 27 YVRDVRAEAKRVTWPTRRNTLITSGAVLVMVTVTCIFFFIVDQVIGLGVRELFGVG 82 >gi|221236246|ref|YP_002518683.1| protein translocase subunit SecE [Caulobacter crescentus NA1000] gi|220965419|gb|ACL96775.1| protein translocase subunit secE [Caulobacter crescentus NA1000] Length = 105 Score = 51.6 bits (122), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 22/63 (34%), Positives = 41/63 (65%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R L FF++VR E++KI W +R E ++ ++V IM+ ++S+FF +D IG+ ++ +L Sbjct: 40 KRTNPLQFFREVRAEARKITWTTRKETWITSVMVFIMVVLASLFFTAVDGGIGFAINQLL 99 Query: 64 GIG 66 + Sbjct: 100 KLA 102 >gi|86137178|ref|ZP_01055756.1| preprotein translocase, SecE subunit [Roseobacter sp. MED193] gi|85826502|gb|EAQ46699.1| preprotein translocase, SecE subunit [Roseobacter sp. MED193] Length = 64 Score = 51.2 bits (121), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 25/63 (39%), Positives = 43/63 (68%), Gaps = 3/63 (4%) Query: 6 LAVLN---FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +A LN F +QVR E K+ WP+R EVL++ ++V IM ++++VFF ++D I + + + Sbjct: 1 MATLNPVQFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALTAVFFALVDLVIRFGLQSL 60 Query: 63 LGI 65 LG+ Sbjct: 61 LGM 63 >gi|16127436|ref|NP_422000.1| preprotein translocase, SecE subunit [Caulobacter crescentus CB15] gi|13424884|gb|AAK25168.1| preprotein translocase, SecE subunit [Caulobacter crescentus CB15] Length = 83 Score = 51.2 bits (121), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 22/63 (34%), Positives = 41/63 (65%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R L FF++VR E++KI W +R E ++ ++V IM+ ++S+FF +D IG+ ++ +L Sbjct: 18 KRTNPLQFFREVRAEARKITWTTRKETWITSVMVFIMVVLASLFFTAVDGGIGFAINQLL 77 Query: 64 GIG 66 + Sbjct: 78 KLA 80 >gi|149913527|ref|ZP_01902060.1| preprotein translocase, SecE subunit, putative [Roseobacter sp. AzwK-3b] gi|149812647|gb|EDM72476.1| preprotein translocase, SecE subunit, putative [Roseobacter sp. AzwK-3b] Length = 65 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 22/51 (43%), Positives = 35/51 (68%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 R L F +QVR E K+ WP+R EVL++ ++V IM ++++VFF ++D I Sbjct: 3 RTNPLQFIQQVRAEVAKVVWPTRREVLLTTVMVFIMAALTAVFFALVDLGI 53 >gi|326386499|ref|ZP_08208122.1| protein translocase subunit secE/sec61 gamma [Novosphingobium nitrogenifigens DSM 19370] gi|326209160|gb|EGD59954.1| protein translocase subunit secE/sec61 gamma [Novosphingobium nitrogenifigens DSM 19370] Length = 65 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 36/57 (63%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 FF QV+ E++K+ WP+R E + I V +M+ + SVFFL ID G+++ +L + Sbjct: 8 EFFNQVKAEARKVVWPTRQETTSTAIFVALMMVLLSVFFLGIDSLFGYVVKILLSLA 64 >gi|114570358|ref|YP_757038.1| protein translocase subunit SecE/sec61 gamma [Maricaulis maris MCS10] gi|114340820|gb|ABI66100.1| protein translocase subunit secE/sec61 gamma [Maricaulis maris MCS10] Length = 85 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 36/57 (63%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + QVR E++K+ W +R E LVS ++V+I+ I+ +FF +D I W + IL +G Sbjct: 29 KYLSQVRQEARKVTWTTRQETLVSTVLVLILSVIAMLFFWGVDSLISWTIQTILSLG 85 >gi|170750244|ref|YP_001756504.1| preprotein translocase, SecE subunit [Methylobacterium radiotolerans JCM 2831] gi|170656766|gb|ACB25821.1| preprotein translocase, SecE subunit [Methylobacterium radiotolerans JCM 2831] Length = 98 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 25/62 (40%), Positives = 43/62 (69%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R FF QVRDE++K+ WP+R E ++ I+V +M+ +S+FF V+DQ++ +++ IL Sbjct: 37 KRATPGEFFAQVRDEARKVTWPTRRETTITTIMVFVMVVAASLFFTVVDQALRFVVGLIL 96 Query: 64 GI 65 G+ Sbjct: 97 GV 98 >gi|254486178|ref|ZP_05099383.1| preprotein translocase, SecE subunit [Roseobacter sp. GAI101] gi|214043047|gb|EEB83685.1| preprotein translocase, SecE subunit [Roseobacter sp. GAI101] Length = 65 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 23/55 (41%), Positives = 38/55 (69%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L F +QVR E KI WP+R EV+++ ++V I+ ++++VFF V+D I + +IL Sbjct: 7 LQFIQQVRSEVSKIVWPTRREVMLTTVMVFILAALTAVFFAVVDILIRGGLQYIL 61 >gi|163739417|ref|ZP_02146827.1| preprotein translocase, SecE subunit, putative [Phaeobacter gallaeciensis BS107] gi|163740206|ref|ZP_02147600.1| preprotein translocase, SecE subunit [Phaeobacter gallaeciensis 2.10] gi|254475455|ref|ZP_05088841.1| preprotein translocase, SecE subunit [Ruegeria sp. R11] gi|161386064|gb|EDQ10439.1| preprotein translocase, SecE subunit [Phaeobacter gallaeciensis 2.10] gi|161387170|gb|EDQ11529.1| preprotein translocase, SecE subunit, putative [Phaeobacter gallaeciensis BS107] gi|214029698|gb|EEB70533.1| preprotein translocase, SecE subunit [Ruegeria sp. R11] Length = 65 Score = 50.8 bits (120), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 40/57 (70%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F +QVR E K+ WP+R EVL++ ++V +M ++++VFF ++D I + + ILG+ Sbjct: 7 VQFIQQVRAEVSKVVWPTRREVLLTTVMVFVMAALTAVFFAIVDILIRFGLEGILGM 63 >gi|330991781|ref|ZP_08315731.1| putative preprotein translocase SecE subunit [Gluconacetobacter sp. SXCC-1] gi|329761249|gb|EGG77743.1| putative preprotein translocase SecE subunit [Gluconacetobacter sp. SXCC-1] Length = 64 Score = 50.4 bits (119), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 20/57 (35%), Positives = 36/57 (63%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F + VR E++K+ WP+R L++ V+ M ++SVFF ++D+ IG + + G+G Sbjct: 7 KFVEDVRAEARKVTWPTRRATLMTTGAVLAMAGLASVFFFLVDEVIGLAVRKLFGLG 63 >gi|254294453|ref|YP_003060476.1| preprotein translocase, SecE subunit [Hirschia baltica ATCC 49814] gi|254042984|gb|ACT59779.1| preprotein translocase, SecE subunit [Hirschia baltica ATCC 49814] Length = 67 Score = 50.4 bits (119), Expect = 7e-05, Method: Compositional matrix adjust. Identities = 24/62 (38%), Positives = 37/62 (59%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R FF QVR E +K+ W SR E + + I+V+IM+ +S+FFL+ D + ++ I Sbjct: 6 KRTNPFTFFGQVRAEGRKVTWTSRQETVAATIMVLIMVVFASIFFLLTDWVVSAVVKLIT 65 Query: 64 GI 65 GI Sbjct: 66 GI 67 >gi|254464491|ref|ZP_05077902.1| preprotein translocase, SecE subunit [Rhodobacterales bacterium Y4I] gi|206685399|gb|EDZ45881.1| preprotein translocase, SecE subunit [Rhodobacterales bacterium Y4I] Length = 65 Score = 50.4 bits (119), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 39/56 (69%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F +QVR E K+ WP+R EVL++ ++V IM +++++FF ++D I + + +LG+ Sbjct: 8 QFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALTALFFALVDLLIRYGLQGLLGM 63 >gi|225017231|ref|ZP_03706423.1| hypothetical protein CLOSTMETH_01157 [Clostridium methylpentosum DSM 5476] gi|224950006|gb|EEG31215.1| hypothetical protein CLOSTMETH_01157 [Clostridium methylpentosum DSM 5476] Length = 77 Score = 50.4 bits (119), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 41/57 (71%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + N+FK +R E+KK+ WP++S+++ + I+V++ + + +F ++D +G L++F+L Sbjct: 19 IANYFKDLRSETKKVVWPTKSQIINNTIIVLVTIIVLGIFIALLDFGLGALVNFLLN 75 >gi|126737139|ref|ZP_01752874.1| preprotein translocase, SecE subunit [Roseobacter sp. SK209-2-6] gi|126721724|gb|EBA18427.1| preprotein translocase, SecE subunit [Roseobacter sp. SK209-2-6] Length = 65 Score = 50.4 bits (119), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 22/56 (39%), Positives = 39/56 (69%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F +QVR E K+ WP+R EVL++ ++V IM ++++VFF ++D I + + +LG+ Sbjct: 8 QFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALTAVFFALVDLLIRFGLQGLLGM 63 >gi|110681151|ref|YP_684158.1| preprotein translocase subunit SecE [Roseobacter denitrificans OCh 114] gi|163732874|ref|ZP_02140319.1| preprotein translocase, SecE subunit, putative [Roseobacter litoralis Och 149] gi|109457267|gb|ABG33472.1| preprotein translocase, SecE subunit, putative [Roseobacter denitrificans OCh 114] gi|161394234|gb|EDQ18558.1| preprotein translocase, SecE subunit, putative [Roseobacter litoralis Och 149] Length = 65 Score = 50.4 bits (119), Expect = 8e-05, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 39/57 (68%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F +QVR E K+ WP+R EV+++ ++V I+ ++++VFF ++D I W + +L + Sbjct: 7 LQFIQQVRAEVSKVVWPTRREVMLTTVMVFILAALTAVFFALVDILIRWGLQSVLTM 63 >gi|83854995|ref|ZP_00948525.1| preprotein translocase, SecE subunit [Sulfitobacter sp. NAS-14.1] gi|83941517|ref|ZP_00953979.1| preprotein translocase, SecE subunit [Sulfitobacter sp. EE-36] gi|83842838|gb|EAP82005.1| preprotein translocase, SecE subunit [Sulfitobacter sp. NAS-14.1] gi|83847337|gb|EAP85212.1| preprotein translocase, SecE subunit [Sulfitobacter sp. EE-36] Length = 65 Score = 50.4 bits (119), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 38/56 (67%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 L F +QVR E K+ WP+R EV+++ ++V I+ ++++VFF ++D I + +IL Sbjct: 7 LQFIQQVRSEVSKVVWPTRREVMLTTVMVFILAALTAVFFAIVDILIRGGLQYILA 62 >gi|85706804|ref|ZP_01037895.1| preprotein translocase, SecE subunit [Roseovarius sp. 217] gi|85668597|gb|EAQ23467.1| preprotein translocase, SecE subunit [Roseovarius sp. 217] Length = 73 Score = 50.4 bits (119), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 34/48 (70%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 R L F +QVR E K+ WP+R EV+++ ++V IM +I+++FF ++D Sbjct: 11 RTNPLQFIQQVRSEVAKVVWPTRREVVLTTVMVFIMATITAIFFALVD 58 >gi|121602263|ref|YP_988875.1| preprotein translocase subunit SecE [Bartonella bacilliformis KC583] gi|120614440|gb|ABM45041.1| preprotein translocase, SecE subunit [Bartonella bacilliformis KC583] Length = 67 Score = 50.1 bits (118), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 23/63 (36%), Positives = 40/63 (63%), Gaps = 7/63 (11%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW-------LMHF 61 + F KQVR E KI WP+R E ++S ++V+++ +++S FF ++DQ I + L+ + Sbjct: 5 IAFLKQVRAEITKIKWPTRRETVISTVMVLVVTAVASAFFFIVDQVINFSVWQGIDLLKY 64 Query: 62 ILG 64 I G Sbjct: 65 IFG 67 >gi|85375047|ref|YP_459109.1| preprotein translocase, SecE subunit [Erythrobacter litoralis HTCC2594] gi|84788130|gb|ABC64312.1| preprotein translocase, SecE subunit [Erythrobacter litoralis HTCC2594] Length = 70 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 23/57 (40%), Positives = 37/57 (64%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E+ K+ WP+R E + + I V IM+ I S+FFL ID + G ++ ++L + Sbjct: 14 EFVRQVRSETSKVVWPTREETIRTAIFVGIMVIILSLFFLAIDSAFGAIVRWLLTLA 70 >gi|328543343|ref|YP_004303452.1| Preprotein translocase, SecE subunit [Polymorphum gilvum SL003B-26A1] gi|326413088|gb|ADZ70151.1| Preprotein translocase, SecE subunit [Polymorphum gilvum SL003B-26A1] Length = 65 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 25/57 (43%), Positives = 40/57 (70%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F +QVR E K+ WP+R E V+ ++V +M+ I+S+FFL+ DQ++ W + +LGIG Sbjct: 8 TFVQQVRSEVSKVTWPTRRETAVTTVMVFVMVLIASIFFLLADQAMSWGIGLLLGIG 64 >gi|15643218|ref|NP_228262.1| preprotein translocase SecE subunit [Thermotoga maritima MSB8] gi|148269608|ref|YP_001244068.1| preprotein translocase, SecE subunit [Thermotoga petrophila RKU-1] gi|170288284|ref|YP_001738522.1| preprotein translocase, SecE subunit [Thermotoga sp. RQ2] gi|281411674|ref|YP_003345753.1| preprotein translocase, SecE subunit [Thermotoga naphthophila RKU-10] gi|548915|sp|P35874|SECE_THEMA RecName: Full=Preprotein translocase subunit secE gi|209156623|pdb|3DIN|D Chain D, Crystal Structure Of The Protein-Translocation Complex Formed By The Secy Channel And The Seca Atpase gi|209156627|pdb|3DIN|G Chain G, Crystal Structure Of The Protein-Translocation Complex Formed By The Secy Channel And The Seca Atpase gi|4980958|gb|AAD35535.1|AE001723_5 preprotein translocase SecE subunit [Thermotoga maritima MSB8] gi|407023|emb|CAA77865.1| SecE [Thermotoga maritima MSB8] gi|147735152|gb|ABQ46492.1| protein translocase subunit secE/sec61 gamma [Thermotoga petrophila RKU-1] gi|170175787|gb|ACB08839.1| preprotein translocase, SecE subunit [Thermotoga sp. RQ2] gi|281372777|gb|ADA66339.1| preprotein translocase, SecE subunit [Thermotoga naphthophila RKU-10] Length = 65 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 22/43 (51%), Positives = 34/43 (79%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 FF++V E+KKI WPSR E+L S VV+++L+++SV+F V+D Sbjct: 6 KFFREVIAEAKKISWPSRKELLTSFGVVLVILAVTSVYFFVLD 48 >gi|254459652|ref|ZP_05073068.1| preprotein translocase, SecE subunit, putative [Rhodobacterales bacterium HTCC2083] gi|206676241|gb|EDZ40728.1| preprotein translocase, SecE subunit, putative [Rhodobacteraceae bacterium HTCC2083] Length = 113 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 23/56 (41%), Positives = 38/56 (67%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 L + +QVR E K+ WP+R EV ++ ++V IM ++++VFF VID I + + +LG Sbjct: 54 LQYVQQVRSEVAKVVWPTRREVALTTVMVFIMAALTAVFFAVIDIIIRFGLTSVLG 109 >gi|323136002|ref|ZP_08071085.1| preprotein translocase, SecE subunit [Methylocystis sp. ATCC 49242] gi|322399093|gb|EFY01612.1| preprotein translocase, SecE subunit [Methylocystis sp. ATCC 49242] Length = 62 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 42/58 (72%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 F ++VR E++K+ WPSR E +++ +VI+M+ +S+FF+++D ++ + + +L +G+ Sbjct: 5 QFMQEVRAEARKVTWPSRRETMITTGLVILMVLFASLFFVIVDSALRFGVGLMLRVGQ 62 >gi|87198853|ref|YP_496110.1| protein translocase subunit secE/sec61 gamma [Novosphingobium aromaticivorans DSM 12444] gi|87134534|gb|ABD25276.1| protein translocase subunit secE/sec61 gamma [Novosphingobium aromaticivorans DSM 12444] Length = 64 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 35/57 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 FF QV+ E++K+ WP+R E + I V IM+ I +VFFL +D ++ F+L + Sbjct: 8 EFFNQVKAEARKVVWPTRQETTTTAIFVGIMMLILAVFFLGVDSLFSAIVRFLLSLA 64 >gi|241761256|ref|ZP_04759344.1| preprotein translocase, SecE subunit [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|260752789|ref|YP_003225682.1| preprotein translocase, SecE subunit [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|302858698|ref|YP_003848907.1| preprotein translocase subunit SecE [Zymomonas mobilis subsp. mobilis ZM4] gi|241374163|gb|EER63660.1| preprotein translocase, SecE subunit [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|258552152|gb|ACV75098.1| preprotein translocase, SecE subunit [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|301503261|gb|ADK75088.1| preprotein translocase, SecE subunit [Zymomonas mobilis subsp. mobilis ZM4] Length = 65 Score = 49.3 bits (116), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 35/56 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF+QVR E+ K+ WPSR E +++ ++V IM + VFF +D + ++ +L + Sbjct: 8 EFFRQVRAETAKVVWPSRRETVMTAVMVAIMAILLGVFFFAVDAAFSHVVRLLLSL 63 >gi|149203663|ref|ZP_01880632.1| SecE subunit of protein translocation complex [Roseovarius sp. TM1035] gi|149142780|gb|EDM30822.1| SecE subunit of protein translocation complex [Roseovarius sp. TM1035] Length = 65 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 35/51 (68%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 R + F +QVR E K+ WP+R EV+++ ++V IM +I+++FF ++D I Sbjct: 3 RTNPVQFIQQVRSEVAKVVWPNRREVMLTTVMVFIMATITAIFFALVDLGI 53 >gi|83949813|ref|ZP_00958546.1| preprotein translocase, SecE subunit [Roseovarius nubinhibens ISM] gi|83837712|gb|EAP77008.1| preprotein translocase, SecE subunit [Roseovarius nubinhibens ISM] Length = 65 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/61 (34%), Positives = 38/61 (62%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R F +QVR E K+ WP+R EV ++ ++V IM +++++FF ++D I + +LG Sbjct: 3 RTNPFQFIQQVRSEVAKVVWPTRREVFLTTVMVFIMATLTAIFFALVDLGIRTGLTSVLG 62 Query: 65 I 65 + Sbjct: 63 L 63 >gi|163868083|ref|YP_001609287.1| preprotein translocase subunit SecE [Bartonella tribocorum CIP 105476] gi|161017734|emb|CAK01292.1| preprotein translocase, SecE subunit [Bartonella tribocorum CIP 105476] Length = 70 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 37/53 (69%), Gaps = 4/53 (7%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + F KQV E+ K+ WP+R E ++S I+V+++ +++S FF ++DQ +MHF Sbjct: 8 IAFLKQVYAETVKVKWPTRRETVISTIMVLLVTALASAFFFIVDQ----VMHF 56 >gi|296282314|ref|ZP_06860312.1| preprotein translocase, SecE subunit [Citromicrobium bathyomarinum JL354] Length = 78 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 24/62 (38%), Positives = 38/62 (61%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R + FF QV+ E+ K+ WP+R E + + I V I++ I S+FFL ID G ++ F+L Sbjct: 17 RTSPGEFFNQVKAETSKVVWPTRQETVQTAIFVSILVLILSLFFLGIDTLFGAVVRFLLT 76 Query: 65 IG 66 + Sbjct: 77 LA 78 >gi|114328706|ref|YP_745863.1| protein translocase subunit secE [Granulibacter bethesdensis CGDNIH1] gi|114316880|gb|ABI62940.1| protein translocase subunit secE [Granulibacter bethesdensis CGDNIH1] Length = 80 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/47 (44%), Positives = 29/47 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG 56 F + VR E K+ WPSR E LV+ +V M ++++ FF VIDQ G Sbjct: 23 KFLRDVRSEVSKVTWPSRKETLVTTGLVFAMATLAAAFFFVIDQLAG 69 >gi|163745520|ref|ZP_02152880.1| preprotein translocase, SecE subunit, putative [Oceanibulbus indolifex HEL-45] gi|161382338|gb|EDQ06747.1| preprotein translocase, SecE subunit, putative [Oceanibulbus indolifex HEL-45] Length = 65 Score = 48.9 bits (115), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 21/57 (36%), Positives = 39/57 (68%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F +QVR E K+ WP++ EV+++ ++V I+ ++++VFF ++D I + ILG+ Sbjct: 7 LQFIQQVRTEVAKVVWPTKREVMLTTVMVFILAALTAVFFAIVDILIRGGLQQILGM 63 >gi|240850286|ref|YP_002971679.1| preprotein translocase subunit SecE [Bartonella grahamii as4aup] gi|240267409|gb|ACS50997.1| preprotein translocase subunit SecE [Bartonella grahamii as4aup] Length = 70 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 20/53 (37%), Positives = 37/53 (69%), Gaps = 4/53 (7%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + F KQV E+ K+ WP+R E ++S ++V+++ +++S FF ++DQ +MHF Sbjct: 8 ITFLKQVYAETIKVKWPTRRETVISTVMVLLVTALASAFFFIVDQ----VMHF 56 >gi|91205974|ref|YP_538329.1| preprotein translocase subunit SecE [Rickettsia bellii RML369-C] gi|157826662|ref|YP_001495726.1| preprotein translocase subunit SecE [Rickettsia bellii OSU 85-389] gi|75448741|sp|Q8KTA9|SECE_RICBE RecName: Full=Preprotein translocase subunit secE gi|122425300|sp|Q1RHC4|SECE_RICBR RecName: Full=Preprotein translocase subunit secE gi|22087319|gb|AAM90928.1|AF502177_2 preprotein translocase SecE subunit [Rickettsia bellii] gi|91069518|gb|ABE05240.1| Preprotein translocase SecE subunit [Rickettsia bellii RML369-C] gi|157801966|gb|ABV78689.1| preprotein translocase subunit SecE [Rickettsia bellii OSU 85-389] Length = 66 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 21/64 (32%), Positives = 39/64 (60%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP++ E+ S +VVI+ + + S+ LV+D I ++ +L Sbjct: 3 KEYKIYKFFEQVKQEAYKVVWPTKKELTASTLVVIVAVFVFSLICLVLDYGIHNIIQILL 62 Query: 64 GIGR 67 IG+ Sbjct: 63 NIGK 66 >gi|258541217|ref|YP_003186650.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-01] gi|329114825|ref|ZP_08243582.1| Preprotein Translocase Subunit SecE [Acetobacter pomorum DM001] gi|256632295|dbj|BAH98270.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-01] gi|256635352|dbj|BAI01321.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-03] gi|256638407|dbj|BAI04369.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-07] gi|256641461|dbj|BAI07416.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-22] gi|256644516|dbj|BAI10464.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-26] gi|256647571|dbj|BAI13512.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-32] gi|256650624|dbj|BAI16558.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-01-42C] gi|256653615|dbj|BAI19542.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-12] gi|326695956|gb|EGE47640.1| Preprotein Translocase Subunit SecE [Acetobacter pomorum DM001] Length = 64 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 20/57 (35%), Positives = 34/57 (59%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F VR E++++ WP+R LV+ V+ M ++S+FF +DQ IG + + G+G Sbjct: 7 KFLHDVRAEAERVTWPTRRATLVTTGAVLAMAGMASIFFFFVDQLIGLGVRQLFGLG 63 >gi|157363335|ref|YP_001470102.1| preprotein translocase, SecE subunit [Thermotoga lettingae TMO] gi|157313939|gb|ABV33038.1| preprotein translocase, SecE subunit [Thermotoga lettingae TMO] Length = 65 Score = 48.1 bits (113), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI-GWLMHFILGIG 66 FF++V E+KK WPSR+E+L S VV+++L + V+F V+D G + F+ IG Sbjct: 6 KFFREVAAEAKKTHWPSRNELLTSTSVVVLILVVMGVYFFVLDMVFSGAIRTFLKAIG 63 >gi|119383493|ref|YP_914549.1| preprotein translocase, SecE subunit [Paracoccus denitrificans PD1222] gi|119373260|gb|ABL68853.1| protein translocase subunit secE/sec61 gamma [Paracoccus denitrificans PD1222] Length = 81 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 20/44 (45%), Positives = 31/44 (70%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 + F QVR E KI WP+R EV+ + I+V IM +++S+FF ++D Sbjct: 22 VQFISQVRAELGKITWPTRREVVTTTIMVFIMATLASIFFFLVD 65 >gi|296447966|ref|ZP_06889873.1| preprotein translocase, SecE subunit [Methylosinus trichosporium OB3b] gi|296254533|gb|EFH01653.1| preprotein translocase, SecE subunit [Methylosinus trichosporium OB3b] Length = 63 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 40/58 (68%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 F + VR E+ K+ WP+R E L++ +VI+M+ +S+FF+++D+++ + +L +G+ Sbjct: 6 QFLQDVRSEATKVVWPTRRETLITTGLVILMVLFASLFFVLVDKTLHVAVGLLLRMGQ 63 >gi|260577198|ref|ZP_05845174.1| preprotein translocase, SecE subunit [Rhodobacter sp. SW2] gi|259020578|gb|EEW23898.1| preprotein translocase, SecE subunit [Rhodobacter sp. SW2] Length = 66 Score = 47.8 bits (112), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 32/44 (72%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 L F +QVR E K+ WP+R EV+++ I+V IM ++++ FF ++D Sbjct: 7 LQFIQQVRSEVSKVVWPTRREVMLTTIMVFIMAALAATFFSLVD 50 >gi|126734757|ref|ZP_01750503.1| SecE subunit of protein translocation complex [Roseobacter sp. CCS2] gi|126715312|gb|EBA12177.1| SecE subunit of protein translocation complex [Roseobacter sp. CCS2] Length = 66 Score = 47.8 bits (112), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 33/44 (75%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 + F ++VR E K+ WP+R EVL++ ++V IM ++++VFF ++D Sbjct: 7 MKFIQEVRAEVSKVVWPTRREVLMTTVMVFIMAALTAVFFALVD 50 >gi|49475392|ref|YP_033433.1| preprotein translocase subunit SecE [Bartonella henselae str. Houston-1] gi|49238198|emb|CAF27408.1| Preprotein translocase secE subunit [Bartonella henselae str. Houston-1] Length = 70 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + F KQV E+ K+ WP+R E ++S +V+++ S++S FF ++DQ +MHF Sbjct: 8 ITFLKQVYAETVKVKWPTRRETVISTFMVLLVTSLASAFFFIVDQ----VMHF 56 >gi|325679010|ref|ZP_08158608.1| preprotein translocase, SecE subunit [Ruminococcus albus 8] gi|324109514|gb|EGC03732.1| preprotein translocase, SecE subunit [Ruminococcus albus 8] Length = 84 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 38/56 (67%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 +FK++R E KK+ WP+R +V+ + VV++++S+ +F +D + + + ++G+G Sbjct: 27 YFKELRAELKKVVWPTRQQVVNNTGVVLVVMSLMGLFLFAVDTGLSYGIRALIGLG 82 >gi|37913003|gb|AAR05332.1| predicted preprotein translocase subunit SecE [uncultured marine alpha proteobacterium HOT2C01] Length = 77 Score = 47.8 bits (112), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 20/66 (30%), Positives = 40/66 (60%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + VN + F ++VR E K+ WP+ E L ++V+++ + ++VFFL+IDQ + + Sbjct: 11 LKVNFMKPFKFIQEVRREGSKVTWPTSRETLTGSVMVVLITAFAAVFFLIIDQIFSFGLD 70 Query: 61 FILGIG 66 ++G+ Sbjct: 71 KLIGVA 76 >gi|49474313|ref|YP_032355.1| preprotein translocase subunit SecE [Bartonella quintana str. Toulouse] gi|49239817|emb|CAF26208.1| Preprotein translocase secE subunit [Bartonella quintana str. Toulouse] Length = 70 Score = 47.4 bits (111), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 20/53 (37%), Positives = 36/53 (67%), Gaps = 4/53 (7%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + F KQV E+ K+ WP+R E ++S +V+++ S+++ FF ++DQ +MHF Sbjct: 8 ITFLKQVYAETIKVKWPTRRETVISTFMVLLVTSLAAAFFFIVDQ----IMHF 56 >gi|27380528|ref|NP_772057.1| preprotein translocase subunit SecE [Bradyrhizobium japonicum USDA 110] gi|27353692|dbj|BAC50682.1| preprotein translocase [Bradyrhizobium japonicum USDA 110] Length = 63 Score = 47.4 bits (111), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 23/57 (40%), Positives = 40/57 (70%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++VR E+ K+ WP+R E ++ I+V +M++++S+FF DQ I +L+ F+LGI Sbjct: 6 FKFLQEVRSETAKVTWPTRRETTITTIMVFVMVAVASIFFFAADQIIRYLITFLLGI 62 >gi|257438469|ref|ZP_05614224.1| preprotein translocase, SecE subunit [Faecalibacterium prausnitzii A2-165] gi|257199048|gb|EEU97332.1| preprotein translocase, SecE subunit [Faecalibacterium prausnitzii A2-165] Length = 79 Score = 47.4 bits (111), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 37/57 (64%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FF+ + E KK+ WPS+++V + IVV++ ++I++V + +D G ++ I+G Sbjct: 22 IAKFFRDTKSELKKVVWPSKADVKTNTIVVLVTVAIAAVVMIALDAIFGGILGLIIG 78 >gi|160944619|ref|ZP_02091846.1| hypothetical protein FAEPRAM212_02132 [Faecalibacterium prausnitzii M21/2] gi|158443803|gb|EDP20807.1| hypothetical protein FAEPRAM212_02132 [Faecalibacterium prausnitzii M21/2] gi|295104377|emb|CBL01921.1| preprotein translocase, SecE subunit, bacterial [Faecalibacterium prausnitzii SL3/3] Length = 83 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 37/57 (64%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V FF+ + E KK+ WPS+ +V + IVV++ ++I++V +++D G ++ I+G Sbjct: 26 VAKFFRDTKSELKKVVWPSKQDVKTNTIVVLVTVAIAAVVMILLDAIFGGILGLIIG 82 >gi|256752773|ref|ZP_05493618.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus CCSD1] gi|307725167|ref|YP_003904918.1| preprotein translocase subunit SecE [Thermoanaerobacter sp. X513] gi|256748334|gb|EEU61393.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus CCSD1] gi|307582228|gb|ADN55627.1| preprotein translocase, SecE subunit [Thermoanaerobacter sp. X513] Length = 65 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 37/58 (63%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ FFK +R E KK+ WPSR V+ +V+I++++ +VF +ID +L+ I+ + Sbjct: 8 IVKFFKDIRAEMKKVTWPSRKTVITYTEIVLIVMALLTVFIFLIDSIFSYLLKLIIKV 65 >gi|84499878|ref|ZP_00998144.1| preprotein translocase, SecE subunit [Oceanicola batsensis HTCC2597] gi|84391812|gb|EAQ04080.1| preprotein translocase, SecE subunit [Oceanicola batsensis HTCC2597] Length = 63 Score = 47.0 bits (110), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 31/44 (70%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 + F Q R E KI WP+R EVL++ ++V IM ++++VFF ++D Sbjct: 5 IQFINQTRAEISKITWPTRREVLLTTVMVFIMAALTAVFFALVD 48 >gi|126724846|ref|ZP_01740689.1| preprotein translocase, SecE subunit [Rhodobacterales bacterium HTCC2150] gi|126706010|gb|EBA05100.1| preprotein translocase, SecE subunit [Rhodobacterales bacterium HTCC2150] Length = 65 Score = 47.0 bits (110), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 31/44 (70%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 L F +QVR E KI WP++ EVL++ +V +M +++++FF +D Sbjct: 7 LQFLQQVRAEVAKIVWPTQREVLLTTAMVFVMATLTAIFFFFVD 50 >gi|154249534|ref|YP_001410359.1| preprotein translocase, SecE subunit [Fervidobacterium nodosum Rt17-B1] gi|154153470|gb|ABS60702.1| preprotein translocase, SecE subunit [Fervidobacterium nodosum Rt17-B1] Length = 63 Score = 47.0 bits (110), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 18/43 (41%), Positives = 31/43 (72%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 FF +V+ E+KK WP+R E+L S VV+ +L++S+V+ ++D Sbjct: 7 KFFAEVKSEAKKTTWPNREELLASTGVVLFILAVSAVYLFLVD 49 >gi|163796065|ref|ZP_02190027.1| transcription antitermination protein NusG [alpha proteobacterium BAL199] gi|159178524|gb|EDP63064.1| transcription antitermination protein NusG [alpha proteobacterium BAL199] Length = 66 Score = 47.0 bits (110), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/62 (29%), Positives = 38/62 (61%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +++ F +QVR E ++ W +R + + ++V IM+ +S+FF ++D + W + +LG Sbjct: 4 KVSPAQFVRQVRQEVSRVTWATRKDTATATLMVFIMVFAASIFFFLVDLGLSWGVQKVLG 63 Query: 65 IG 66 +G Sbjct: 64 LG 65 >gi|148555475|ref|YP_001263057.1| protein translocase subunit secE/sec61 gamma [Sphingomonas wittichii RW1] gi|148500665|gb|ABQ68919.1| protein translocase subunit secE/sec61 gamma [Sphingomonas wittichii RW1] Length = 65 Score = 47.0 bits (110), Expect = 0.001, Method: Compositional matrix adjust. Identities = 21/61 (34%), Positives = 37/61 (60%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + + F QV+ E++K+ WPSR E + + I+V IM + +FF IDQ ++ F+L Sbjct: 3 KTSPVEFINQVKAETRKVVWPSRKETIATTIMVGIMTLLLGLFFFGIDQMFASIVKFLLS 62 Query: 65 I 65 + Sbjct: 63 L 63 >gi|167036787|ref|YP_001664365.1| preprotein translocase, SecE subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|320115209|ref|YP_004185368.1| preprotein translocase subunit SecE [Thermoanaerobacter brockii subsp. finnii Ako-1] gi|166855621|gb|ABY94029.1| preprotein translocase, SecE subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|319928300|gb|ADV78985.1| preprotein translocase, SecE subunit [Thermoanaerobacter brockii subsp. finnii Ako-1] Length = 65 Score = 47.0 bits (110), Expect = 0.001, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 37/58 (63%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ FFK +R E KK+ WPSR V+ +V+I++++ +VF +ID +L+ I+ + Sbjct: 8 IVKFFKDIRAEMKKVTWPSRKTVITYTEIVLIVVALFTVFIFLIDSVFSYLLKLIIKV 65 >gi|114764161|ref|ZP_01443399.1| preprotein translocase, SecE subunit [Pelagibaca bermudensis HTCC2601] gi|114543313|gb|EAU46329.1| preprotein translocase, SecE subunit [Roseovarius sp. HTCC2601] Length = 63 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 30/44 (68%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 + F +Q R E KI WP+R EVL++ + V IM ++++ FF ++D Sbjct: 5 IQFIQQTRAEVAKIVWPTRREVLLTTVTVFIMAALTASFFAIVD 48 >gi|255263610|ref|ZP_05342952.1| preprotein translocase, SecE subunit [Thalassiobium sp. R2A62] gi|255105945|gb|EET48619.1| preprotein translocase, SecE subunit [Thalassiobium sp. R2A62] Length = 66 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 22/60 (36%), Positives = 38/60 (63%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R + F +VR E K+ WP+R EV+++ I+V IM ++++VFF ++D I + +LG Sbjct: 3 RTNPIQFINEVRAEVSKVVWPTRREVVLTTIMVFIMAALTAVFFSIVDLIIRSGLQGVLG 62 >gi|307297142|ref|ZP_07576956.1| preprotein translocase, SecE subunit [Sphingobium chlorophenolicum L-1] gi|306877446|gb|EFN08676.1| preprotein translocase, SecE subunit [Sphingobium chlorophenolicum L-1] Length = 68 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 4/59 (6%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG----WLMHFILG 64 F QV+ E+KKI WP+ E +++ ++V+IM S+ +FF ID G WL+ F G Sbjct: 8 EFVNQVQTEAKKIVWPTGRETIMTGVMVVIMTSLLGLFFFGIDTFFGAIVQWLLAFAAG 66 >gi|254436562|ref|ZP_05050056.1| preprotein translocase, SecE subunit [Octadecabacter antarcticus 307] gi|198252008|gb|EDY76322.1| preprotein translocase, SecE subunit [Octadecabacter antarcticus 307] Length = 64 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 20/48 (41%), Positives = 33/48 (68%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 R + F +QVR E K+ WPSR EV ++ I+V+IM ++ ++FF ++D Sbjct: 3 RTNPVQFIQQVRAEVGKVVWPSRREVTLTTIMVLIMATVMALFFTLVD 50 >gi|85710260|ref|ZP_01041325.1| preprotein translocase [Erythrobacter sp. NAP1] gi|85688970|gb|EAQ28974.1| preprotein translocase [Erythrobacter sp. NAP1] Length = 74 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 21/63 (33%), Positives = 36/63 (57%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ F QVR E+ K+ WP+R E + + I V I + I S+FF +D L++F+L Sbjct: 12 TKTSIPEFVNQVRTETSKVVWPTREETIRTAIFVFIFMVILSLFFFGVDSLFNALVNFLL 71 Query: 64 GIG 66 + Sbjct: 72 TLA 74 >gi|83312246|ref|YP_422510.1| preprotein translocase subunit SecE [Magnetospirillum magneticum AMB-1] gi|82947087|dbj|BAE51951.1| Preprotein translocase subunit SecE [Magnetospirillum magneticum AMB-1] Length = 65 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 26/56 (46%), Positives = 38/56 (67%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 FFKQVR E K+ WP+R E VS +V++M+ I++VFFLV+DQ + + G+G Sbjct: 9 FFKQVRQEVAKVTWPTRRETTVSTGMVVVMVVIAAVFFLVVDQIFAASVKLLFGLG 64 >gi|291280161|ref|YP_003496996.1| preprotein translocase subunit E [Deferribacter desulfuricans SSM1] gi|290754863|dbj|BAI81240.1| preprotein translocase subunit E [Deferribacter desulfuricans SSM1] Length = 60 Score = 46.2 bits (108), Expect = 0.001, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 36/55 (65%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F ++V++E KK+ WP++ E + + IVVI+M I S F V+D ++ ++ I+G Sbjct: 6 KFIQEVKEELKKVVWPTKQETIQTTIVVIVMTLIVSAFLGVVDVALSKVIKLIVG 60 >gi|300915243|ref|ZP_07132558.1| preprotein translocase, SecE subunit [Thermoanaerobacter sp. X561] gi|300888967|gb|EFK84114.1| preprotein translocase, SecE subunit [Thermoanaerobacter sp. X561] Length = 65 Score = 46.2 bits (108), Expect = 0.001, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 36/58 (62%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ FFK +R E KK+ WPSR V+ +V+I++++ +VF ID +L+ I+ + Sbjct: 8 IVKFFKDIRAEMKKVTWPSRKTVITYTEIVLIVMALLTVFIFFIDSIFSYLLKLIIKV 65 >gi|89071243|ref|ZP_01158422.1| preprotein translocase, SecE subunit [Oceanicola granulosus HTCC2516] gi|89043229|gb|EAR49459.1| preprotein translocase, SecE subunit [Oceanicola granulosus HTCC2516] Length = 66 Score = 46.2 bits (108), Expect = 0.001, Method: Compositional matrix adjust. Identities = 17/46 (36%), Positives = 33/46 (71%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 F QVR E K+ WP+R EV+++ ++V +M +++++FF ++D +I Sbjct: 8 QFISQVRAEVSKVTWPTRREVVLTTVMVFLMATLAAIFFFLVDLAI 53 >gi|307267206|ref|ZP_07548712.1| preprotein translocase, SecE subunit [Thermoanaerobacter wiegelii Rt8.B1] gi|326390675|ref|ZP_08212230.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus JW 200] gi|306917785|gb|EFN48053.1| preprotein translocase, SecE subunit [Thermoanaerobacter wiegelii Rt8.B1] gi|325993353|gb|EGD51790.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus JW 200] Length = 65 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 37/58 (63%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ FFK VR E KK+ WPSR ++ +V+I++++ +VF +ID +L+ I+ + Sbjct: 8 IVKFFKDVRAEMKKVTWPSRETMITYTEIVLIVVALFTVFIFLIDSVFSYLLKLIIKV 65 >gi|330831433|ref|YP_004394385.1| preprotein translocase subunit SecE [Aeromonas veronii B565] gi|328806569|gb|AEB51768.1| Preprotein translocase, SecE subunit [Aeromonas veronii B565] Length = 95 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 37/59 (62%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E + + ++V+ + ++ + V+D ++ WL++ I G+ Sbjct: 37 ATLAFARESRLEVRKVVWPTRQEAIQTTLIVLAVTAVMGLLLFVLDGALVWLVNLITGV 95 >gi|114319606|ref|YP_741289.1| preprotein translocase subunit SecE [Alkalilimnicola ehrlichii MLHE-1] gi|114226000|gb|ABI55799.1| protein translocase subunit secE/sec61 gamma [Alkalilimnicola ehrlichii MLHE-1] Length = 125 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 20/60 (33%), Positives = 37/60 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 AV F + R E +K+ WP+R E L + ++V +M+ + ++F ++D GW + I+G+G Sbjct: 65 AVWQFARASRQELRKVVWPNRQETLQTTLIVFVMVVLVALFLWLVDLLAGWGIGRIIGLG 124 >gi|260425488|ref|ZP_05779468.1| preprotein translocase, SecE subunit [Citreicella sp. SE45] gi|260423428|gb|EEX16678.1| preprotein translocase, SecE subunit [Citreicella sp. SE45] Length = 63 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 30/44 (68%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 + F +Q R E KI WP+R EV+++ + V IM ++++ FF ++D Sbjct: 5 IQFIQQTRSEIGKIVWPTRREVILTTVTVFIMAALTATFFALVD 48 >gi|218779774|ref|YP_002431092.1| preprotein translocase, SecE subunit [Desulfatibacillum alkenivorans AK-01] gi|218761158|gb|ACL03624.1| preprotein translocase, SecE subunit [Desulfatibacillum alkenivorans AK-01] Length = 112 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/56 (33%), Positives = 37/56 (66%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++VR E KK+ WPSR + + S VVII++++ S+F ++D + ++ ++G Sbjct: 57 VQFLREVRGELKKVTWPSRKQTVGSTAVVIILVAVISMFLGLVDMGLTEIVRLVIG 112 >gi|119713238|gb|ABL97304.1| putative preprotein translocase SecE subunit [uncultured marine bacterium HF10_12C08] Length = 62 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 36/58 (62%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F ++VR E K+ WP+ E L I+V+++ + ++VFFL+IDQ + + ++G+ Sbjct: 4 FKFIQEVRREGSKVTWPTSRETLTGSIMVVLITAFAAVFFLIIDQIFSFGLDKLIGVA 61 >gi|319790551|ref|YP_004152184.1| preprotein translocase, SecE subunit [Thermovibrio ammonificans HB-1] gi|317115053|gb|ADU97543.1| preprotein translocase, SecE subunit [Thermovibrio ammonificans HB-1] Length = 60 Score = 45.4 bits (106), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 34/55 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F K+VR+E +++ WPS+ EV+ + I VI+ ++ + +F VID + + IL Sbjct: 5 QFLKEVREELQRVTWPSKEEVVEATIAVIVFCAVIAAYFWVIDTVLTAALEVILA 59 >gi|294012698|ref|YP_003546158.1| preprotein translocase subunit SecE [Sphingobium japonicum UT26S] gi|292676028|dbj|BAI97546.1| preprotein translocase subunit SecE [Sphingobium japonicum UT26S] Length = 71 Score = 45.4 bits (106), Expect = 0.002, Method: Compositional matrix adjust. Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 4/59 (6%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG----WLMHFILG 64 F QV+ E+ KI WP+ E +++ ++V+IM S+ +FF ID G WL+ F G Sbjct: 11 EFVNQVKAEASKIVWPTGRETIMTGVMVVIMTSLLGIFFFGIDTFFGAIVQWLLAFAAG 69 >gi|163938103|ref|YP_001642987.1| preprotein translocase subunit SecE [Bacillus weihenstephanensis KBAB4] gi|229009604|ref|ZP_04166830.1| preprotein translocase subunit SecE [Bacillus mycoides DSM 2048] gi|229053941|ref|ZP_04195375.1| preprotein translocase subunit SecE [Bacillus cereus AH603] gi|229131102|ref|ZP_04260014.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-ST196] gi|229165083|ref|ZP_04292878.1| preprotein translocase subunit SecE [Bacillus cereus AH621] gi|163860300|gb|ABY41359.1| preprotein translocase, SecE subunit [Bacillus weihenstephanensis KBAB4] gi|228618346|gb|EEK75376.1| preprotein translocase subunit SecE [Bacillus cereus AH621] gi|228652315|gb|EEL08240.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-ST196] gi|228721359|gb|EEL72880.1| preprotein translocase subunit SecE [Bacillus cereus AH603] gi|228751626|gb|EEM01426.1| preprotein translocase subunit SecE [Bacillus mycoides DSM 2048] Length = 59 Score = 45.4 bits (106), Expect = 0.002, Method: Compositional matrix adjust. Identities = 23/55 (41%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF V E KK+ WP + E+L S VI + ++FF V+D I L+ ILG Sbjct: 5 NFFGDVGREMKKVSWPKKDELLRSTTTVIATVVFFAIFFAVVDMGISSLIRLILG 59 >gi|77462245|ref|YP_351749.1| preprotein translocase subunit SecE [Rhodobacter sphaeroides 2.4.1] gi|126461107|ref|YP_001042221.1| preprotein translocase subunit SecE [Rhodobacter sphaeroides ATCC 17029] gi|126461121|ref|YP_001042235.1| preprotein translocase subunit SecE [Rhodobacter sphaeroides ATCC 17029] gi|221641200|ref|YP_002527462.1| preprotein translocase subunit SecE [Rhodobacter sphaeroides KD131] gi|77386663|gb|ABA77848.1| protein translocase subunit secE/sec61 gamma [Rhodobacter sphaeroides 2.4.1] gi|126102771|gb|ABN75449.1| preprotein translocase, SecE subunit [Rhodobacter sphaeroides ATCC 17029] gi|126102785|gb|ABN75463.1| protein translocase subunit secE/sec61 gamma [Rhodobacter sphaeroides ATCC 17029] gi|221161981|gb|ACM02961.1| Preprotein translocase, SecE subunit [Rhodobacter sphaeroides KD131] Length = 64 Score = 45.4 bits (106), Expect = 0.002, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 31/46 (67%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 F QVR E K+ WP R EVL++ I+V +M ++++ FF ++D +I Sbjct: 8 TFISQVRSEVGKVAWPGRREVLLTTIMVFVMAALTATFFSLVDFAI 53 >gi|222099195|ref|YP_002533763.1| Preprotein translocase subunit secE [Thermotoga neapolitana DSM 4359] gi|221571585|gb|ACM22397.1| Preprotein translocase subunit secE [Thermotoga neapolitana DSM 4359] Length = 65 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 20/43 (46%), Positives = 32/43 (74%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 FF++V E+KKI WPSR E+L S VV+++L ++ ++F V+D Sbjct: 6 RFFREVIAEAKKISWPSRKELLTSFSVVLVILIVTGLYFFVLD 48 >gi|30260286|ref|NP_842663.1| preprotein translocase subunit SecE [Bacillus anthracis str. Ames] gi|42779176|ref|NP_976423.1| preprotein translocase subunit SecE [Bacillus cereus ATCC 10987] gi|47525349|ref|YP_016698.1| preprotein translocase subunit SecE [Bacillus anthracis str. 'Ames Ancestor'] gi|49183129|ref|YP_026381.1| preprotein translocase subunit SecE [Bacillus anthracis str. Sterne] gi|52145297|ref|YP_081706.1| preprotein translocase subunit SecE [Bacillus cereus E33L] gi|65317555|ref|ZP_00390514.1| COG0690: Preprotein translocase subunit SecE [Bacillus anthracis str. A2012] gi|170689562|ref|ZP_02880748.1| preprotein translocase, SecE subunit [Bacillus anthracis str. A0465] gi|177655599|ref|ZP_02936980.1| preprotein translocase, SecE subunit [Bacillus anthracis str. A0174] gi|217957670|ref|YP_002336214.1| preprotein translocase subunit SecE [Bacillus cereus AH187] gi|218901297|ref|YP_002449131.1| preprotein translocase, SecE subunit [Bacillus cereus AH820] gi|222093865|ref|YP_002527915.1| preprotein translocase subunit sece [Bacillus cereus Q1] gi|227812768|ref|YP_002812777.1| preprotein translocase, SecE subunit [Bacillus anthracis str. CDC 684] gi|228912834|ref|ZP_04076481.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] gi|228925348|ref|ZP_04088444.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] gi|228931597|ref|ZP_04094503.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] gi|228943901|ref|ZP_04106286.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228983350|ref|ZP_04143563.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] gi|229015497|ref|ZP_04172495.1| preprotein translocase subunit SecE [Bacillus cereus AH1273] gi|229021706|ref|ZP_04178288.1| preprotein translocase subunit SecE [Bacillus cereus AH1272] gi|229027943|ref|ZP_04184096.1| preprotein translocase subunit SecE [Bacillus cereus AH1271] gi|229074156|ref|ZP_04207202.1| preprotein translocase subunit SecE [Bacillus cereus Rock4-18] gi|229083415|ref|ZP_04215763.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-44] gi|229089226|ref|ZP_04220507.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-42] gi|229094817|ref|ZP_04225822.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-29] gi|229100894|ref|ZP_04231698.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-28] gi|229113771|ref|ZP_04243206.1| preprotein translocase subunit SecE [Bacillus cereus Rock1-3] gi|229119757|ref|ZP_04249018.1| preprotein translocase subunit SecE [Bacillus cereus 95/8201] gi|229136941|ref|ZP_04265568.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-ST26] gi|229153873|ref|ZP_04282003.1| preprotein translocase subunit SecE [Bacillus cereus ATCC 4342] gi|229159268|ref|ZP_04287292.1| preprotein translocase subunit SecE [Bacillus cereus R309803] gi|229170946|ref|ZP_04298547.1| preprotein translocase subunit SecE [Bacillus cereus MM3] gi|229182489|ref|ZP_04309740.1| preprotein translocase subunit SecE [Bacillus cereus BGSC 6E1] gi|229194485|ref|ZP_04321288.1| preprotein translocase subunit SecE [Bacillus cereus m1293] gi|229604883|ref|YP_002864746.1| preprotein translocase, SecE subunit [Bacillus anthracis str. A0248] gi|254684401|ref|ZP_05148261.1| preprotein translocase subunit SecE [Bacillus anthracis str. CNEVA-9066] gi|254724236|ref|ZP_05186021.1| preprotein translocase subunit SecE [Bacillus anthracis str. A1055] gi|254733750|ref|ZP_05191465.1| preprotein translocase subunit SecE [Bacillus anthracis str. Western North America USA6153] gi|254739419|ref|ZP_05197119.1| preprotein translocase subunit SecE [Bacillus anthracis str. Kruger B] gi|254751208|ref|ZP_05203246.1| preprotein translocase subunit SecE [Bacillus anthracis str. Vollum] gi|254756807|ref|ZP_05208835.1| preprotein translocase subunit SecE [Bacillus anthracis str. Australia 94] gi|300119594|ref|ZP_07057138.1| preprotein translocase subunit SecE [Bacillus cereus SJ1] gi|301051832|ref|YP_003790043.1| preprotein translocase subunit SecE [Bacillus anthracis CI] gi|30253607|gb|AAP24149.1| preprotein translocase, SecE subunit [Bacillus anthracis str. Ames] gi|42735091|gb|AAS39031.1| preprotein translocase, SecE subunit [Bacillus cereus ATCC 10987] gi|47500497|gb|AAT29173.1| preprotein translocase, SecE subunit [Bacillus anthracis str. 'Ames Ancestor'] gi|49177056|gb|AAT52432.1| preprotein translocase, SecE subunit [Bacillus anthracis str. Sterne] gi|51978766|gb|AAU20316.1| preprotein translocase secE subunit [Bacillus cereus E33L] gi|170666475|gb|EDT17252.1| preprotein translocase, SecE subunit [Bacillus anthracis str. A0465] gi|172080063|gb|EDT65161.1| preprotein translocase, SecE subunit [Bacillus anthracis str. A0174] gi|217067682|gb|ACJ81932.1| preprotein translocase, SecE subunit [Bacillus cereus AH187] gi|218536009|gb|ACK88407.1| preprotein translocase, SecE subunit [Bacillus cereus AH820] gi|221237913|gb|ACM10623.1| preprotein translocase secE subunit [Bacillus cereus Q1] gi|227002464|gb|ACP12207.1| preprotein translocase, SecE subunit [Bacillus anthracis str. CDC 684] gi|228588951|gb|EEK46966.1| preprotein translocase subunit SecE [Bacillus cereus m1293] gi|228600944|gb|EEK58513.1| preprotein translocase subunit SecE [Bacillus cereus BGSC 6E1] gi|228612486|gb|EEK69707.1| preprotein translocase subunit SecE [Bacillus cereus MM3] gi|228624160|gb|EEK80962.1| preprotein translocase subunit SecE [Bacillus cereus R309803] gi|228629554|gb|EEK86251.1| preprotein translocase subunit SecE [Bacillus cereus ATCC 4342] gi|228646479|gb|EEL02686.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-ST26] gi|228663658|gb|EEL19237.1| preprotein translocase subunit SecE [Bacillus cereus 95/8201] gi|228669642|gb|EEL25049.1| preprotein translocase subunit SecE [Bacillus cereus Rock1-3] gi|228682473|gb|EEL36546.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-28] gi|228688560|gb|EEL42433.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-29] gi|228694065|gb|EEL47747.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-42] gi|228699848|gb|EEL52485.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-44] gi|228708926|gb|EEL61053.1| preprotein translocase subunit SecE [Bacillus cereus Rock4-18] gi|228733331|gb|EEL84160.1| preprotein translocase subunit SecE [Bacillus cereus AH1271] gi|228739574|gb|EEL89988.1| preprotein translocase subunit SecE [Bacillus cereus AH1272] gi|228745784|gb|EEL95788.1| preprotein translocase subunit SecE [Bacillus cereus AH1273] gi|228776340|gb|EEM24693.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] gi|228815734|gb|EEM61970.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228828025|gb|EEM73753.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] gi|228834270|gb|EEM79811.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] gi|228846770|gb|EEM91775.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] gi|229269291|gb|ACQ50928.1| preprotein translocase, SecE subunit [Bacillus anthracis str. A0248] gi|298723066|gb|EFI63964.1| preprotein translocase subunit SecE [Bacillus cereus SJ1] gi|300374001|gb|ADK02905.1| preprotein translocase, SecE subunit [Bacillus cereus biovar anthracis str. CI] gi|324324085|gb|ADY19345.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar finitimus YBT-020] Length = 59 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 23/55 (41%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF V E KK+ WP + E+L S VI + ++FF V+D I L+ ILG Sbjct: 5 NFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAIFFAVVDMGISSLIRLILG 59 >gi|295401935|ref|ZP_06811898.1| preprotein translocase, SecE subunit [Geobacillus thermoglucosidasius C56-YS93] gi|312109246|ref|YP_003987562.1| preprotein translocase subunit SecE [Geobacillus sp. Y4.1MC1] gi|294976065|gb|EFG51680.1| preprotein translocase, SecE subunit [Geobacillus thermoglucosidasius C56-YS93] gi|311214347|gb|ADP72951.1| preprotein translocase, SecE subunit [Geobacillus sp. Y4.1MC1] Length = 60 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 34/55 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +NFFK V E KK+ WPSR E++ ++V+ ++ +VFF V+D I L+ + Sbjct: 5 INFFKDVAREMKKVSWPSRKELVNYTVIVLATVAFFTVFFAVVDLGISELIRLVF 59 >gi|84515190|ref|ZP_01002553.1| preprotein translocase, SecE subunit [Loktanella vestfoldensis SKA53] gi|84511349|gb|EAQ07803.1| preprotein translocase, SecE subunit [Loktanella vestfoldensis SKA53] Length = 66 Score = 45.4 bits (106), Expect = 0.003, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 39/56 (69%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++VR E K+ WP+R EV+++ I+V I+ ++++VFF ++D I + + +LG Sbjct: 7 VKFIQEVRSEVAKVVWPTRREVVLTTIMVFILAALTAVFFSLVDFVIRFGLSGVLG 62 >gi|212637939|ref|YP_002314459.1| preprotein translocase subunit SecE [Anoxybacillus flavithermus WK1] gi|212559419|gb|ACJ32474.1| Preprotein translocase subunit SecE [Anoxybacillus flavithermus WK1] Length = 60 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 23/56 (41%), Positives = 34/56 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V FF++V E KK+ WP R E++ I V+ ++ +VFF V+D I L+ FIL Sbjct: 4 VTKFFREVVREMKKVSWPKRKELVNYTITVLATVAFFTVFFAVVDLGISELVRFIL 59 >gi|157825314|ref|YP_001493034.1| preprotein translocase subunit SecE [Rickettsia akari str. Hartford] gi|157799272|gb|ABV74526.1| preprotein translocase subunit SecE [Rickettsia akari str. Hartford] Length = 68 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 36/55 (65%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 +QV+ E K+ WP++ E++ S +VV+ + I S+ LV+D SI +M +L IG+ Sbjct: 12 EQVKQEIYKVVWPTKKELVASTLVVVAAVFIFSLICLVLDYSIHNIMQLLLNIGK 66 >gi|49476712|ref|YP_034447.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar konkukian str. 97-27] gi|49328268|gb|AAT58914.1| preprotein translocase secE subunit [Bacillus thuringiensis serovar konkukian str. 97-27] Length = 63 Score = 45.1 bits (105), Expect = 0.004, Method: Compositional matrix adjust. Identities = 23/56 (41%), Positives = 32/56 (57%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 NFF V E KK+ WP + E+L S VI + ++FF V+D I L+ ILG+ Sbjct: 5 NFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAIFFAVVDMGISSLIRVILGL 60 >gi|261367233|ref|ZP_05980116.1| preprotein translocase, SecE subunit [Subdoligranulum variabile DSM 15176] gi|282570833|gb|EFB76368.1| preprotein translocase, SecE subunit [Subdoligranulum variabile DSM 15176] Length = 91 Score = 45.1 bits (105), Expect = 0.004, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 35/57 (61%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + +FK + E KK+ WPS+ +V + I VI ++ I+++ +V+D G +H ++G Sbjct: 34 IAKYFKDTKSELKKVVWPSKKDVKTNTITVIAVVLIAAIVLIVLDLIFGGAIHLVVG 90 >gi|117618782|ref|YP_858462.1| preprotein translocase, SecE subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966] gi|117560189|gb|ABK37137.1| preprotein translocase, SecE subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966] Length = 123 Score = 45.1 bits (105), Expect = 0.004, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 37/59 (62%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E + + ++V+ + ++ + ++D ++ WL++ I G+ Sbjct: 65 ATLAFARESRLEVRKVVWPTRQEAIQTTLIVLAVTAVMGLLLFILDGALVWLVNLITGV 123 >gi|30018365|ref|NP_829996.1| preprotein translocase subunit SecE [Bacillus cereus ATCC 14579] gi|218230921|ref|YP_002364944.1| preprotein translocase subunit SecE [Bacillus cereus B4264] gi|218895230|ref|YP_002443641.1| preprotein translocase, SecE subunit [Bacillus cereus G9842] gi|228898848|ref|ZP_04063130.1| preprotein translocase subunit SecE [Bacillus thuringiensis IBL 4222] gi|228905892|ref|ZP_04069789.1| preprotein translocase subunit SecE [Bacillus thuringiensis IBL 200] gi|228919045|ref|ZP_04082424.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] gi|228937397|ref|ZP_04100043.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar berliner ATCC 10792] gi|228950643|ref|ZP_04112777.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar kurstaki str. T03a001] gi|228956536|ref|ZP_04118332.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar pakistani str. T13001] gi|228963195|ref|ZP_04124364.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar sotto str. T04001] gi|228970283|ref|ZP_04130942.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar thuringiensis str. T01001] gi|228976853|ref|ZP_04137265.1| preprotein translocase subunit SecE [Bacillus thuringiensis Bt407] gi|229041000|ref|ZP_04189763.1| preprotein translocase subunit SecE [Bacillus cereus AH676] gi|229067860|ref|ZP_04201177.1| preprotein translocase subunit SecE [Bacillus cereus F65185] gi|229077390|ref|ZP_04210050.1| preprotein translocase subunit SecE [Bacillus cereus Rock4-2] gi|229107781|ref|ZP_04237417.1| preprotein translocase subunit SecE [Bacillus cereus Rock1-15] gi|229125612|ref|ZP_04254644.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-Cer4] gi|229142901|ref|ZP_04271342.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-ST24] gi|229148504|ref|ZP_04276760.1| preprotein translocase subunit SecE [Bacillus cereus m1550] gi|229176695|ref|ZP_04304099.1| preprotein translocase subunit SecE [Bacillus cereus 172560W] gi|229188380|ref|ZP_04315428.1| preprotein translocase subunit SecE [Bacillus cereus ATCC 10876] gi|296500929|ref|YP_003662629.1| preprotein translocase subunit SecE [Bacillus thuringiensis BMB171] gi|29893905|gb|AAP07197.1| Protein translocase subunit SecE [Bacillus cereus ATCC 14579] gi|218158878|gb|ACK58870.1| preprotein translocase, SecE subunit [Bacillus cereus B4264] gi|218544141|gb|ACK96535.1| preprotein translocase, SecE subunit [Bacillus cereus G9842] gi|228595054|gb|EEK52825.1| preprotein translocase subunit SecE [Bacillus cereus ATCC 10876] gi|228606738|gb|EEK64155.1| preprotein translocase subunit SecE [Bacillus cereus 172560W] gi|228634920|gb|EEK91493.1| preprotein translocase subunit SecE [Bacillus cereus m1550] gi|228640522|gb|EEK96911.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-ST24] gi|228657804|gb|EEL13610.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-Cer4] gi|228675630|gb|EEL30838.1| preprotein translocase subunit SecE [Bacillus cereus Rock1-15] gi|228705924|gb|EEL58250.1| preprotein translocase subunit SecE [Bacillus cereus Rock4-2] gi|228715219|gb|EEL67078.1| preprotein translocase subunit SecE [Bacillus cereus F65185] gi|228727297|gb|EEL78491.1| preprotein translocase subunit SecE [Bacillus cereus AH676] gi|228782823|gb|EEM30989.1| preprotein translocase subunit SecE [Bacillus thuringiensis Bt407] gi|228789392|gb|EEM37312.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar thuringiensis str. T01001] gi|228796453|gb|EEM43892.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar sotto str. T04001] gi|228803101|gb|EEM49923.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar pakistani str. T13001] gi|228808994|gb|EEM55479.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar kurstaki str. T03a001] gi|228822230|gb|EEM68212.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar berliner ATCC 10792] gi|228840570|gb|EEM85832.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] gi|228853707|gb|EEM98467.1| preprotein translocase subunit SecE [Bacillus thuringiensis IBL 200] gi|228860748|gb|EEN05126.1| preprotein translocase subunit SecE [Bacillus thuringiensis IBL 4222] gi|296321981|gb|ADH04909.1| preprotein translocase subunit SecE [Bacillus thuringiensis BMB171] gi|326937889|gb|AEA13785.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar chinensis CT-43] Length = 59 Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 22/55 (40%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF V E KK+ WP + E+L S V+ + ++FF V+D I L+ ILG Sbjct: 5 NFFGDVGREMKKVSWPKKDELLRSTATVVATVVFFAIFFAVVDMGISSLIRLILG 59 >gi|159042814|ref|YP_001531608.1| preprotein translocase subunit SecE [Dinoroseobacter shibae DFL 12] gi|157910574|gb|ABV92007.1| preprotein translocase, SecE subunit [Dinoroseobacter shibae DFL 12] Length = 66 Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 34/56 (60%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F +QVR E K+ WP+R EV+V+ ++V M ++++FF +D I + F+L Sbjct: 7 FQFLQQVRAEVSKVTWPTRKEVMVTSLMVFAMAILTAIFFFFVDWMIRTGLQFVLN 62 >gi|138893770|ref|YP_001124223.1| preprotein translocase subunit SecE [Geobacillus thermodenitrificans NG80-2] gi|196251120|ref|ZP_03149799.1| preprotein translocase, SecE subunit [Geobacillus sp. G11MC16] gi|134265283|gb|ABO65478.1| Preprotein translocase SecE subunit [Geobacillus thermodenitrificans NG80-2] gi|196209361|gb|EDY04141.1| preprotein translocase, SecE subunit [Geobacillus sp. G11MC16] Length = 60 Score = 44.7 bits (104), Expect = 0.004, Method: Compositional matrix adjust. Identities = 23/56 (41%), Positives = 34/56 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V NFFK+V E KK+ WP+R E++ VV+ ++ +VFF VID I L+ + Sbjct: 4 VTNFFKEVVRELKKVSWPNRKELVNYTAVVLATVAFFTVFFAVIDLGISQLIRLVF 59 >gi|225874473|ref|YP_002755932.1| preprotein translocase, SecE subunit [Acidobacterium capsulatum ATCC 51196] gi|225791321|gb|ACO31411.1| preprotein translocase, SecE subunit [Acidobacterium capsulatum ATCC 51196] Length = 85 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 4/60 (6%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG----WLMHFILG 64 + FFK VR E +K+ PSR+EV + +VVI + + S FF V+D +G L+H + G Sbjct: 25 MEFFKDVRSEMRKVVTPSRAEVQSTTLVVIFSVFLFSAFFYVVDSIVGRGLQALLHALGG 84 >gi|116748978|ref|YP_845665.1| preprotein translocase subunit SecE [Syntrophobacter fumaroxidans MPOB] gi|116698042|gb|ABK17230.1| protein translocase subunit secE/sec61 gamma [Syntrophobacter fumaroxidans MPOB] Length = 115 Score = 44.3 bits (103), Expect = 0.005, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 36/58 (62%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A + ++V E KK+ WPSR E + S VV++++++ VF ++DQ + L+ ++G Sbjct: 58 ASRQYLREVVSELKKVVWPSRKETVGSTAVVLVIVAVCGVFLGIVDQVLSLLVRMLIG 115 >gi|319654853|ref|ZP_08008928.1| preprotein translocase [Bacillus sp. 2_A_57_CT2] gi|317393416|gb|EFV74179.1| preprotein translocase [Bacillus sp. 2_A_57_CT2] Length = 60 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 34/56 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++NFF++V E KK+ WP R E+ + V+ ++ ++FF VID I L+ IL Sbjct: 4 IVNFFREVGREMKKVSWPKRKELTNYTVTVLATVTFFALFFAVIDLGISELIRLIL 59 >gi|145297372|ref|YP_001140213.1| preprotein translocase subunit SecE [Aeromonas salmonicida subsp. salmonicida A449] gi|142850144|gb|ABO88465.1| preprotein translocase subunit SecE [Aeromonas salmonicida subsp. salmonicida A449] Length = 123 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 37/59 (62%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E + + ++V+ + ++ + ++D ++ WL++ I G+ Sbjct: 65 ATLAFARESRLEVRKVVWPTRQEAIQTTLIVLAVTAVMGLLLFMLDGALVWLVNLITGV 123 >gi|299821039|ref|ZP_07052927.1| preprotein translocase [Listeria grayi DSM 20601] gi|299816704|gb|EFI83940.1| preprotein translocase [Listeria grayi DSM 20601] Length = 64 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 36/57 (63%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ NFF V E +K+ WP+R E++ + VII + + +VFF+VID I L+ ++ Sbjct: 8 ALSNFFHNVISEMRKVSWPTRKELVTYTVTVIITVILFAVFFMVIDFGIEQLIKLVI 64 >gi|146278582|ref|YP_001168741.1| preprotein translocase subunit SecE [Rhodobacter sphaeroides ATCC 17025] gi|145556823|gb|ABP71436.1| protein translocase subunit secE/sec61 gamma [Rhodobacter sphaeroides ATCC 17025] Length = 64 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 29/43 (67%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 F QVR E K+ WP R EVL++ ++V +M ++++ FF ++D Sbjct: 8 TFISQVRSEVGKVVWPGRREVLLTTVMVFVMAALTATFFSLVD 50 >gi|103486930|ref|YP_616491.1| SecE subunit of protein translocation complex [Sphingopyxis alaskensis RB2256] gi|98977007|gb|ABF53158.1| protein translocase subunit secE/sec61 gamma [Sphingopyxis alaskensis RB2256] Length = 126 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 20/63 (31%), Positives = 38/63 (60%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ + F QV+ E+ KI WP+ E + + I+V+IM +I S FFL +D +++ ++ Sbjct: 64 KVKIGEFVNQVKTEAGKIVWPTGRETVQTTILVLIMATILSFFFLGVDTVFSYIVSWLTS 123 Query: 65 IGR 67 + R Sbjct: 124 LAR 126 >gi|294675842|ref|YP_003576457.1| preprotein translocase subunit SecE [Rhodobacter capsulatus SB 1003] gi|294474662|gb|ADE84050.1| preprotein translocase, SecE subunit [Rhodobacter capsulatus SB 1003] Length = 60 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 31/44 (70%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 + F QVR E KI WP+R EV+++ ++V+ M ++++FF ++D Sbjct: 5 IQFLSQVRSEVGKITWPTRREVVLTTVMVLTMAMVAAIFFSLVD 48 >gi|167648398|ref|YP_001686061.1| preprotein translocase subunit SecE [Caulobacter sp. K31] gi|167350828|gb|ABZ73563.1| preprotein translocase, SecE subunit [Caulobacter sp. K31] Length = 104 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 37/58 (63%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + F ++VR E++KI W +R E ++ ++V IM+ ++S+FF + D +G H +L I Sbjct: 45 VRFAQEVRAEARKITWTTRKETWITSVMVFIMVVLASLFFTLADWILGLGSHLLLKIA 102 >gi|261364712|ref|ZP_05977595.1| preprotein translocase, SecE subunit [Neisseria mucosa ATCC 25996] gi|288567008|gb|EFC88568.1| preprotein translocase, SecE subunit [Neisseria mucosa ATCC 25996] Length = 90 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 32/55 (58%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 R +L++F+ E KK+ WP+R + + I V+I +SI +VF D +I WL Sbjct: 27 KREGLLSYFRNSWSEFKKVVWPARDDAVKMTIFVVIFVSILAVFIYAADSAISWL 81 >gi|288957407|ref|YP_003447748.1| hypothetical protein AZL_005660 [Azospirillum sp. B510] gi|288909715|dbj|BAI71204.1| hypothetical protein AZL_005660 [Azospirillum sp. B510] Length = 65 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 20/57 (35%), Positives = 38/57 (66%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F ++VR E ++ WP+R E ++ +V +M+ ++++FFLV+DQ + + ILG+G Sbjct: 8 EFAREVRREVARVTWPTRKETGITTAMVFVMVVVAALFFLVVDQVLAVAVRLILGLG 64 >gi|197104677|ref|YP_002130054.1| preprotein translocase, SecE subunit [Phenylobacterium zucineum HLK1] gi|196478097|gb|ACG77625.1| preprotein translocase, SecE subunit [Phenylobacterium zucineum HLK1] Length = 78 Score = 43.9 bits (102), Expect = 0.008, Method: Compositional matrix adjust. Identities = 18/49 (36%), Positives = 34/49 (69%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +++ F ++VR E++KI W SR E ++ ++V IM+ +++VFF V+D Sbjct: 13 KKVSPAQFAREVRAEARKITWTSRKETWITSVMVAIMVLLAAVFFWVVD 61 >gi|239825678|ref|YP_002948302.1| preprotein translocase subunit SecE [Geobacillus sp. WCH70] gi|239805971|gb|ACS23036.1| preprotein translocase, SecE subunit [Geobacillus sp. WCH70] Length = 60 Score = 43.5 bits (101), Expect = 0.008, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 34/56 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++NFFK+V E KK+ WPSR E++ +V+ + +VFF ++D I L+ + Sbjct: 4 IMNFFKEVAREMKKVSWPSRKELVNYTAIVLATVVFFTVFFAIVDLGISKLIRLVF 59 >gi|320120547|gb|ADW16182.1| hypothetical protein HMPREF0389_01737 [Filifactor alocis ATCC 35896] Length = 69 Score = 43.5 bits (101), Expect = 0.009, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 31/53 (58%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG 56 + + +F +V+ E KK+ WPS+ E+ VIIM+ ++++F ID +G Sbjct: 8 TKTSPTEYFGEVKTELKKVHWPSKQELSEHTFTVIIMVLVTALFIFCIDAGVG 60 >gi|229542220|ref|ZP_04431280.1| preprotein translocase, SecE subunit [Bacillus coagulans 36D1] gi|229326640|gb|EEN92315.1| preprotein translocase, SecE subunit [Bacillus coagulans 36D1] Length = 61 Score = 43.5 bits (101), Expect = 0.010, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 33/51 (64%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG 56 +++ NFF+ V E +K+ WP R E++ I V++ ++ ++FF+VID I Sbjct: 1 MSITNFFRNVASEMRKVSWPGRKELVKYTITVLVTVAFLTLFFIVIDLGIS 51 >gi|255067814|ref|ZP_05319669.1| preprotein translocase, SecE subunit [Neisseria sicca ATCC 29256] gi|255047905|gb|EET43369.1| preprotein translocase, SecE subunit [Neisseria sicca ATCC 29256] Length = 90 Score = 43.5 bits (101), Expect = 0.010, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 32/55 (58%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 R +L++FK E KK+ WP+R + + + V+I ++I +VF D +I WL Sbjct: 27 KREGLLSYFKNSWSEFKKVVWPTRDDAVKMTVFVVIFVAILAVFIYAADSAISWL 81 >gi|114778897|ref|ZP_01453694.1| hypothetical protein SPV1_12145 [Mariprofundus ferrooxydans PV-1] gi|114550866|gb|EAU53432.1| hypothetical protein SPV1_12145 [Mariprofundus ferrooxydans PV-1] Length = 62 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 33/53 (62%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 V F +V+ E+KK+ WP R E L S ++V +M+ ++F ++D S+ WL+ Sbjct: 7 VRKFMSEVKVEAKKVTWPERRETLQSTLMVFVMVIFIALFLWLVDSSLSWLVR 59 >gi|218886544|ref|YP_002435865.1| preprotein translocase subunit SecE [Desulfovibrio vulgaris str. 'Miyazaki F'] gi|218757498|gb|ACL08397.1| preprotein translocase, SecE subunit [Desulfovibrio vulgaris str. 'Miyazaki F'] Length = 83 Score = 43.1 bits (100), Expect = 0.013, Method: Compositional matrix adjust. Identities = 16/54 (29%), Positives = 35/54 (64%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++F++ + E +K+ WP+R E + I V++++ + S+F V+D + L+ +IL Sbjct: 29 DYFEEAKGELRKVTWPTRKETTATGIAVLVLVFVMSLFLGVVDLGLTKLVEYIL 82 >gi|262375154|ref|ZP_06068388.1| preprotein translocase subunit SecE [Acinetobacter lwoffii SH145] gi|262310167|gb|EEY91296.1| preprotein translocase subunit SecE [Acinetobacter lwoffii SH145] Length = 146 Score = 42.7 bits (99), Expect = 0.015, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 33/56 (58%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + K R E +++ WP++ E + + V++++ I+S+ D +GWLM FI+G Sbjct: 91 IRLLKDARIELRRVTWPTKQETMSTSWQVLVVVVIASILLWCFDYILGWLMKFIIG 146 >gi|303247803|ref|ZP_07334072.1| preprotein translocase, SecE subunit [Desulfovibrio fructosovorans JJ] gi|302490887|gb|EFL50786.1| preprotein translocase, SecE subunit [Desulfovibrio fructosovorans JJ] Length = 100 Score = 42.7 bits (99), Expect = 0.016, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 35/57 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A FF+Q + E KK+ WP+R E + + + V++ I +++ V+D ++ L+ FIL Sbjct: 43 AAQEFFEQSKVELKKVTWPTRQETIKTGVAVLVFSVIMAIYLGVVDMALSRLVAFIL 99 >gi|332188802|ref|ZP_08390512.1| preprotein translocase, SecE subunit [Sphingomonas sp. S17] gi|332011155|gb|EGI53250.1| preprotein translocase, SecE subunit [Sphingomonas sp. S17] Length = 65 Score = 42.7 bits (99), Expect = 0.016, Method: Compositional matrix adjust. Identities = 20/63 (31%), Positives = 41/63 (65%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + FF QV+ E+KK+ WP+R E +++ ++V++M +I ++FFL +D L+ +L Sbjct: 3 KTTPIEFFNQVKTETKKVVWPTRRETVMTGVMVVVMTTILAIFFLAVDSFFETLVRTLLS 62 Query: 65 IGR 67 + + Sbjct: 63 LAK 65 >gi|89100742|ref|ZP_01173597.1| transcription antitermination protein NusG [Bacillus sp. NRRL B-14911] gi|89084559|gb|EAR63705.1| transcription antitermination protein NusG [Bacillus sp. NRRL B-14911] Length = 56 Score = 42.7 bits (99), Expect = 0.016, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 33/55 (60%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +NFF+ + E +K+ WP R E+ I V++ ++ ++FF V+D I L+ IL Sbjct: 1 MNFFRDIGREMRKVSWPKRKELTSYTITVLVTVTFFALFFAVLDLGISELIRLIL 55 >gi|114798990|ref|YP_760700.1| preprotein translocase, SecE subunit [Hyphomonas neptunium ATCC 15444] gi|114739164|gb|ABI77289.1| preprotein translocase, SecE subunit [Hyphomonas neptunium ATCC 15444] Length = 72 Score = 42.4 bits (98), Expect = 0.019, Method: Compositional matrix adjust. Identities = 20/61 (32%), Positives = 34/61 (55%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R+ + F +QVR E K+ W SR E + + I V+IM + ++F + D I ++F+ Sbjct: 11 KRIGPVTFLRQVRAEGNKVTWTSRQETIQATIFVLIMSFLIAIFLFLTDTVITIFVNFVR 70 Query: 64 G 64 G Sbjct: 71 G 71 >gi|160901845|ref|YP_001567426.1| preprotein translocase, SecE subunit [Petrotoga mobilis SJ95] gi|160359489|gb|ABX31103.1| preprotein translocase, SecE subunit [Petrotoga mobilis SJ95] Length = 72 Score = 42.4 bits (98), Expect = 0.019, Method: Compositional matrix adjust. Identities = 24/62 (38%), Positives = 38/62 (61%), Gaps = 6/62 (9%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID----QSIGWLMH--FILG 64 F V E+KKI WP+R E+L S +VV+I+++I +V+ +D Q WL++ F+ G Sbjct: 7 FLTSVWQEAKKINWPTRKELLNSTLVVLIVIAIFAVYLFAVDFGLLQLFSWLVYPVFLRG 66 Query: 65 IG 66 G Sbjct: 67 SG 68 >gi|225862147|ref|YP_002747525.1| preprotein translocase, SecE subunit [Bacillus cereus 03BB102] gi|225789835|gb|ACO30052.1| preprotein translocase, SecE subunit [Bacillus cereus 03BB102] Length = 59 Score = 42.4 bits (98), Expect = 0.020, Method: Compositional matrix adjust. Identities = 22/54 (40%), Positives = 30/54 (55%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NFF V E KK+ WP + E+L S VI + ++FF V+D I L+ IL Sbjct: 5 NFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAIFFAVVDMGISSLIRLIL 58 >gi|158520713|ref|YP_001528583.1| preprotein translocase, SecE subunit [Desulfococcus oleovorans Hxd3] gi|158509539|gb|ABW66506.1| preprotein translocase, SecE subunit [Desulfococcus oleovorans Hxd3] Length = 130 Score = 42.4 bits (98), Expect = 0.020, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 35/56 (62%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F ++V+ E KK+ WP+R + + S VV++++ I SVF + D +G L+ IL Sbjct: 74 AVQFLREVKVELKKVTWPTRQQTIGSTAVVLLLVMIISVFLGLADLVLGRLIQVIL 129 >gi|84685455|ref|ZP_01013353.1| preprotein translocase, SecE subunit [Maritimibacter alkaliphilus HTCC2654] gi|84666612|gb|EAQ13084.1| preprotein translocase, SecE subunit [Rhodobacterales bacterium HTCC2654] Length = 65 Score = 42.4 bits (98), Expect = 0.020, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 33/51 (64%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 R F +QVR E K+ WP+R EV+++ +VI + ++ +VFF ++D +I Sbjct: 3 RTNPFQFIQQVRSEVSKVTWPTRREVMLTSGMVIALTALVAVFFSLVDLAI 53 >gi|152973942|ref|YP_001373459.1| preprotein translocase subunit SecE [Bacillus cereus subsp. cytotoxis NVH 391-98] gi|152022694|gb|ABS20464.1| preprotein translocase, SecE subunit [Bacillus cytotoxicus NVH 391-98] Length = 59 Score = 42.4 bits (98), Expect = 0.021, Method: Compositional matrix adjust. Identities = 22/54 (40%), Positives = 30/54 (55%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NFF V E KK+ WP + E+L S VI + ++FF V+D I L+ IL Sbjct: 5 NFFGDVSREMKKVSWPKKDELLRSTATVIATVIFFAIFFAVVDMGISSLIRLIL 58 >gi|29653576|ref|NP_819268.1| protein translocase subunit [Coxiella burnetii RSA 493] gi|153208138|ref|ZP_01946566.1| preprotein translocase, SecE subunit [Coxiella burnetii 'MSU Goat Q177'] gi|154706284|ref|YP_001425196.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111] gi|165918639|ref|ZP_02218725.1| preprotein translocase, SecE subunit [Coxiella burnetii RSA 334] gi|212213264|ref|YP_002304200.1| protein translocase subunit [Coxiella burnetii CbuG_Q212] gi|212218058|ref|YP_002304845.1| protein translocase subunit [Coxiella burnetii CbuK_Q154] gi|29540838|gb|AAO89782.1| protein translocase subunit [Coxiella burnetii RSA 493] gi|120576151|gb|EAX32775.1| preprotein translocase, SecE subunit [Coxiella burnetii 'MSU Goat Q177'] gi|154355570|gb|ABS77032.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111] gi|165917667|gb|EDR36271.1| preprotein translocase, SecE subunit [Coxiella burnetii RSA 334] gi|212011674|gb|ACJ19055.1| protein translocase subunit [Coxiella burnetii CbuG_Q212] gi|212012320|gb|ACJ19700.1| protein translocase subunit [Coxiella burnetii CbuK_Q154] Length = 127 Score = 42.4 bits (98), Expect = 0.023, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 4/53 (7%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQ----SIGWL 58 F K R E +K+ WP+R E L + +VVI+M+ I+++ +D +IGW+ Sbjct: 70 GFIKNARTELRKVVWPTRQETLQTTLVVIVMVVITALILWGLDSFFMWAIGWM 122 >gi|56418626|ref|YP_145944.1| preprotein translocase subunit SecE [Geobacillus kaustophilus HTA426] gi|56378468|dbj|BAD74376.1| preprotein translocase subunit [Geobacillus kaustophilus HTA426] Length = 61 Score = 42.4 bits (98), Expect = 0.023, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 34/55 (61%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V+NF K+V E KK+ WP+R E++ VV+ ++ +VFF V+D I L+ + Sbjct: 5 VINFLKEVVRELKKVSWPNRKELVNYTAVVLATVAFFTVFFAVVDLGISELIRLV 59 >gi|261417592|ref|YP_003251274.1| preprotein translocase subunit SecE [Geobacillus sp. Y412MC61] gi|297528467|ref|YP_003669742.1| preprotein translocase, SecE subunit [Geobacillus sp. C56-T3] gi|319765250|ref|YP_004130751.1| preprotein translocase, SecE subunit [Geobacillus sp. Y412MC52] gi|261374049|gb|ACX76792.1| preprotein translocase, SecE subunit [Geobacillus sp. Y412MC61] gi|297251719|gb|ADI25165.1| preprotein translocase, SecE subunit [Geobacillus sp. C56-T3] gi|317110116|gb|ADU92608.1| preprotein translocase, SecE subunit [Geobacillus sp. Y412MC52] Length = 60 Score = 42.4 bits (98), Expect = 0.023, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 34/55 (61%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V+NF K+V E KK+ WP+R E++ VV+ ++ +VFF V+D I L+ + Sbjct: 4 VINFLKEVVRELKKVSWPNRKELVNYTAVVLATVAFFTVFFAVVDLGISELIRLV 58 >gi|158319529|ref|YP_001512036.1| preprotein translocase, SecE subunit [Alkaliphilus oremlandii OhILAs] gi|158139728|gb|ABW18040.1| preprotein translocase, SecE subunit [Alkaliphilus oremlandii OhILAs] Length = 71 Score = 42.0 bits (97), Expect = 0.028, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 35/53 (66%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K VR E KK+ WP++ E+ + +VV+I +++++V ID +G+ ++ I+ Sbjct: 18 FIKGVRSELKKVNWPNKKELTNNSVVVVITVTLATVAIWAIDSILGYGLNLII 70 >gi|94497191|ref|ZP_01303763.1| SecE subunit of protein translocation complex [Sphingomonas sp. SKA58] gi|94423296|gb|EAT08325.1| SecE subunit of protein translocation complex [Sphingomonas sp. SKA58] Length = 68 Score = 42.0 bits (97), Expect = 0.028, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 34/54 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F QV+ E+ KI WP+ E +++ ++V+IM ++ +FF ID G ++ ++L Sbjct: 8 EFVNQVKTEASKIVWPTGRETVMTGVMVVIMTTLLGLFFFGIDTFFGAIVQWLL 61 >gi|145628434|ref|ZP_01784235.1| transcription antitermination protein NusG [Haemophilus influenzae 22.1-21] gi|148827884|ref|YP_001292637.1| preprotein translocase subunit SecE [Haemophilus influenzae PittGG] gi|144980209|gb|EDJ89868.1| transcription antitermination protein NusG [Haemophilus influenzae 22.1-21] gi|148719126|gb|ABR00254.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittGG] Length = 138 Score = 42.0 bits (97), Expect = 0.028, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 34/52 (65%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF R E++K+ WP+R+E + ++VI + I+S+FF +D I +++F+ Sbjct: 82 FFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFL 133 >gi|325577260|ref|ZP_08147744.1| preprotein translocase [Haemophilus parainfluenzae ATCC 33392] gi|325160842|gb|EGC72963.1| preprotein translocase [Haemophilus parainfluenzae ATCC 33392] Length = 138 Score = 42.0 bits (97), Expect = 0.029, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 34/53 (64%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF + + E +K+ WP+R+E + ++VI + ++S+FF ID I L++F+ Sbjct: 81 TFFSEAKVEGRKVVWPTRAETRQTTLIVIAVTVLTSLFFWAIDSIIIALINFL 133 >gi|71083816|ref|YP_266536.1| protein secE/sec61-gamma protein [Candidatus Pelagibacter ubique HTCC1062] gi|91763148|ref|ZP_01265112.1| Protein secE/sec61-gamma protein [Candidatus Pelagibacter ubique HTCC1002] gi|71062929|gb|AAZ21932.1| Protein secE/sec61-gamma protein [Candidatus Pelagibacter ubique HTCC1062] gi|91717561|gb|EAS84212.1| Protein secE/sec61-gamma protein [Candidatus Pelagibacter ubique HTCC1002] Length = 63 Score = 42.0 bits (97), Expect = 0.029, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 36/58 (62%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + F ++V+ E+ K+ WP+ E + ++V M I S+FFL++DQ + +L+ +L + Sbjct: 5 IKFIQEVKQEAFKVSWPTGKETMQGALMVFAMAVIMSLFFLLLDQVLKFLLEALLKVS 62 >gi|289579159|ref|YP_003477786.1| preprotein translocase, SecE subunit [Thermoanaerobacter italicus Ab9] gi|289528872|gb|ADD03224.1| preprotein translocase, SecE subunit [Thermoanaerobacter italicus Ab9] Length = 65 Score = 42.0 bits (97), Expect = 0.029, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 33/57 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + FFK VR E KK+ WPS+ ++ +V+I + +VF +ID +L+ I+ + Sbjct: 9 VKFFKDVRAEMKKVTWPSKESMITYTEIVLIAMVFFTVFIFLIDSVFSYLLKLIIKV 65 >gi|161831611|ref|YP_001596169.1| preprotein translocase, SecE subunit [Coxiella burnetii RSA 331] gi|161763478|gb|ABX79120.1| preprotein translocase, SecE subunit [Coxiella burnetii RSA 331] Length = 127 Score = 42.0 bits (97), Expect = 0.030, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 4/53 (7%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQ----SIGWL 58 F K R E +K+ WP+R E L + +VVI+M+ I+++ +D +IGW+ Sbjct: 70 GFIKNARAELRKVVWPTRQETLRTTLVVIVMVVITALILWGLDSFFMWAIGWM 122 >gi|113474162|ref|YP_720223.1| preprotein translocase subunit SecE [Trichodesmium erythraeum IMS101] gi|110165210|gb|ABG49750.1| protein translocase subunit secE/sec61 gamma [Trichodesmium erythraeum IMS101] Length = 74 Score = 42.0 bits (97), Expect = 0.030, Method: Compositional matrix adjust. Identities = 15/59 (25%), Positives = 35/59 (59%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 L+ + FF++ ++E K+ WPSR +++ + V++M+ +S+ ++D+ W + G Sbjct: 16 LSPVTFFQETKEELDKVVWPSREQLISESVAVLLMVILSATIIYLVDEFFSWGAQVVFG 74 >gi|145639476|ref|ZP_01795081.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittII] gi|145271523|gb|EDK11435.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittII] Length = 138 Score = 42.0 bits (97), Expect = 0.030, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 34/52 (65%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF R E++K+ WP+R+E + ++VI + I+S+FF +D I +++F+ Sbjct: 82 FFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFL 133 >gi|145642381|ref|ZP_01797941.1| transcription antitermination protein NusG [Haemophilus influenzae R3021] gi|145272924|gb|EDK12810.1| transcription antitermination protein NusG [Haemophilus influenzae 22.4-21] Length = 138 Score = 41.6 bits (96), Expect = 0.032, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 34/52 (65%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF R E++K+ WP+R+E + ++VI + I+S+FF +D I +++F+ Sbjct: 82 FFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFL 133 >gi|322434555|ref|YP_004216767.1| preprotein translocase, SecE subunit [Acidobacterium sp. MP5ACTX9] gi|321162282|gb|ADW67987.1| preprotein translocase, SecE subunit [Acidobacterium sp. MP5ACTX9] Length = 85 Score = 41.6 bits (96), Expect = 0.032, Method: Compositional matrix adjust. Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 G RL F VR E KK+ PSR EV + IVVII + I + +F ++D ++G Sbjct: 21 GPARLG--EFLHDVRSEMKKVITPSRDEVQSTTIVVIITVFIFAAYFALVDFAVGH 74 >gi|68249292|ref|YP_248404.1| preprotein translocase subunit SecE [Haemophilus influenzae 86-028NP] gi|145633843|ref|ZP_01789565.1| transcription antitermination protein NusG [Haemophilus influenzae 3655] gi|145635954|ref|ZP_01791639.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittAA] gi|145637967|ref|ZP_01793606.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittHH] gi|148826640|ref|YP_001291393.1| preprotein translocase subunit SecE [Haemophilus influenzae PittEE] gi|229845549|ref|ZP_04465677.1| preprotein translocase subunit SecE [Haemophilus influenzae 6P18H1] gi|229847176|ref|ZP_04467280.1| preprotein translocase subunit SecE [Haemophilus influenzae 7P49H1] gi|260581526|ref|ZP_05849334.1| transcription antitermination protein NusG [Haemophilus influenzae RdAW] gi|260583373|ref|ZP_05851144.1| transcription antitermination protein NusG [Haemophilus influenzae NT127] gi|319775443|ref|YP_004137931.1| preprotein translocase SecE [Haemophilus influenzae F3047] gi|319897849|ref|YP_004136046.1| preprotein translocase sece [Haemophilus influenzae F3031] gi|329122527|ref|ZP_08251111.1| preprotein translocase [Haemophilus aegyptius ATCC 11116] gi|68057491|gb|AAX87744.1| preprotein translocase SecE [Haemophilus influenzae 86-028NP] gi|144985285|gb|EDJ92124.1| transcription antitermination protein NusG [Haemophilus influenzae 3655] gi|145266787|gb|EDK06806.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittAA] gi|145268833|gb|EDK08797.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittHH] gi|148716800|gb|ABQ99010.1| transcription antitermination protein NusG [Haemophilus influenzae PittEE] gi|229809852|gb|EEP45574.1| preprotein translocase subunit SecE [Haemophilus influenzae 7P49H1] gi|229811565|gb|EEP47266.1| preprotein translocase subunit SecE [Haemophilus influenzae 6P18H1] gi|260091824|gb|EEW75779.1| transcription antitermination protein NusG [Haemophilus influenzae RdAW] gi|260093578|gb|EEW77495.1| transcription antitermination protein NusG [Haemophilus influenzae NT127] gi|301169434|emb|CBW29034.1| preprotein translocase membrane subunit [Haemophilus influenzae 10810] gi|309751685|gb|ADO81669.1| Probable preprotein translocase SecE subunit [Haemophilus influenzae R2866] gi|317433355|emb|CBY81734.1| preprotein translocase SecE [Haemophilus influenzae F3031] gi|317450034|emb|CBY86248.1| preprotein translocase SecE [Haemophilus influenzae F3047] gi|327473156|gb|EGF18579.1| preprotein translocase [Haemophilus aegyptius ATCC 11116] Length = 138 Score = 41.6 bits (96), Expect = 0.033, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 34/52 (65%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF R E++K+ WP+R+E + ++VI + I+S+FF +D I +++F+ Sbjct: 82 FFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFL 133 >gi|258591303|emb|CBE67602.1| Preprotein translocase subunit secE [NC10 bacterium 'Dutch sediment'] Length = 64 Score = 41.6 bits (96), Expect = 0.033, Method: Compositional matrix adjust. Identities = 22/53 (41%), Positives = 34/53 (64%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F K+VR E K++ WP R EV+ S IVVI+ + I S+F V+D ++ L+ + Sbjct: 10 QFLKEVRTELKRVNWPLRKEVVGSTIVVIVSVFILSLFLGVVDVTLQKLLTLV 62 >gi|16272656|ref|NP_438874.1| preprotein translocase subunit SecE [Haemophilus influenzae Rd KW20] gi|1173415|sp|P43805|SECE_HAEIN RecName: Full=Preprotein translocase subunit secE gi|1573718|gb|AAC22373.1| preprotein translocase SecE subunit (secE) [Haemophilus influenzae Rd KW20] Length = 106 Score = 41.6 bits (96), Expect = 0.034, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 34/52 (65%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF R E++K+ WP+R+E + ++VI + I+S+FF +D I +++F+ Sbjct: 50 FFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFL 101 >gi|283851490|ref|ZP_06368770.1| preprotein translocase, SecE subunit [Desulfovibrio sp. FW1012B] gi|283573024|gb|EFC21004.1| preprotein translocase, SecE subunit [Desulfovibrio sp. FW1012B] Length = 103 Score = 41.6 bits (96), Expect = 0.036, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 34/54 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF+Q + E KK+ WP+R E + + I V++ + +++ V+D ++ L+ FIL Sbjct: 49 EFFEQSKVELKKVTWPTRQETVKTGIAVLVFSVVMAIYLGVVDMALSRLVAFIL 102 >gi|160331566|ref|XP_001712490.1| secE [Hemiselmis andersenii] gi|159765938|gb|ABW98165.1| secE [Hemiselmis andersenii] Length = 119 Score = 41.6 bits (96), Expect = 0.037, Method: Compositional matrix adjust. Identities = 20/49 (40%), Positives = 32/49 (65%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 N+ +L+FF++V+DE K I WP+ VL ++V+I L S++F ID Sbjct: 56 NKPNILDFFQEVKDEIKMIEWPTFDRVLKQFVIVLISLVFSALFIFSID 104 >gi|94971708|ref|YP_593756.1| SecE subunit of protein translocation complex [Candidatus Koribacter versatilis Ellin345] gi|94553758|gb|ABF43682.1| SecE subunit of protein translocation complex [Candidatus Koribacter versatilis Ellin345] Length = 86 Score = 41.6 bits (96), Expect = 0.038, Method: Compositional matrix adjust. Identities = 20/47 (42%), Positives = 31/47 (65%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG 56 +F+ VR E KK+ PSR EV + +VVII + I ++F ++D +IG Sbjct: 27 SFYNDVRTEMKKVSTPSRKEVQSTTVVVIITVFIFGLYFWLVDNAIG 73 >gi|289641397|ref|ZP_06473561.1| preprotein translocase, SecE subunit [Frankia symbiont of Datisca glomerata] gi|289508733|gb|EFD29668.1| preprotein translocase, SecE subunit [Frankia symbiont of Datisca glomerata] Length = 82 Score = 41.6 bits (96), Expect = 0.040, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 31/51 (60%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 G R L F+++V E +K+ +P RSE++ VIVV++ SI+ F +D Sbjct: 20 GRRRTTPLRFYREVVAELRKVVYPGRSELVTYVIVVLVFCSITVAFVASLD 70 >gi|89893199|ref|YP_516686.1| preprotein translocase subunit SecE [Desulfitobacterium hafniense Y51] gi|89332647|dbj|BAE82242.1| hypothetical protein [Desulfitobacterium hafniense Y51] Length = 72 Score = 41.2 bits (95), Expect = 0.045, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +FK V E KK+ WP R ++L VV+ ++I +V V+D + LM ILG Sbjct: 18 EYFKGVWSELKKVHWPDRKQLLTYTGVVLTAVAIVAVMLWVVDSGLSILMTKILG 72 >gi|313673494|ref|YP_004051605.1| preprotein translocase, sece subunit [Calditerrivibrio nitroreducens DSM 19672] gi|312940250|gb|ADR19442.1| preprotein translocase, SecE subunit [Calditerrivibrio nitroreducens DSM 19672] Length = 60 Score = 41.2 bits (95), Expect = 0.048, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 39/56 (69%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +NF K+V++E KKI WP++ E + + VV+I + + ++F V+D ++ ++ FI+G Sbjct: 5 VNFIKEVKEELKKIVWPTKDETIGTTTVVVIFVVLMAIFLGVVDVALSKIIQFIVG 60 >gi|16330013|ref|NP_440741.1| secretory protein SecE [Synechocystis sp. PCC 6803] gi|585980|sp|P38382|SECE_SYNY3 RecName: Full=Preprotein translocase subunit secE gi|1652500|dbj|BAA17421.1| secretory protein; SecE [Synechocystis sp. PCC 6803] Length = 81 Score = 41.2 bits (95), Expect = 0.048, Method: Compositional matrix adjust. Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH--F 61 N A NF +DE K+ WPSR +++ + VI+M+ + S +DQ GW+ F Sbjct: 19 NVQARSNFIAATKDELAKVVWPSRQQLISESVAVILMVILVSTVIYFVDQIFGWITKQPF 78 Query: 62 ILG 64 + G Sbjct: 79 LFG 81 >gi|292492408|ref|YP_003527847.1| preprotein translocase subunit SecE [Nitrosococcus halophilus Nc4] gi|291581003|gb|ADE15460.1| preprotein translocase, SecE subunit [Nitrosococcus halophilus Nc4] Length = 112 Score = 41.2 bits (95), Expect = 0.050, Method: Compositional matrix adjust. Identities = 16/58 (27%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A L+F + R E +K+ WPSR E + + ++V++M+ + + + D + W++ + G Sbjct: 55 AALSFAGETRTEFRKVVWPSRQETIRTTLIVLLMVMVMASILWLFDTLLMWIVRLLTG 112 >gi|301154975|emb|CBW14438.1| preprotein translocase membrane subunit [Haemophilus parainfluenzae T3T1] Length = 138 Score = 41.2 bits (95), Expect = 0.053, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 34/53 (64%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF + + E +K+ WP+R+E + ++VI + ++S+FF ID I L++F+ Sbjct: 81 TFFSEAKVEGRKVVWPTRAETRQTTLIVIGVTVLTSLFFWAIDSIIIALINFL 133 >gi|298490350|ref|YP_003720527.1| preprotein translocase subunit SecE ['Nostoc azollae' 0708] gi|298232268|gb|ADI63404.1| preprotein translocase, SecE subunit ['Nostoc azollae' 0708] Length = 73 Score = 40.8 bits (94), Expect = 0.057, Method: Compositional matrix adjust. Identities = 15/54 (27%), Positives = 33/54 (61%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 N ++ NFF+ ++E +K+ WPSR +++ V++M+++S+ ++D W Sbjct: 14 NGFSLNNFFQGTKEELEKVVWPSRKQLVSESAAVLLMVTLSASLIYLVDGLFAW 67 >gi|262370139|ref|ZP_06063466.1| preprotein translocase subunit SecE [Acinetobacter johnsonii SH046] gi|262315178|gb|EEY96218.1| preprotein translocase subunit SecE [Acinetobacter johnsonii SH046] Length = 146 Score = 40.8 bits (94), Expect = 0.058, Method: Compositional matrix adjust. Identities = 16/54 (29%), Positives = 31/54 (57%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K R E +++ WP++ E + + V+ ++ ++S+ D +GWLM FI+G Sbjct: 93 LLKDSRIELRRVTWPTKQETMTTSWQVLAVVVVASILLWCFDYILGWLMKFIIG 146 >gi|109896920|ref|YP_660175.1| preprotein translocase, SecE subunit [Pseudoalteromonas atlantica T6c] gi|109699201|gb|ABG39121.1| protein translocase subunit secE/sec61 gamma [Pseudoalteromonas atlantica T6c] gi|332172373|gb|AEE21627.1| preprotein translocase, SecE subunit [Glaciecola agarilytica 4H-3-7+YE-5] Length = 125 Score = 40.8 bits (94), Expect = 0.060, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 32/58 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 L F K R E +K+ WP+R E + I+V++ + S+ +D I L+ FI G+G Sbjct: 67 LTFAKDARTEVRKVVWPTRQEATQTTIIVLVATAFMSLVLWGLDLIIVQLVSFITGLG 124 >gi|255320103|ref|ZP_05361295.1| preprotein translocase iisp family, membrane subunit [Acinetobacter radioresistens SK82] gi|262379960|ref|ZP_06073115.1| preprotein translocase subunit SecE [Acinetobacter radioresistens SH164] gi|255302821|gb|EET82046.1| preprotein translocase iisp family, membrane subunit [Acinetobacter radioresistens SK82] gi|262298154|gb|EEY86068.1| preprotein translocase subunit SecE [Acinetobacter radioresistens SH164] Length = 146 Score = 40.8 bits (94), Expect = 0.062, Method: Compositional matrix adjust. Identities = 16/54 (29%), Positives = 31/54 (57%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K R E +++ WP++ E + + V+ ++ ++S+ D +GWLM FI+G Sbjct: 93 LLKDSRIELRRVTWPTKQETMTTSWQVLAVVVVASILLWCFDYILGWLMKFIIG 146 >gi|217076741|ref|YP_002334457.1| preprotein translocase, SecE subunit [Thermosipho africanus TCF52B] gi|217036594|gb|ACJ75116.1| preprotein translocase, SecE subunit [Thermosipho africanus TCF52B] Length = 62 Score = 40.8 bits (94), Expect = 0.063, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 29/43 (67%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 FF++V+ E KK WP+R E+ + VV+++L ++ V+F +D Sbjct: 6 KFFREVKTEIKKTHWPNRKELWGATGVVLVILLVTGVYFFALD 48 >gi|239907758|ref|YP_002954499.1| preprotein translocase SecE subunit [Desulfovibrio magneticus RS-1] gi|239797624|dbj|BAH76613.1| preprotein translocase SecE subunit [Desulfovibrio magneticus RS-1] Length = 99 Score = 40.8 bits (94), Expect = 0.067, Method: Compositional matrix adjust. Identities = 16/54 (29%), Positives = 33/54 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF+Q + E +K+ WP+R E + + I V++ + +++ V+D ++ L+ IL Sbjct: 45 EFFEQAKGELRKVTWPTREETVKTGIAVLVFSVVMAIYLGVVDMALSRLVALIL 98 >gi|311029033|ref|ZP_07707123.1| preprotein translocase subunit SecE [Bacillus sp. m3-13] Length = 60 Score = 40.8 bits (94), Expect = 0.069, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 30/55 (54%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF+ V E KK+ WP R E+ I V+ + +VFF VID I L+ ++ Sbjct: 6 NFFRDVAREMKKVSWPKRQELTRYTITVVTTVLFVAVFFWVIDLGISELIRALIN 60 >gi|99080067|ref|YP_612221.1| preprotein translocase subunit SecE [Ruegeria sp. TM1040] gi|99036347|gb|ABF62959.1| protein translocase subunit secE/sec61 gamma [Ruegeria sp. TM1040] Length = 65 Score = 40.4 bits (93), Expect = 0.073, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 39/57 (68%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F +QVR E K+ WP+R EVL++ ++V IM ++++ FF V+D I ++ +LG+ Sbjct: 7 VKFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALAAAFFAVVDLLIRTGLNGVLGL 63 >gi|309973787|gb|ADO96988.1| Probable preprotein translocase SecE subunit [Haemophilus influenzae R2846] Length = 138 Score = 40.4 bits (93), Expect = 0.073, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 33/52 (63%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF R E+ K+ WP+R+E + ++VI + I+S+FF +D I +++F+ Sbjct: 82 FFNDSRTEAHKVVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFL 133 >gi|186685894|ref|YP_001869090.1| preprotein translocase subunit SecE [Nostoc punctiforme PCC 73102] gi|186468346|gb|ACC84147.1| preprotein translocase, SecE subunit [Nostoc punctiforme PCC 73102] Length = 73 Score = 40.4 bits (93), Expect = 0.074, Method: Compositional matrix adjust. Identities = 15/55 (27%), Positives = 32/55 (58%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 N ++ NF + ++E K+ WPSR +++ V++M+++S+ ++D GW Sbjct: 13 TNGFSLGNFIQGTKEELDKVVWPSRKQIVSESAAVLLMVALSASLIYLVDGLFGW 67 >gi|220909379|ref|YP_002484690.1| preprotein translocase subunit SecE [Cyanothece sp. PCC 7425] gi|219865990|gb|ACL46329.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 7425] Length = 83 Score = 40.4 bits (93), Expect = 0.075, Method: Compositional matrix adjust. Identities = 14/53 (26%), Positives = 30/53 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF++ ++E K+ WP R ++ + V++M+++S+ ++DQ W I Sbjct: 30 QFFQETKEELDKVVWPDRQRLIGESVAVVLMVALSATTIYLVDQLFSWAASLI 82 >gi|78778594|ref|YP_396706.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. MIT 9312] gi|78712093|gb|ABB49270.1| protein translocase subunit secE/sec61 gamma [Prochlorococcus marinus str. MIT 9312] Length = 80 Score = 40.4 bits (93), Expect = 0.075, Method: Compositional matrix adjust. Identities = 18/55 (32%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF+ DE K + WP++ ++ + VIIM+S S+ + + GW I G Sbjct: 26 NFFRSTYDELKLVVWPNKQQLFSESVAVIIMVSFSAAAIASVSRFYGWAASQIFG 80 >gi|126695564|ref|YP_001090450.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. MIT 9301] gi|126542607|gb|ABO16849.1| putative preprotein translocase, SecE subunit [Prochlorococcus marinus str. MIT 9301] Length = 80 Score = 40.4 bits (93), Expect = 0.078, Method: Compositional matrix adjust. Identities = 18/55 (32%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF+ DE K + WP++ ++ + VIIM+S S+ + + GW I G Sbjct: 26 NFFRSTYDELKLVVWPNKQQLFSESVAVIIMVSFSAAAIASVSRFYGWAASQIFG 80 >gi|289433599|ref|YP_003463471.1| preprotein translocase, SecE subunit [Listeria seeligeri serovar 1/2b str. SLCC3954] gi|289169843|emb|CBH26381.1| preprotein translocase, SecE subunit [Listeria seeligeri serovar 1/2b str. SLCC3954] gi|313635073|gb|EFS01423.1| preprotein translocase, SecE subunit [Listeria seeligeri FSL N1-067] gi|313639749|gb|EFS04502.1| preprotein translocase, SecE subunit [Listeria seeligeri FSL S4-171] Length = 59 Score = 40.4 bits (93), Expect = 0.080, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 35/57 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ FF+ V E K+ WP+R E+L + V+I + + +VFF+VID I L+ I+ Sbjct: 3 AIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVILFAVFFMVIDFGIEQLIQLIM 59 >gi|123967761|ref|YP_001008619.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. AS9601] gi|123197871|gb|ABM69512.1| putative preprotein translocase, SecE subunit [Prochlorococcus marinus str. AS9601] Length = 80 Score = 40.4 bits (93), Expect = 0.080, Method: Compositional matrix adjust. Identities = 18/55 (32%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF+ DE K + WP++ ++ + VIIM+S S+ + + GW I G Sbjct: 26 NFFRSTYDELKLVVWPNKQQLFSESVAVIIMVSFSAAAIASVSRFYGWAASQIFG 80 >gi|297624699|ref|YP_003706133.1| preprotein translocase subunitSecE [Truepera radiovictrix DSM 17093] gi|297165879|gb|ADI15590.1| preprotein translocase, SecE subunit [Truepera radiovictrix DSM 17093] Length = 59 Score = 40.4 bits (93), Expect = 0.080, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +L + + R E ++ WP+R EV+ S +I + I+S+F L D +G L++ L Sbjct: 3 GLLRYLRNSRAELGRVTWPTRQEVVQSTQATLIFVLITSLFLLATDTVLGNLINLFL 59 >gi|239618208|ref|YP_002941530.1| preprotein translocase, SecE subunit [Kosmotoga olearia TBF 19.5.1] gi|239507039|gb|ACR80526.1| preprotein translocase, SecE subunit [Kosmotoga olearia TBF 19.5.1] Length = 68 Score = 40.4 bits (93), Expect = 0.081, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 4/58 (6%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID----QSIGWLMHFILG 64 F +VR E+KK+ WP+R ++L + V+++L + +F ++D IG L+ F+ G Sbjct: 9 FITEVRQETKKVTWPNRKQLLSTTGAVMVVLLVCGIFLGLLDIIFTNVIGDLLKFLTG 66 >gi|56750898|ref|YP_171599.1| preprotein translocase subunit SecE [Synechococcus elongatus PCC 6301] gi|81299447|ref|YP_399655.1| preprotein translocase subunit SecE [Synechococcus elongatus PCC 7942] gi|56685857|dbj|BAD79079.1| preprotein translocase SecE subunit [Synechococcus elongatus PCC 6301] gi|81168328|gb|ABB56668.1| protein translocase subunit secE/sec61 gamma [Synechococcus elongatus PCC 7942] Length = 81 Score = 40.4 bits (93), Expect = 0.082, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 34/59 (57%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 L +++F ++ R E K+ WPSR +++ V++M+S+S+ +I++ W + G Sbjct: 23 LNLVSFLQETRAELSKVVWPSRQQLISESAAVLLMVSLSATLIYLINELFSWASSRVFG 81 >gi|34499654|ref|NP_903869.1| preprotein translocase subunit SecE [Chromobacterium violaceum ATCC 12472] gi|34105504|gb|AAQ61859.1| preprotein translocase transmembrane,secE subunit [Chromobacterium violaceum ATCC 12472] Length = 118 Score = 40.4 bits (93), Expect = 0.085, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 33/51 (64%), Gaps = 1/51 (1%) Query: 18 ESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH-FILGIGR 67 E++K+ WP+R E ++V + +++ ++F ++D S+ WL + ILG GR Sbjct: 68 EARKVVWPTRKEATQVTLMVFVFVTVLALFMWLVDSSLSWLFYDVILGRGR 118 >gi|237809528|ref|YP_002893968.1| preprotein translocase, SecE subunit [Tolumonas auensis DSM 9187] gi|237501789|gb|ACQ94382.1| preprotein translocase, SecE subunit [Tolumonas auensis DSM 9187] Length = 127 Score = 40.4 bits (93), Expect = 0.087, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A+L F ++ E +K+ WP+R E + + +++ + +F +ID ++ WL+ I G+ Sbjct: 67 ALLTFSRESIKEVRKVVWPTRQETIQTTLIIFAFTVVMGLFLFLIDGALIWLVELITGM 125 >gi|198282624|ref|YP_002218945.1| preprotein translocase subunit SecE [Acidithiobacillus ferrooxidans ATCC 53993] gi|218665561|ref|YP_002424816.1| preprotein translocase, SecE subunit [Acidithiobacillus ferrooxidans ATCC 23270] gi|198247145|gb|ACH82738.1| preprotein translocase, SecE subunit [Acidithiobacillus ferrooxidans ATCC 53993] gi|218517774|gb|ACK78360.1| preprotein translocase, SecE subunit [Acidithiobacillus ferrooxidans ATCC 23270] Length = 116 Score = 40.4 bits (93), Expect = 0.088, Method: Compositional matrix adjust. Identities = 18/61 (29%), Positives = 39/61 (63%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 N A+L FF++ E K+ WP+R EV+ S ++I ++++ ++F ++D ++ ++ +L Sbjct: 53 NGKALLVFFREAYVELLKVVWPTRPEVVRSTAIIIGLIAVIAIFLWLVDMALLGIVRLLL 112 Query: 64 G 64 G Sbjct: 113 G 113 >gi|331007101|ref|ZP_08330324.1| Preprotein translocase subunit SecE [gamma proteobacterium IMCC1989] gi|330419096|gb|EGG93539.1| Preprotein translocase subunit SecE [gamma proteobacterium IMCC1989] Length = 122 Score = 40.4 bits (93), Expect = 0.089, Method: Compositional matrix adjust. Identities = 17/58 (29%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A+ + K+ + E +K+ WPSR E + ++V+++ I ++ +D IGW+ I+G Sbjct: 65 AIWHTVKESQTEIRKVVWPSRQETNQTALIVVVLTIIMALILWGLDTFIGWIASLIIG 122 >gi|319639536|ref|ZP_07994283.1| preprotein translocase subunit SecE [Neisseria mucosa C102] gi|317399107|gb|EFV79781.1| preprotein translocase subunit SecE [Neisseria mucosa C102] Length = 91 Score = 40.0 bits (92), Expect = 0.092, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 29/55 (52%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 + + +FK E KK+ WPSR E + + VII ++I + F V D I WL Sbjct: 27 KKEGLFAYFKSSWTEFKKVVWPSRDEAVKMTVFVIIFVAILAAFIYVADTIISWL 81 >gi|302036652|ref|YP_003796974.1| preprotein translocase subunit SecE [Candidatus Nitrospira defluvii] gi|300604716|emb|CBK41048.1| Preprotein translocase, subunit SecE [Candidatus Nitrospira defluvii] Length = 64 Score = 40.0 bits (92), Expect = 0.097, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 33/54 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 ++ F VR E KK+ +PS++E + + VVI+ + S++ ++D +GWLM Sbjct: 8 SIREFIDGVRGELKKVSFPSKAETIGATTVVIVFCILMSLYLSMMDSVLGWLMR 61 >gi|223042950|ref|ZP_03612998.1| preprotein translocase, SecE subunit [Staphylococcus capitis SK14] gi|314932759|ref|ZP_07840128.1| preprotein translocase, SecE subunit [Staphylococcus caprae C87] gi|222443804|gb|EEE49901.1| preprotein translocase, SecE subunit [Staphylococcus capitis SK14] gi|313654440|gb|EFS18193.1| preprotein translocase, SecE subunit [Staphylococcus caprae C87] Length = 60 Score = 40.0 bits (92), Expect = 0.097, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 30/55 (54%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFFK V+ E +K WP++ E+ ++V+ + VFF +D I L +LG Sbjct: 6 NFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDVGINALKQLLLG 60 >gi|237738809|ref|ZP_04569290.1| protein translocase subunit sece [Fusobacterium sp. 2_1_31] gi|229423912|gb|EEO38959.1| protein translocase subunit sece [Fusobacterium sp. 2_1_31] Length = 58 Score = 40.0 bits (92), Expect = 0.098, Method: Compositional matrix adjust. Identities = 20/44 (45%), Positives = 29/44 (65%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +N F++V+ E K+ WPS++EV+ S I VI M I SV+ V D Sbjct: 1 MNLFQKVKMEYSKVEWPSKTEVIHSTIWVITMTVIVSVYLGVFD 44 >gi|20808674|ref|NP_623845.1| preprotein translocase subunit SecE [Thermoanaerobacter tengcongensis MB4] gi|20517310|gb|AAM25449.1| Preprotein translocase subunit SecE [Thermoanaerobacter tengcongensis MB4] Length = 66 Score = 40.0 bits (92), Expect = 0.099, Method: Compositional matrix adjust. Identities = 15/56 (26%), Positives = 35/56 (62%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ FF++V+ E KK+ WP R ++ VV++++ + ++F ++D +++ IL Sbjct: 8 IVKFFREVKAEMKKVTWPGRDTMITYTEVVLVVMVLFTIFIFLVDSVFSYILKLIL 63 >gi|262067339|ref|ZP_06026951.1| preprotein translocase, SecE subunit [Fusobacterium periodonticum ATCC 33693] gi|291378902|gb|EFE86420.1| preprotein translocase, SecE subunit [Fusobacterium periodonticum ATCC 33693] Length = 58 Score = 40.0 bits (92), Expect = 0.10, Method: Compositional matrix adjust. Identities = 20/44 (45%), Positives = 29/44 (65%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +N F++V+ E K+ WPS++EV+ S I VI M I SV+ V D Sbjct: 1 MNLFQKVKMEYSKVEWPSKTEVIHSTIWVITMTVIVSVYLGVFD 44 >gi|92112541|ref|YP_572469.1| protein translocase subunit secE/sec61 gamma [Chromohalobacter salexigens DSM 3043] gi|91795631|gb|ABE57770.1| protein translocase subunit secE/sec61 gamma [Chromohalobacter salexigens DSM 3043] Length = 122 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 15/58 (25%), Positives = 33/58 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A+ + R E +++ WP+R E + + +V++ + + + +ID +GW+M I+G Sbjct: 65 ALAELARGSRKEIRRVVWPTRPETIQTTAIVLVAVLLVGIMLWLIDTLLGWIMSGIIG 122 >gi|17232790|ref|NP_489338.1| preprotein translocase subunit SecE [Nostoc sp. PCC 7120] gi|75908764|ref|YP_323060.1| preprotein translocase subunit SecE [Anabaena variabilis ATCC 29413] gi|17134437|dbj|BAB76997.1| secretory protein [Nostoc sp. PCC 7120] gi|75702489|gb|ABA22165.1| protein translocase subunit secE/sec61 gamma [Anabaena variabilis ATCC 29413] Length = 73 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 14/49 (28%), Positives = 31/49 (63%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 NFF+ ++E +K+ WPSR +++ V++M+++S+ ++D W+ Sbjct: 20 NFFQGTKEELEKVVWPSRKQLISESAAVLLMVTLSASLIYLVDGLFAWV 68 >gi|257095053|ref|YP_003168694.1| preprotein translocase subunit SecE [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] gi|257047577|gb|ACV36765.1| preprotein translocase, SecE subunit [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] Length = 117 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 14/51 (27%), Positives = 30/51 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 F K+ E+KK+ WPSR E + + +V + + ++F + D+ + W+++ Sbjct: 58 GFAKEASTEAKKVVWPSRKETMQTTGLVFAFVVVMALFLWLTDKGLEWVLY 108 >gi|119485149|ref|ZP_01619534.1| translocase [Lyngbya sp. PCC 8106] gi|119457377|gb|EAW38502.1| translocase [Lyngbya sp. PCC 8106] Length = 74 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 16/57 (28%), Positives = 32/57 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V++FFK+ ++E K+ WPSR ++ V++M+ +S+ ++D W + G Sbjct: 18 VVDFFKETKEELDKVVWPSRQQLFSESAGVLLMIMLSATLIYLVDNIFRWASGQVFG 74 >gi|294781918|ref|ZP_06747250.1| preprotein translocase, SecE subunit [Fusobacterium sp. 1_1_41FAA] gi|294481729|gb|EFG29498.1| preprotein translocase, SecE subunit [Fusobacterium sp. 1_1_41FAA] Length = 58 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 20/44 (45%), Positives = 29/44 (65%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +N F++V+ E K+ WPS++EV+ S I VI M I SV+ V D Sbjct: 1 MNLFQKVKMEYSKVEWPSKTEVIHSTIWVITMTVIVSVYLGVFD 44 >gi|119502909|ref|ZP_01624994.1| translocase [marine gamma proteobacterium HTCC2080] gi|119461255|gb|EAW42345.1| translocase [marine gamma proteobacterium HTCC2080] Length = 119 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 17/58 (29%), Positives = 32/58 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A K R E +K+ WP+R E + ++V++ + I ++ ID +GWL+ ++G Sbjct: 62 AFWQLIKGSRTEIRKVVWPTRQETTQTTLIVVVFVFIMALILWGIDSVLGWLVGMVIG 119 >gi|225175688|ref|ZP_03729682.1| preprotein translocase, SecE subunit [Dethiobacter alkaliphilus AHT 1] gi|225169017|gb|EEG77817.1| preprotein translocase, SecE subunit [Dethiobacter alkaliphilus AHT 1] Length = 64 Score = 40.0 bits (92), Expect = 0.12, Method: Compositional matrix adjust. Identities = 20/63 (31%), Positives = 33/63 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M N + K V+ E KK+ WPSR EV + +V++ + + VFF ++D ++ Sbjct: 1 MAANVKVLTKHIKDVKQELKKVHWPSRREVTLFTSIVLMAILVIGVFFWILDTGFTGMLQ 60 Query: 61 FIL 63 IL Sbjct: 61 LIL 63 >gi|299137912|ref|ZP_07031092.1| preprotein translocase, SecE subunit [Acidobacterium sp. MP5ACTX8] gi|298599842|gb|EFI56000.1| preprotein translocase, SecE subunit [Acidobacterium sp. MP5ACTX8] Length = 87 Score = 40.0 bits (92), Expect = 0.12, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG 56 G RL +F K VR+E +K+ P+R+EV + IVVI + I + +F ++D +G Sbjct: 22 GPERLT--SFLKDVREEMRKVVTPTRAEVQSTTIVVIATVFIFAAYFEIVDLILG 74 >gi|89053050|ref|YP_508501.1| protein translocase subunit secE/sec61 gamma [Jannaschia sp. CCS1] gi|88862599|gb|ABD53476.1| protein translocase subunit secE/sec61 gamma [Jannaschia sp. CCS1] Length = 63 Score = 40.0 bits (92), Expect = 0.12, Method: Compositional matrix adjust. Identities = 14/43 (32%), Positives = 27/43 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 F +Q R E K+ WP+R EV+ + +V ++ ++++FF +D Sbjct: 6 QFLQQTRAEVAKVVWPTRKEVITTTAMVFLLALVAAIFFFGVD 48 >gi|257126640|ref|YP_003164754.1| preprotein translocase, SecE subunit [Leptotrichia buccalis C-1013-b] gi|257050579|gb|ACV39763.1| preprotein translocase, SecE subunit [Leptotrichia buccalis C-1013-b] Length = 71 Score = 39.7 bits (91), Expect = 0.12, Method: Compositional matrix adjust. Identities = 15/48 (31%), Positives = 31/48 (64%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 F +R+E KKI+WP + EV ++VI+M + +++ L+ D + +++ Sbjct: 10 FGNLREEYKKIYWPDKIEVYHVTVIVILMTAFIAIYTLLFDTAFNFVL 57 >gi|292486721|ref|YP_003529591.1| preprotein translocase subunit SecE [Erwinia amylovora CFBP1430] gi|292897954|ref|YP_003537323.1| preprotein translocase SecE subunit [Erwinia amylovora ATCC 49946] gi|291197802|emb|CBJ44897.1| preprotein translocase SecE subunit [Erwinia amylovora ATCC 49946] gi|291552138|emb|CBA19175.1| Preprotein translocase subunit secE [Erwinia amylovora CFBP1430] gi|312170786|emb|CBX79047.1| Preprotein translocase subunit secE [Erwinia amylovora ATCC BAA-2158] Length = 127 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATLAFAREARTEVRKVVWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|242372753|ref|ZP_04818327.1| preprotein translocase subunit SecE [Staphylococcus epidermidis M23864:W1] gi|242349526|gb|EES41127.1| preprotein translocase subunit SecE [Staphylococcus epidermidis M23864:W1] Length = 65 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 30/55 (54%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFFK V+ E +K WP++ E+ ++V+ + VFF +D I L +LG Sbjct: 11 NFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDIGINALKQLLLG 65 >gi|22087315|gb|AAM90926.1|AF502176_2 preprotein translocase SecE subunit [Rickettsia typhi] Length = 37 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 24/31 (77%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVI 38 + FF+QV+ E+ K+FWP+R E++ S +VV+ Sbjct: 7 IYKFFEQVKQETYKVFWPNRKELIASTLVVV 37 >gi|282899202|ref|ZP_06307176.1| SecE subunit of protein translocation complex [Cylindrospermopsis raciborskii CS-505] gi|281195885|gb|EFA70808.1| SecE subunit of protein translocation complex [Cylindrospermopsis raciborskii CS-505] Length = 73 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 30/48 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 NFF+ ++E +K+ WPSR +++ V++M+++S+ ++D W Sbjct: 20 NFFQGTKEELEKVVWPSRKQLVSESAAVLLMVTLSASLIYLVDGLFAW 67 >gi|51894227|ref|YP_076918.1| hypothetical protein STH3092 [Symbiobacterium thermophilum IAM 14863] gi|51857916|dbj|BAD42074.1| conserved domain protein [Symbiobacterium thermophilum IAM 14863] Length = 123 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 32/55 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + ++V E +K+ WPSR V+ + +V+ M+++ + F + D IG LM +L Sbjct: 69 TYLREVVGELRKVVWPSRERVIKATGIVVAMVALVAGFLYLWDLGIGALMELLLA 123 >gi|188532308|ref|YP_001906105.1| preprotein translocase subunit SecE [Erwinia tasmaniensis Et1/99] gi|188027350|emb|CAO95195.1| Preprotein translocase, secE subunit [Erwinia tasmaniensis Et1/99] Length = 127 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATLAFAREARTEVRKVVWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|160872765|ref|ZP_02062897.1| preprotein translocase, SecE subunit [Rickettsiella grylli] gi|159121564|gb|EDP46902.1| preprotein translocase, SecE subunit [Rickettsiella grylli] Length = 104 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 32/52 (61%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F + R E +K+ WP+R E + + ++VI+M+ ++ +F ID + W + F+ Sbjct: 51 FAQASRAELRKVVWPTREETIRTTLIVIVMVIVAGLFLWAIDTLLLWAVAFL 102 >gi|150020535|ref|YP_001305889.1| preprotein translocase, SecE subunit [Thermosipho melanesiensis BI429] gi|149793056|gb|ABR30504.1| preprotein translocase, SecE subunit [Thermosipho melanesiensis BI429] Length = 62 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 16/43 (37%), Positives = 29/43 (67%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 FF++V+ E KK WP++ E+ + VV+ +L ++ V+F V+D Sbjct: 6 KFFREVKTEIKKTHWPNKKELWGATGVVLFILLVTGVYFFVLD 48 >gi|283476716|emb|CAY72545.1| secE [Erwinia pyrifoliae DSM 12163] gi|310766068|gb|ADP11018.1| hypothetical protein EJP617_13370 [Erwinia sp. Ejp617] Length = 127 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATLAFAREARTEVRKVVWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|260858090|ref|YP_003231981.1| preprotein translocase membrane subunit SecE [Escherichia coli O26:H11 str. 11368] gi|257756739|dbj|BAI28241.1| preprotein translocase membrane subunit SecE [Escherichia coli O26:H11 str. 11368] gi|323155527|gb|EFZ41705.1| preprotein translocase, SecE subunit [Escherichia coli EPECa14] Length = 127 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 18/63 (28%), Positives = 35/63 (55%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 N A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 63 TNGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGL 125 >gi|50083573|ref|YP_045083.1| preprotein translocase subunit SecE [Acinetobacter sp. ADP1] gi|49529549|emb|CAG67261.1| preprotein translocase IISP family, membrane subunit [Acinetobacter sp. ADP1] Length = 146 Score = 39.7 bits (91), Expect = 0.13, Method: Compositional matrix adjust. Identities = 15/56 (26%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + K R E +++ WP++ E + + V++++ I+S+ D +GWL+ I+G Sbjct: 91 IRLLKDARIELRRVTWPTKQETVTTSWQVLLVVVITSIVLWCFDYGLGWLIKLIIG 146 >gi|227825214|ref|ZP_03990046.1| predicted protein [Acidaminococcus sp. D21] gi|226905713|gb|EEH91631.1| predicted protein [Acidaminococcus sp. D21] Length = 74 Score = 39.7 bits (91), Expect = 0.14, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 30/59 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L FF+ V++E KK+ WP+R E+ VI+ SS+ ID L ++G+ Sbjct: 15 GALGFFRDVKNEMKKVAWPNRRELGGYTATVIVAAITSSLLIWAIDAVFSVLFRLVMGV 73 >gi|254302297|ref|ZP_04969655.1| possible preprotein translocase SecE [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] gi|148322489|gb|EDK87739.1| possible preprotein translocase SecE [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] Length = 58 Score = 39.7 bits (91), Expect = 0.14, Method: Compositional matrix adjust. Identities = 19/44 (43%), Positives = 29/44 (65%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +N F++V+ E K+ WPSR+EV+ S I V+ M I S++ V D Sbjct: 1 MNLFQKVKMEYSKVEWPSRTEVIHSTIWVVTMTVIISIYLGVFD 44 >gi|328958749|ref|YP_004376135.1| preprotein translocase subunit SecE [Carnobacterium sp. 17-4] gi|328675073|gb|AEB31119.1| preprotein translocase subunit SecE [Carnobacterium sp. 17-4] Length = 59 Score = 39.7 bits (91), Expect = 0.14, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 30/54 (55%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NFF VR E K + WP+ E+ + V ++ + +FF V+D IG L+ IL Sbjct: 6 NFFGGVRQEIKTVTWPTGKELRKYTLTVFVVCLLFVLFFAVVDFGIGALLDLIL 59 >gi|313888194|ref|ZP_07821868.1| preprotein translocase, SecE subunit [Peptoniphilus harei ACS-146-V-Sch2b] gi|312845884|gb|EFR33271.1| preprotein translocase, SecE subunit [Peptoniphilus harei ACS-146-V-Sch2b] Length = 71 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 33/53 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +F+ V+ E KK+ WP++ V+ I+VI+ + +SS+ L D+ I +L FI Sbjct: 18 RYFRGVKSEFKKVVWPTKDTVIKYSIIVIVAVILSSLLLLAYDKIIMFLFGFI 70 >gi|167039506|ref|YP_001662491.1| preprotein translocase, SecE subunit [Thermoanaerobacter sp. X514] gi|166853746|gb|ABY92155.1| preprotein translocase, SecE subunit [Thermoanaerobacter sp. X514] Length = 51 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 16/40 (40%), Positives = 28/40 (70%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVF 47 ++ FFK +R E KK+ WPSR V+ +V+I++++ +VF Sbjct: 8 IVKFFKDIRAEMKKVTWPSRKTVITYTEIVLIVMALLTVF 47 >gi|224370703|ref|YP_002604867.1| SecE [Desulfobacterium autotrophicum HRM2] gi|223693420|gb|ACN16703.1| SecE [Desulfobacterium autotrophicum HRM2] Length = 113 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 35/57 (61%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FF++VR E KK+ WP++ + S +VVII++ I + F ++D + L+ +L Sbjct: 57 AVRFFREVRVELKKVTWPNQKQTAGSTVVVIILVFILAAFLGLVDFGLSKLVQVVLA 113 >gi|254526722|ref|ZP_05138774.1| preprotein translocase, SecE subunit [Prochlorococcus marinus str. MIT 9202] gi|221538146|gb|EEE40599.1| preprotein translocase, SecE subunit [Prochlorococcus marinus str. MIT 9202] Length = 80 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF+ DE K + WP++ ++ + VIIM++ S+ + + GW I G Sbjct: 26 NFFRSTYDELKLVVWPNKQQLFSESVAVIIMVTFSAAAIASVSRFYGWAASQIFG 80 >gi|195952630|ref|YP_002120920.1| preprotein translocase, SecE subunit [Hydrogenobaculum sp. Y04AAS1] gi|195932242|gb|ACG56942.1| preprotein translocase, SecE subunit [Hydrogenobaculum sp. Y04AAS1] Length = 66 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 34/58 (58%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 +LNF K+V+ E +K+ WP + V+ + + VII ++ ++D S ++ FI GI Sbjct: 4 ILNFLKEVKQELRKVSWPDKKLVIRATVSVIIFSLFFGIYLWIVDLSFTKILSFIFGI 61 >gi|307297341|ref|ZP_07577147.1| preprotein translocase, SecE subunit [Thermotogales bacterium mesG1.Ag.4.2] gi|306916601|gb|EFN46983.1| preprotein translocase, SecE subunit [Thermotogales bacterium mesG1.Ag.4.2] Length = 68 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 35/58 (60%), Gaps = 4/58 (6%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID----QSIGWLMHFILG 64 F +V++E KK+ WP+R +++ S V+++L F ++D +IG L++F+ G Sbjct: 9 FLSEVKNEVKKVTWPNREQMISSTGAVLVILIAVGAFLALLDVLFTNAIGSLLNFLTG 66 >gi|163784526|ref|ZP_02179387.1| Preprotein translocase subunit SecE [Hydrogenivirga sp. 128-5-R1-1] gi|159880202|gb|EDP73845.1| Preprotein translocase subunit SecE [Hydrogenivirga sp. 128-5-R1-1] Length = 70 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 36/60 (60%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +N ++NF K+V+DE KK+ WP+ V + I VI+ + SV+ V+D + ++ ++ Sbjct: 9 MNASQLVNFLKEVKDELKKVTWPTSELVKKATIAVIVFTLLVSVYLWVLDIAFSRIIDYL 68 >gi|157412564|ref|YP_001483430.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. MIT 9215] gi|157387139|gb|ABV49844.1| putative preprotein translocase, SecE subunit [Prochlorococcus marinus str. MIT 9215] Length = 80 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF+ DE K + WP++ ++ + VIIM++ S+ + + GW I G Sbjct: 26 NFFRSTYDELKLVVWPNKQQLFSESVAVIIMVTFSAAAIASVSRFYGWAASQIFG 80 >gi|313679511|ref|YP_004057250.1| protein translocase subunit sece/sec61 gamma [Oceanithermus profundus DSM 14977] gi|313152226|gb|ADR36077.1| protein translocase subunit secE/sec61 gamma [Oceanithermus profundus DSM 14977] Length = 60 Score = 39.7 bits (91), Expect = 0.16, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 31/56 (55%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ +F++ R E ++ WPSR E++ S V++ S F + D + G +M IL Sbjct: 4 IITYFREARAELARVSWPSRDEIIQSTEAVLLFTLFSMTIFWIYDMAFGAVMQRIL 59 >gi|269926930|ref|YP_003323553.1| preprotein translocase, SecE subunit [Thermobaculum terrenum ATCC BAA-798] gi|269790590|gb|ACZ42731.1| preprotein translocase, SecE subunit [Thermobaculum terrenum ATCC BAA-798] Length = 76 Score = 39.7 bits (91), Expect = 0.16, Method: Compositional matrix adjust. Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 3/58 (5%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFL--VIDQSIGWLMHFILGI 65 F++ R E +K+ WP+R EV + + +V+I+LS+S FL ++D WL I GI Sbjct: 20 KFYEDTRAEIRKVSWPTRDEV-IRLSIVVIVLSVSMAIFLGVIVDGIFLWLYRLIGGI 76 >gi|259906923|ref|YP_002647279.1| preprotein translocase subunit SecE [Erwinia pyrifoliae Ep1/96] gi|224962545|emb|CAX54000.1| Preprotein translocase SecE subunit [Erwinia pyrifoliae Ep1/96] Length = 132 Score = 39.7 bits (91), Expect = 0.16, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 72 ATLAFAREARTEVRKVVWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 130 >gi|53804630|ref|YP_113535.1| preprotein translocase, SecE subunit [Methylococcus capsulatus str. Bath] gi|53758391|gb|AAU92682.1| preprotein translocase, SecE subunit [Methylococcus capsulatus str. Bath] Length = 124 Score = 39.3 bits (90), Expect = 0.16, Method: Compositional matrix adjust. Identities = 17/58 (29%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A+L FF++ R E +K+ WP+R E + ++V+ ++ +F ++D + W + I G Sbjct: 67 ALLGFFRESRIEVRKVVWPTRQEAAQATLMVVALVFFVGIFLWLLDMLLFWAITSITG 124 >gi|317057219|ref|YP_004105686.1| preprotein translocase subunit SecE [Ruminococcus albus 7] gi|315449488|gb|ADU23052.1| preprotein translocase, SecE subunit [Ruminococcus albus 7] Length = 84 Score = 39.3 bits (90), Expect = 0.16, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 38/56 (67%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 +FK++R E KK+ WP+R +V+ + VV++++S+ +F +D + + + ++G+G Sbjct: 27 YFKELRAELKKVVWPTRQQVVNNTGVVLVVMSVVGLFLFAVDTGLSYAIKQLIGLG 82 >gi|300114749|ref|YP_003761324.1| preprotein translocase subunit SecE [Nitrosococcus watsonii C-113] gi|300114761|ref|YP_003761336.1| preprotein translocase subunit SecE [Nitrosococcus watsonii C-113] gi|299540686|gb|ADJ29003.1| preprotein translocase, SecE subunit [Nitrosococcus watsonii C-113] gi|299540698|gb|ADJ29015.1| preprotein translocase, SecE subunit [Nitrosococcus watsonii C-113] Length = 115 Score = 39.3 bits (90), Expect = 0.16, Method: Compositional matrix adjust. Identities = 17/60 (28%), Positives = 34/60 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 A L+F + R E +K+ WP+R E + + ++V++M+ I + + D + W + + G G Sbjct: 55 AALSFAGETRLEFRKVVWPTRQETIRTTLLVLLMVMIMASILWLFDTLLMWAVRLLTGQG 114 >gi|296533969|ref|ZP_06896487.1| preprotein translocase [Roseomonas cervicalis ATCC 49957] gi|296265700|gb|EFH11807.1| preprotein translocase [Roseomonas cervicalis ATCC 49957] Length = 65 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 19/56 (33%), Positives = 37/56 (66%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F + VR E ++ WP+R E L++ +V+ + ++++VFFL+ D+ I +L+ + G G Sbjct: 9 FIRDVRQEVARVTWPTRKETLITTGLVLALSALAAVFFLLTDKLIQFLVSLLFGFG 64 >gi|297537518|ref|YP_003673287.1| preprotein translocase subunit SecE [Methylotenera sp. 301] gi|297256865|gb|ADI28710.1| preprotein translocase, SecE subunit [Methylotenera sp. 301] Length = 115 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 16/58 (27%), Positives = 34/58 (58%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 L F + E++K+ WP+R E + +VV +++ I + F V+D +++ +++G G Sbjct: 57 LVFIGEAVAEARKVVWPTRKETTQTTMVVFVLVVIMAAFLAVVDIGFAFMVQWLMGRG 114 >gi|218246574|ref|YP_002371945.1| preprotein translocase subunit SecE [Cyanothece sp. PCC 8801] gi|257059614|ref|YP_003137502.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 8802] gi|218167052|gb|ACK65789.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 8801] gi|256589780|gb|ACV00667.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 8802] Length = 78 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 15/48 (31%), Positives = 28/48 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 NF + ++E K+ WPSR ++L + VI+M+S+ + ++D W Sbjct: 25 NFINETKEELGKVVWPSRQQLLSESVAVILMVSLVATVIYLVDNLFAW 72 >gi|149186889|ref|ZP_01865198.1| preprotein translocase, SecE subunit [Erythrobacter sp. SD-21] gi|148829398|gb|EDL47840.1| preprotein translocase, SecE subunit [Erythrobacter sp. SD-21] Length = 77 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 20/63 (31%), Positives = 37/63 (58%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ + F +QV+ E +K+ WP+ E + I V IM+ I S+FFL +D G ++ ++L Sbjct: 15 SKPSPAEFIRQVQTEGRKVVWPTWPETVRISIFVFIMMIILSLFFLGVDSLFGAVVRWLL 74 Query: 64 GIG 66 + Sbjct: 75 TLA 77 >gi|125975200|ref|YP_001039110.1| preprotein translocase, SecE subunit [Clostridium thermocellum ATCC 27405] gi|256003138|ref|ZP_05428130.1| preprotein translocase, SecE subunit [Clostridium thermocellum DSM 2360] gi|281419561|ref|ZP_06250572.1| preprotein translocase, SecE subunit [Clostridium thermocellum JW20] gi|125715425|gb|ABN53917.1| preprotein translocase, SecE subunit [Clostridium thermocellum ATCC 27405] gi|255992829|gb|EEU02919.1| preprotein translocase, SecE subunit [Clostridium thermocellum DSM 2360] gi|281406783|gb|EFB37050.1| preprotein translocase, SecE subunit [Clostridium thermocellum JW20] gi|316939364|gb|ADU73398.1| preprotein translocase, SecE subunit [Clostridium thermocellum DSM 1313] Length = 80 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 31/53 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +FK V++E K++ WP+RS+++ + I V+I+ I V + D G L I Sbjct: 27 KYFKDVKNELKRVIWPTRSQLINNTITVLILCFIVGVLIWLFDLGFGALSSLI 79 >gi|259416653|ref|ZP_05740573.1| preprotein translocase, SecE subunit [Silicibacter sp. TrichCH4B] gi|259348092|gb|EEW59869.1| preprotein translocase, SecE subunit [Silicibacter sp. TrichCH4B] Length = 65 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 23/57 (40%), Positives = 37/57 (64%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F +QVR E K+ WP+R EVL++ ++V IM ++++ FF V+D I + I GI Sbjct: 7 VKFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALAAAFFAVVDLLIRTGLSGIYGI 63 >gi|238756066|ref|ZP_04617389.1| Preprotein translocase subunit secE [Yersinia ruckeri ATCC 29473] gi|238705733|gb|EEP98127.1| Preprotein translocase subunit secE [Yersinia ruckeri ATCC 29473] Length = 127 Score = 39.3 bits (90), Expect = 0.19, Method: Compositional matrix adjust. Identities = 19/65 (29%), Positives = 36/65 (55%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M V A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 MTVKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|310817024|ref|YP_003964988.1| preprotein translocase, SecE subunit [Ketogulonicigenium vulgare Y25] gi|308755759|gb|ADO43688.1| preprotein translocase, SecE subunit [Ketogulonicigenium vulgare Y25] Length = 66 Score = 39.3 bits (90), Expect = 0.20, Method: Compositional matrix adjust. Identities = 24/60 (40%), Positives = 40/60 (66%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R + F +QVR E KI WP+R EV V+ ++V+ + +++++FF +D SI +L+ ILG Sbjct: 3 RTNPIQFAQQVRAEIGKITWPTRREVTVTTLMVVAIAALAALFFSAVDISIRFLLDVILG 62 >gi|30064736|ref|NP_838907.1| preprotein translocase subunit SecE [Shigella flexneri 2a str. 2457T] gi|110807831|ref|YP_691351.1| preprotein translocase subunit SecE [Shigella flexneri 5 str. 8401] gi|30042996|gb|AAP18718.1| preprotein translocase [Shigella flexneri 2a str. 2457T] gi|110617379|gb|ABF06046.1| preprotein translocase [Shigella flexneri 5 str. 8401] gi|281603367|gb|ADA76351.1| Preprotein translocase [Shigella flexneri 2002017] gi|313648631|gb|EFS13071.1| preprotein translocase, SecE subunit [Shigella flexneri 2a str. 2457T] Length = 127 Score = 38.9 bits (89), Expect = 0.21, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATIAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|304415280|ref|ZP_07395975.1| preprotein translocase subunit E [Candidatus Regiella insecticola LSR1] gi|304282870|gb|EFL91338.1| preprotein translocase subunit E [Candidatus Regiella insecticola LSR1] Length = 127 Score = 38.9 bits (89), Expect = 0.21, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 35/59 (59%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V ++ ++ S+ +D + L+ FI G+ Sbjct: 67 ASVGFAREARTEMRKVIWPTRQEALQTTLIVAVVTAVMSLILWGLDGILIHLVSFITGL 125 >gi|238897919|ref|YP_002923598.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] gi|229465676|gb|ACQ67450.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] Length = 127 Score = 38.9 bits (89), Expect = 0.21, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E L + ++V ++ + S+ ID + L+ FI G+ Sbjct: 67 ASLEFAREARIEMRKVIWPTRQETLQTTLIVALITLVMSLILWGIDSILVRLISFITGL 125 >gi|118594013|ref|ZP_01551360.1| translocase [Methylophilales bacterium HTCC2181] gi|118439791|gb|EAV46418.1| translocase [Methylophilales bacterium HTCC2181] Length = 114 Score = 38.9 bits (89), Expect = 0.21, Method: Compositional matrix adjust. Identities = 16/58 (27%), Positives = 32/58 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + F E+KK+ WP+R E ++V I++ + ++F +D ++++ ILG G Sbjct: 57 IGFLNDAITEAKKVVWPTRKETFQMTLIVFILVVLMAIFLAFVDIGFSYIINMILGRG 114 >gi|149925891|ref|ZP_01914154.1| SecE subunit of protein translocation complex [Limnobacter sp. MED105] gi|149825179|gb|EDM84390.1| SecE subunit of protein translocation complex [Limnobacter sp. MED105] Length = 156 Score = 38.9 bits (89), Expect = 0.21, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH-FILG 64 F K +E+K++ WP+R E + VV + + I S++ L++D+++ W+ + ILG Sbjct: 98 GFAKDSVNEAKRVVWPTRKEGMQMTGVVFVFVLIMSIYLLLVDKTLEWVFYDLILG 153 >gi|189424397|ref|YP_001951574.1| preprotein translocase subunit SecE [Geobacter lovleyi SZ] gi|189420656|gb|ACD95054.1| preprotein translocase, SecE subunit [Geobacter lovleyi SZ] Length = 60 Score = 38.9 bits (89), Expect = 0.21, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 34/57 (59%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V FF+ V+ E K+ WP+R E + + VVI+++ + S++ + D + LM +LG Sbjct: 4 VKTFFESVKLELSKVTWPTRKETVATTGVVIMIVFMVSIYLGLCDVVLSKLMRLVLG 60 >gi|317046438|ref|YP_004114086.1| preprotein translocase subunit SecE [Pantoea sp. At-9b] gi|316948055|gb|ADU67530.1| preprotein translocase, SecE subunit [Pantoea sp. At-9b] Length = 127 Score = 38.9 bits (89), Expect = 0.22, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEMRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|255994045|ref|ZP_05427180.1| conserved domain protein [Eubacterium saphenum ATCC 49989] gi|255993713|gb|EEU03802.1| conserved domain protein [Eubacterium saphenum ATCC 49989] Length = 104 Score = 38.9 bits (89), Expect = 0.22, Method: Compositional matrix adjust. Identities = 18/62 (29%), Positives = 34/62 (54%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +L++ +FK V+ E KK+ WP++ E+ V++ + ++ F D I + M +L Sbjct: 41 EKLSLKEYFKGVKLEMKKVVWPTKKELGSYTTYVLVTCAFFTLLFYAADTGILFGMKKLL 100 Query: 64 GI 65 GI Sbjct: 101 GI 102 >gi|304399297|ref|ZP_07381162.1| preprotein translocase, SecE subunit [Pantoea sp. aB] gi|304353153|gb|EFM17535.1| preprotein translocase, SecE subunit [Pantoea sp. aB] Length = 127 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEMRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|295095133|emb|CBK84223.1| protein translocase subunit secE/sec61 gamma [Enterobacter cloacae subsp. cloacae NCTC 9394] Length = 127 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|237727885|ref|ZP_04558366.1| preprotein translocase subunit SecE [Citrobacter sp. 30_2] gi|261340890|ref|ZP_05968748.1| preprotein translocase, SecE subunit [Enterobacter cancerogenus ATCC 35316] gi|283836717|ref|ZP_06356458.1| preprotein translocase, SecE subunit [Citrobacter youngae ATCC 29220] gi|226910442|gb|EEH96360.1| preprotein translocase subunit SecE [Citrobacter sp. 30_2] gi|288316943|gb|EFC55881.1| preprotein translocase, SecE subunit [Enterobacter cancerogenus ATCC 35316] gi|291067264|gb|EFE05373.1| preprotein translocase, SecE subunit [Citrobacter youngae ATCC 29220] Length = 127 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|157147226|ref|YP_001454545.1| preprotein translocase subunit SecE [Citrobacter koseri ATCC BAA-895] gi|157084431|gb|ABV14109.1| hypothetical protein CKO_03009 [Citrobacter koseri ATCC BAA-895] Length = 127 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|197286620|ref|YP_002152492.1| preprotein translocase subunit SecE [Proteus mirabilis HI4320] gi|227355187|ref|ZP_03839596.1| preprotein translocase SecE subunit [Proteus mirabilis ATCC 29906] gi|194684107|emb|CAR45506.1| preprotein translocase SecE subunit [Proteus mirabilis HI4320] gi|227164696|gb|EEI49550.1| preprotein translocase SecE subunit [Proteus mirabilis ATCC 29906] Length = 125 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E L + ++V + +I S+ +D + L+ FI G+ Sbjct: 67 ATLAFAREARIEMRKVVWPTRQETLQTTLIVAAVTAIVSLVLWGLDGILVRLVSFITGL 125 >gi|223936441|ref|ZP_03628353.1| preprotein translocase, SecE subunit [bacterium Ellin514] gi|223894959|gb|EEF61408.1| preprotein translocase, SecE subunit [bacterium Ellin514] Length = 85 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 15/43 (34%), Positives = 31/43 (72%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 N+ ++ R+E KK WP+ +E+ S +VV+I +++ ++F +V+D Sbjct: 32 NYIQETREELKKCTWPTWAELKGSTLVVMICIALIAIFTIVVD 74 >gi|188584821|ref|YP_001916366.1| preprotein translocase, SecE subunit [Natranaerobius thermophilus JW/NM-WN-LF] gi|179349508|gb|ACB83778.1| preprotein translocase, SecE subunit [Natranaerobius thermophilus JW/NM-WN-LF] Length = 63 Score = 38.9 bits (89), Expect = 0.23, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQS 54 MG+ R A L F ++ + E KK+ WP+R +++ VV++ ++I V+F ++D + Sbjct: 1 MGLIRKA-LKFLRETKIELKKVNWPNRQQLITYTGVVLMTVAIVGVYFWILDTA 53 >gi|323948847|gb|EGB44744.1| preprotein translocase [Escherichia coli H252] Length = 127 Score = 38.9 bits (89), Expect = 0.24, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|291615762|ref|YP_003518504.1| SecE [Pantoea ananatis LMG 20103] gi|291150792|gb|ADD75376.1| SecE [Pantoea ananatis LMG 20103] gi|327396028|dbj|BAK13450.1| preprotein translocase SecE subunit [Pantoea ananatis AJ13355] Length = 132 Score = 38.9 bits (89), Expect = 0.24, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 72 ATVAFAREARTEMRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 130 >gi|169333757|ref|ZP_02860950.1| hypothetical protein ANASTE_00141 [Anaerofustis stercorihominis DSM 17244] gi|169259606|gb|EDS73572.1| hypothetical protein ANASTE_00141 [Anaerofustis stercorihominis DSM 17244] Length = 79 Score = 38.9 bits (89), Expect = 0.24, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 34/52 (65%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 +V NFF+ V E KK+ WP++ E++ IVV+++ ++ ++F +D +G L Sbjct: 24 SVSNFFRGVSVELKKVTWPTKDELIQYTIVVVVICAVLTLFIWGLDTVLGLL 75 >gi|323161297|gb|EFZ47207.1| preprotein translocase, SecE subunit [Escherichia coli E128010] Length = 127 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|308188902|ref|YP_003933033.1| preprotein translocase subunit SecE [Pantoea vagans C9-1] gi|308059412|gb|ADO11584.1| Preprotein translocase subunit SecE [Pantoea vagans C9-1] Length = 127 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEMRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|298506901|gb|ADI85624.1| preprotein translocase, SecE subunit [Geobacter sulfurreducens KN400] Length = 61 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F +V+ E K+ WP+R E + + VV+ ++ + SV+ V D + LM ILG Sbjct: 7 EFLTEVKAELDKVTWPTRKETVSTTWVVVAIVLLISVYLGVCDVVLAKLMRIILG 61 >gi|146309858|ref|YP_001174932.1| preprotein translocase subunit SecE [Enterobacter sp. 638] gi|145316734|gb|ABP58881.1| protein translocase subunit secE/sec61 gamma [Enterobacter sp. 638] Length = 127 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|82546323|ref|YP_410270.1| preprotein translocase subunit SecE [Shigella boydii Sb227] gi|81247734|gb|ABB68442.1| preprotein translocase [Shigella boydii Sb227] Length = 127 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|332083869|gb|EGI89082.1| preprotein translocase, SecE subunit [Shigella boydii 5216-82] Length = 127 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|296100609|ref|YP_003610755.1| preprotein translocase subunit SecE [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|311281469|ref|YP_003943700.1| preprotein translocase, SecE subunit [Enterobacter cloacae SCF1] gi|295055068|gb|ADF59806.1| preprotein translocase subunit SecE [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|308750664|gb|ADO50416.1| preprotein translocase, SecE subunit [Enterobacter cloacae SCF1] Length = 127 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|212696287|ref|ZP_03304415.1| hypothetical protein ANHYDRO_00824 [Anaerococcus hydrogenalis DSM 7454] gi|325846707|ref|ZP_08169622.1| preprotein translocase, SecE subunit [Anaerococcus hydrogenalis ACS-025-V-Sch4] gi|212676916|gb|EEB36523.1| hypothetical protein ANHYDRO_00824 [Anaerococcus hydrogenalis DSM 7454] gi|325481465|gb|EGC84506.1| preprotein translocase, SecE subunit [Anaerococcus hydrogenalis ACS-025-V-Sch4] Length = 60 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 34/53 (64%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK +R E KKI WP+++E L ++VII+ I+ + ++D G ++ F++ Sbjct: 8 FFKSIRREFKKITWPTKNETLNYSLLVIIVSVITGLLIWLLDIVFGNMLGFLM 60 >gi|15804571|ref|NP_290612.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 EDL933] gi|15834158|ref|NP_312931.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. Sakai] gi|16131811|ref|NP_418408.1| preprotein translocase membrane subunit [Escherichia coli str. K-12 substr. MG1655] gi|26250750|ref|NP_756790.1| preprotein translocase subunit SecE [Escherichia coli CFT073] gi|74314475|ref|YP_312894.1| preprotein translocase subunit SecE [Shigella sonnei Ss046] gi|89110058|ref|AP_003838.1| preprotein translocase membrane subunit [Escherichia coli str. K-12 substr. W3110] gi|91212814|ref|YP_542800.1| preprotein translocase subunit SecE [Escherichia coli UTI89] gi|110644316|ref|YP_672046.1| preprotein translocase subunit SecE [Escherichia coli 536] gi|117626245|ref|YP_859568.1| preprotein translocase subunit SecE [Escherichia coli APEC O1] gi|157155377|ref|YP_001465472.1| preprotein translocase subunit SecE [Escherichia coli E24377A] gi|157163449|ref|YP_001460767.1| preprotein translocase subunit SecE [Escherichia coli HS] gi|168771451|ref|ZP_02796458.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4486] gi|168777408|ref|ZP_02802415.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4196] gi|168780364|ref|ZP_02805371.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4076] gi|168790339|ref|ZP_02815346.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC869] gi|170022016|ref|YP_001726970.1| preprotein translocase subunit SecE [Escherichia coli ATCC 8739] gi|170083441|ref|YP_001732761.1| preprotein translocase membrane subunit [Escherichia coli str. K-12 substr. DH10B] gi|170679747|ref|YP_001746365.1| preprotein translocase subunit SecE [Escherichia coli SMS-3-5] gi|170770137|ref|ZP_02904590.1| preprotein translocase subunit secE [Escherichia albertii TW07627] gi|187730737|ref|YP_001882666.1| preprotein translocase subunit SecE [Shigella boydii CDC 3083-94] gi|188492920|ref|ZP_03000190.1| preprotein translocase, SecE subunit [Escherichia coli 53638] gi|191172715|ref|ZP_03034253.1| preprotein translocase subunit secE [Escherichia coli F11] gi|193071947|ref|ZP_03052780.1| preprotein translocase subunit secE [Escherichia coli E110019] gi|194440250|ref|ZP_03072269.1| preprotein translocase subunit secE [Escherichia coli 101-1] gi|195939606|ref|ZP_03084988.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. EC4024] gi|208808098|ref|ZP_03250435.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4206] gi|208813674|ref|ZP_03255003.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4045] gi|208819192|ref|ZP_03259512.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4042] gi|209396026|ref|YP_002273497.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4115] gi|209921459|ref|YP_002295543.1| preprotein translocase subunit SecE [Escherichia coli SE11] gi|217325998|ref|ZP_03442082.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. TW14588] gi|218551035|ref|YP_002384826.1| preprotein translocase subunit SecE [Escherichia fergusonii ATCC 35469] gi|218556535|ref|YP_002389449.1| preprotein translocase subunit SecE [Escherichia coli IAI1] gi|218561047|ref|YP_002393960.1| preprotein translocase subunit SecE [Escherichia coli S88] gi|218692262|ref|YP_002400474.1| preprotein translocase subunit SecE [Escherichia coli ED1a] gi|218697688|ref|YP_002405355.1| preprotein translocase subunit SecE [Escherichia coli 55989] gi|218702611|ref|YP_002410240.1| preprotein translocase subunit SecE [Escherichia coli IAI39] gi|218707599|ref|YP_002415118.1| preprotein translocase subunit SecE [Escherichia coli UMN026] gi|227885490|ref|ZP_04003295.1| preprotein translocase subunit SecE [Escherichia coli 83972] gi|237702748|ref|ZP_04533229.1| preprotein translocase subunit SecE [Escherichia sp. 3_2_53FAA] gi|238903037|ref|YP_002928833.1| preprotein translocase membrane subunit [Escherichia coli BW2952] gi|253775390|ref|YP_003038221.1| preprotein translocase subunit SecE [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254039236|ref|ZP_04873285.1| preprotein translocase membrane subunit [Escherichia sp. 1_1_43] gi|254163922|ref|YP_003047030.1| preprotein translocase subunit SecE [Escherichia coli B str. REL606] gi|254795979|ref|YP_003080816.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. TW14359] gi|256021699|ref|ZP_05435564.1| preprotein translocase subunit SecE [Shigella sp. D9] gi|256026296|ref|ZP_05440161.1| preprotein translocase subunit SecE [Escherichia sp. 4_1_40B] gi|260846781|ref|YP_003224559.1| preprotein translocase membrane subunit SecE [Escherichia coli O103:H2 str. 12009] gi|260870692|ref|YP_003237094.1| preprotein translocase membrane subunit SecE [Escherichia coli O111:H- str. 11128] gi|261227308|ref|ZP_05941589.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. FRIK2000] gi|261257055|ref|ZP_05949588.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. FRIK966] gi|291285395|ref|YP_003502213.1| Preprotein translocase [Escherichia coli O55:H7 str. CB9615] gi|293407597|ref|ZP_06651515.1| secE [Escherichia coli FVEC1412] gi|293413416|ref|ZP_06656076.1| secE [Escherichia coli B354] gi|293417484|ref|ZP_06660107.1| preprotein translocase SecE subunit [Escherichia coli B185] gi|293474288|ref|ZP_06664697.1| preprotein translocase SecE subunit [Escherichia coli B088] gi|297519741|ref|ZP_06938127.1| preprotein translocase subunit SecE [Escherichia coli OP50] gi|298383345|ref|ZP_06992937.1| preprotein translocase SecE subunit [Escherichia coli FVEC1302] gi|300819791|ref|ZP_07099978.1| preprotein translocase, SecE subunit [Escherichia coli MS 107-1] gi|300824640|ref|ZP_07104748.1| preprotein translocase, SecE subunit [Escherichia coli MS 119-7] gi|300897606|ref|ZP_07116014.1| preprotein translocase, SecE subunit [Escherichia coli MS 198-1] gi|300907532|ref|ZP_07125172.1| preprotein translocase, SecE subunit [Escherichia coli MS 84-1] gi|300919396|ref|ZP_07135902.1| preprotein translocase, SecE subunit [Escherichia coli MS 115-1] gi|300925846|ref|ZP_07141691.1| preprotein translocase, SecE subunit [Escherichia coli MS 182-1] gi|300928798|ref|ZP_07144307.1| preprotein translocase, SecE subunit [Escherichia coli MS 187-1] gi|300938795|ref|ZP_07153507.1| preprotein translocase, SecE subunit [Escherichia coli MS 21-1] gi|300947416|ref|ZP_07161607.1| preprotein translocase, SecE subunit [Escherichia coli MS 116-1] gi|300954790|ref|ZP_07167219.1| preprotein translocase, SecE subunit [Escherichia coli MS 175-1] gi|300979571|ref|ZP_07174614.1| preprotein translocase, SecE subunit [Escherichia coli MS 45-1] gi|300985576|ref|ZP_07177492.1| preprotein translocase, SecE subunit [Escherichia coli MS 200-1] gi|301019393|ref|ZP_07183570.1| preprotein translocase, SecE subunit [Escherichia coli MS 69-1] gi|301023347|ref|ZP_07187139.1| preprotein translocase, SecE subunit [Escherichia coli MS 196-1] gi|301302208|ref|ZP_07208340.1| preprotein translocase, SecE subunit [Escherichia coli MS 124-1] gi|301326088|ref|ZP_07219486.1| preprotein translocase, SecE subunit [Escherichia coli MS 78-1] gi|301645765|ref|ZP_07245685.1| preprotein translocase, SecE subunit [Escherichia coli MS 146-1] gi|306811996|ref|ZP_07446204.1| preprotein translocase subunit SecE [Escherichia coli NC101] gi|307140672|ref|ZP_07500028.1| preprotein translocase subunit SecE [Escherichia coli H736] gi|307315046|ref|ZP_07594632.1| preprotein translocase, SecE subunit [Escherichia coli W] gi|309783932|ref|ZP_07678577.1| preprotein translocase, SecE subunit [Shigella dysenteriae 1617] gi|309797684|ref|ZP_07692070.1| preprotein translocase, SecE subunit [Escherichia coli MS 145-7] gi|312965366|ref|ZP_07779599.1| preprotein translocase, SecE subunit [Escherichia coli 2362-75] gi|312974233|ref|ZP_07788403.1| preprotein translocase, SecE subunit [Escherichia coli 1827-70] gi|331644715|ref|ZP_08345833.1| preprotein translocase subunit SecE [Escherichia coli H736] gi|331649834|ref|ZP_08350912.1| preprotein translocase subunit SecE [Escherichia coli M605] gi|331655678|ref|ZP_08356668.1| preprotein translocase subunit SecE [Escherichia coli M718] gi|331660540|ref|ZP_08361473.1| preprotein translocase subunit SecE [Escherichia coli TA206] gi|331665635|ref|ZP_08366531.1| preprotein translocase subunit SecE [Escherichia coli TA143] gi|331670833|ref|ZP_08371668.1| preprotein translocase subunit SecE [Escherichia coli TA271] gi|331675468|ref|ZP_08376217.1| preprotein translocase subunit SecE [Escherichia coli TA280] gi|331680101|ref|ZP_08380762.1| preprotein translocase subunit SecE [Escherichia coli H591] gi|331685722|ref|ZP_08386304.1| preprotein translocase subunit SecE [Escherichia coli H299] gi|84028690|sp|P0AG98|SECE_ECO57 RecName: Full=Preprotein translocase subunit secE gi|84028691|sp|P0AG97|SECE_ECOL6 RecName: Full=Preprotein translocase subunit secE gi|84028692|sp|P0AG96|SECE_ECOLI RecName: Full=Preprotein translocase subunit SecE gi|12518903|gb|AAG59177.1|AE005629_6 preprotein translocase [Escherichia coli O157:H7 str. EDL933] gi|26111181|gb|AAN83364.1|AE016770_164 Preprotein translocase secE subunit [Escherichia coli CFT073] gi|147800|gb|AAA24621.1| SecE protein [Escherichia coli] gi|396320|gb|AAC43079.1| ORF_o127a [Escherichia coli str. K-12 substr. MG1655] gi|1790413|gb|AAC76955.1| preprotein translocase membrane subunit [Escherichia coli str. K-12 substr. MG1655] gi|13364380|dbj|BAB38327.1| preprotein translocase [Escherichia coli O157:H7 str. Sakai] gi|73857952|gb|AAZ90659.1| preprotein translocase [Shigella sonnei Ss046] gi|85676089|dbj|BAE77339.1| preprotein translocase membrane subunit [Escherichia coli str. K12 substr. W3110] gi|91074388|gb|ABE09269.1| inner membrane preprotein translocase [Escherichia coli UTI89] gi|110345908|gb|ABG72145.1| preprotein translocase secE subunit [Escherichia coli 536] gi|115515369|gb|ABJ03444.1| preprotein translocase SecE subunit [Escherichia coli APEC O1] gi|157069129|gb|ABV08384.1| preprotein translocase subunit secE [Escherichia coli HS] gi|157077407|gb|ABV17115.1| preprotein translocase subunit secE [Escherichia coli E24377A] gi|169756944|gb|ACA79643.1| preprotein translocase, SecE subunit [Escherichia coli ATCC 8739] gi|169891276|gb|ACB04983.1| preprotein translocase membrane subunit [Escherichia coli str. K-12 substr. DH10B] gi|170121019|gb|EDS89950.1| preprotein translocase subunit secE [Escherichia albertii TW07627] gi|170517465|gb|ACB15643.1| preprotein translocase subunit secE [Escherichia coli SMS-3-5] gi|187427729|gb|ACD07003.1| preprotein translocase subunit secE [Shigella boydii CDC 3083-94] gi|187767368|gb|EDU31212.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4196] gi|188488119|gb|EDU63222.1| preprotein translocase, SecE subunit [Escherichia coli 53638] gi|189001848|gb|EDU70834.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4076] gi|189359753|gb|EDU78172.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4486] gi|189370178|gb|EDU88594.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC869] gi|190907019|gb|EDV66620.1| preprotein translocase subunit secE [Escherichia coli F11] gi|192954739|gb|EDV85309.1| preprotein translocase subunit secE [Escherichia coli E110019] gi|194420816|gb|EDX36884.1| preprotein translocase subunit secE [Escherichia coli 101-1] gi|208727899|gb|EDZ77500.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4206] gi|208734951|gb|EDZ83638.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4045] gi|208739315|gb|EDZ86997.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4042] gi|209157426|gb|ACI34859.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4115] gi|209751868|gb|ACI74241.1| component in transcription antitermination [Escherichia coli] gi|209751870|gb|ACI74242.1| component in transcription antitermination [Escherichia coli] gi|209751872|gb|ACI74243.1| component in transcription antitermination [Escherichia coli] gi|209751874|gb|ACI74244.1| component in transcription antitermination [Escherichia coli] gi|209751876|gb|ACI74245.1| component in transcription antitermination [Escherichia coli] gi|209914718|dbj|BAG79792.1| preprotein translocase [Escherichia coli SE11] gi|217322219|gb|EEC30643.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. TW14588] gi|218354420|emb|CAV01218.1| preprotein translocase membrane subunit [Escherichia coli 55989] gi|218358576|emb|CAQ91224.1| preprotein translocase membrane subunit [Escherichia fergusonii ATCC 35469] gi|218363304|emb|CAR00954.1| preprotein translocase membrane subunit [Escherichia coli IAI1] gi|218367816|emb|CAR05611.1| preprotein translocase membrane subunit [Escherichia coli S88] gi|218372597|emb|CAR20472.1| preprotein translocase membrane subunit [Escherichia coli IAI39] gi|218429826|emb|CAR10795.2| preprotein translocase membrane subunit [Escherichia coli ED1a] gi|218434696|emb|CAR15628.1| preprotein translocase membrane subunit [Escherichia coli UMN026] gi|222035692|emb|CAP78437.1| Preprotein translocase secE subunit [Escherichia coli LF82] gi|226838471|gb|EEH70501.1| preprotein translocase membrane subunit [Escherichia sp. 1_1_43] gi|226903061|gb|EEH89320.1| preprotein translocase subunit SecE [Escherichia sp. 3_2_53FAA] gi|227837564|gb|EEJ48030.1| preprotein translocase subunit SecE [Escherichia coli 83972] gi|238863273|gb|ACR65271.1| preprotein translocase membrane subunit [Escherichia coli BW2952] gi|242379511|emb|CAQ34327.1| secE, subunit of SecEGY-Secretion Complex and Sec Protein Secretion Complex [Escherichia coli BL21(DE3)] gi|253326434|gb|ACT31036.1| preprotein translocase, SecE subunit [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|253975823|gb|ACT41494.1| translocase [Escherichia coli B str. REL606] gi|253979979|gb|ACT45649.1| translocase [Escherichia coli BL21(DE3)] gi|254595379|gb|ACT74740.1| preprotein translocase membrane subunit [Escherichia coli O157:H7 str. TW14359] gi|257761928|dbj|BAI33425.1| preprotein translocase membrane subunit SecE [Escherichia coli O103:H2 str. 12009] gi|257767048|dbj|BAI38543.1| preprotein translocase membrane subunit SecE [Escherichia coli O111:H- str. 11128] gi|260451192|gb|ACX41614.1| preprotein translocase, SecE subunit [Escherichia coli DH1] gi|281181045|dbj|BAI57375.1| preprotein translocase [Escherichia coli SE15] gi|284924073|emb|CBG37172.1| preprotein translocase SecE subunit [Escherichia coli 042] gi|290765268|gb|ADD59229.1| Preprotein translocase [Escherichia coli O55:H7 str. CB9615] gi|291321318|gb|EFE60759.1| preprotein translocase SecE subunit [Escherichia coli B088] gi|291425365|gb|EFE98405.1| secE [Escherichia coli FVEC1412] gi|291430811|gb|EFF03808.1| preprotein translocase SecE subunit [Escherichia coli B185] gi|291468011|gb|EFF10510.1| secE [Escherichia coli B354] gi|294493030|gb|ADE91786.1| preprotein translocase subunit secE [Escherichia coli IHE3034] gi|298276224|gb|EFI17745.1| preprotein translocase SecE subunit [Escherichia coli FVEC1302] gi|299880907|gb|EFI89118.1| preprotein translocase, SecE subunit [Escherichia coli MS 196-1] gi|300306522|gb|EFJ61042.1| preprotein translocase, SecE subunit [Escherichia coli MS 200-1] gi|300318259|gb|EFJ68043.1| preprotein translocase, SecE subunit [Escherichia coli MS 175-1] gi|300358653|gb|EFJ74523.1| preprotein translocase, SecE subunit [Escherichia coli MS 198-1] gi|300399277|gb|EFJ82815.1| preprotein translocase, SecE subunit [Escherichia coli MS 69-1] gi|300400739|gb|EFJ84277.1| preprotein translocase, SecE subunit [Escherichia coli MS 84-1] gi|300409475|gb|EFJ93013.1| preprotein translocase, SecE subunit [Escherichia coli MS 45-1] gi|300413531|gb|EFJ96841.1| preprotein translocase, SecE subunit [Escherichia coli MS 115-1] gi|300418071|gb|EFK01382.1| preprotein translocase, SecE subunit [Escherichia coli MS 182-1] gi|300452985|gb|EFK16605.1| preprotein translocase, SecE subunit [Escherichia coli MS 116-1] gi|300456279|gb|EFK19772.1| preprotein translocase, SecE subunit [Escherichia coli MS 21-1] gi|300463209|gb|EFK26702.1| preprotein translocase, SecE subunit [Escherichia coli MS 187-1] gi|300522889|gb|EFK43958.1| preprotein translocase, SecE subunit [Escherichia coli MS 119-7] gi|300527612|gb|EFK48674.1| preprotein translocase, SecE subunit [Escherichia coli MS 107-1] gi|300842371|gb|EFK70131.1| preprotein translocase, SecE subunit [Escherichia coli MS 124-1] gi|300847181|gb|EFK74941.1| preprotein translocase, SecE subunit [Escherichia coli MS 78-1] gi|301075976|gb|EFK90782.1| preprotein translocase, SecE subunit [Escherichia coli MS 146-1] gi|305854601|gb|EFM55037.1| preprotein translocase subunit SecE [Escherichia coli NC101] gi|306905551|gb|EFN36084.1| preprotein translocase, SecE subunit [Escherichia coli W] gi|307556124|gb|ADN48899.1| preprotein translocase SecE subunit [Escherichia coli ABU 83972] gi|307628402|gb|ADN72706.1| preprotein translocase subunit SecE [Escherichia coli UM146] gi|308118696|gb|EFO55958.1| preprotein translocase, SecE subunit [Escherichia coli MS 145-7] gi|308928303|gb|EFP73765.1| preprotein translocase, SecE subunit [Shigella dysenteriae 1617] gi|309704396|emb|CBJ03745.1| preprotein translocase SecE subunit [Escherichia coli ETEC H10407] gi|310331400|gb|EFP98665.1| preprotein translocase, SecE subunit [Escherichia coli 1827-70] gi|312290040|gb|EFR17927.1| preprotein translocase, SecE subunit [Escherichia coli 2362-75] gi|312948555|gb|ADR29382.1| preprotein translocase subunit SecE [Escherichia coli O83:H1 str. NRG 857C] gi|315063306|gb|ADT77633.1| preprotein translocase membrane subunit [Escherichia coli W] gi|315138537|dbj|BAJ45696.1| preprotein translocase [Escherichia coli DH1] gi|315253053|gb|EFU33021.1| preprotein translocase, SecE subunit [Escherichia coli MS 85-1] gi|315288349|gb|EFU47747.1| preprotein translocase, SecE subunit [Escherichia coli MS 110-3] gi|315294337|gb|EFU53688.1| preprotein translocase, SecE subunit [Escherichia coli MS 153-1] gi|315300754|gb|EFU59979.1| preprotein translocase, SecE subunit [Escherichia coli MS 16-3] gi|315617344|gb|EFU97950.1| preprotein translocase, SecE subunit [Escherichia coli 3431] gi|320172758|gb|EFW47992.1| Preprotein translocase subunit SecE [Shigella dysenteriae CDC 74-1112] gi|320179558|gb|EFW54509.1| Preprotein translocase subunit SecE [Shigella boydii ATCC 9905] gi|320190923|gb|EFW65573.1| Preprotein translocase subunit SecE [Escherichia coli O157:H7 str. EC1212] gi|320197124|gb|EFW71742.1| Preprotein translocase subunit SecE [Escherichia coli WV_060327] gi|320200180|gb|EFW74769.1| Preprotein translocase subunit SecE [Escherichia coli EC4100B] gi|320639071|gb|EFX08711.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. G5101] gi|320644465|gb|EFX13528.1| preprotein translocase subunit SecE [Escherichia coli O157:H- str. 493-89] gi|320649784|gb|EFX18305.1| preprotein translocase subunit SecE [Escherichia coli O157:H- str. H 2687] gi|320655117|gb|EFX23073.1| preprotein translocase subunit SecE [Escherichia coli O55:H7 str. 3256-97 TW 07815] gi|320660761|gb|EFX28215.1| preprotein translocase subunit SecE [Escherichia coli O55:H7 str. USDA 5905] gi|320665879|gb|EFX32910.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. LSU-61] gi|323167451|gb|EFZ53159.1| preprotein translocase, SecE subunit [Shigella sonnei 53G] gi|323174510|gb|EFZ60135.1| preprotein translocase, SecE subunit [Escherichia coli LT-68] gi|323177534|gb|EFZ63119.1| preprotein translocase, SecE subunit [Escherichia coli 1180] gi|323190162|gb|EFZ75440.1| preprotein translocase, SecE subunit [Escherichia coli RN587/1] gi|323380630|gb|ADX52898.1| preprotein translocase, SecE subunit [Escherichia coli KO11] gi|323933977|gb|EGB30451.1| preprotein translocase [Escherichia coli E1520] gi|323938902|gb|EGB35122.1| preprotein translocase [Escherichia coli E482] gi|323943602|gb|EGB39711.1| preprotein translocase [Escherichia coli H120] gi|323953806|gb|EGB49613.1| preprotein translocase [Escherichia coli H263] gi|323958907|gb|EGB54582.1| preprotein translocase [Escherichia coli H489] gi|323963801|gb|EGB59300.1| preprotein translocase [Escherichia coli M863] gi|323969054|gb|EGB64362.1| preprotein translocase [Escherichia coli TA007] gi|323974181|gb|EGB69313.1| preprotein translocase [Escherichia coli TW10509] gi|324009472|gb|EGB78691.1| preprotein translocase, SecE subunit [Escherichia coli MS 57-2] gi|324015276|gb|EGB84495.1| preprotein translocase, SecE subunit [Escherichia coli MS 60-1] gi|324017336|gb|EGB86555.1| preprotein translocase, SecE subunit [Escherichia coli MS 117-3] gi|324110893|gb|EGC04885.1| preprotein translocase [Escherichia fergusonii B253] gi|324115412|gb|EGC09357.1| preprotein translocase [Escherichia coli E1167] gi|325499287|gb|EGC97146.1| preprotein translocase subunit SecE [Escherichia fergusonii ECD227] gi|326347169|gb|EGD70899.1| Preprotein translocase subunit SecE [Escherichia coli O157:H7 str. 1125] gi|326347580|gb|EGD71302.1| Preprotein translocase subunit SecE [Escherichia coli O157:H7 str. 1044] gi|327250451|gb|EGE62161.1| preprotein translocase, SecE subunit [Escherichia coli STEC_7v] gi|330908298|gb|EGH36817.1| preprotein translocase subunit SecE [Escherichia coli AA86] gi|331036015|gb|EGI08252.1| preprotein translocase subunit SecE [Escherichia coli H736] gi|331041300|gb|EGI13452.1| preprotein translocase subunit SecE [Escherichia coli M605] gi|331046603|gb|EGI18690.1| preprotein translocase subunit SecE [Escherichia coli M718] gi|331052323|gb|EGI24361.1| preprotein translocase subunit SecE [Escherichia coli TA206] gi|331057153|gb|EGI29145.1| preprotein translocase subunit SecE [Escherichia coli TA143] gi|331061921|gb|EGI33845.1| preprotein translocase subunit SecE [Escherichia coli TA271] gi|331067346|gb|EGI38752.1| preprotein translocase subunit SecE [Escherichia coli TA280] gi|331072256|gb|EGI43590.1| preprotein translocase subunit SecE [Escherichia coli H591] gi|331077032|gb|EGI48248.1| preprotein translocase subunit SecE [Escherichia coli H299] gi|332105294|gb|EGJ08640.1| preprotein translocase subunit SecE [Shigella sp. D9] Length = 127 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|51594632|ref|YP_068823.1| preprotein translocase subunit SecE [Yersinia pseudotuberculosis IP 32953] gi|108809616|ref|YP_653532.1| preprotein translocase subunit SecE [Yersinia pestis Antiqua] gi|108810379|ref|YP_646146.1| preprotein translocase subunit SecE [Yersinia pestis Nepal516] gi|145600994|ref|YP_001165070.1| preprotein translocase subunit SecE [Yersinia pestis Pestoides F] gi|153947517|ref|YP_001402817.1| preprotein translocase subunit SecE [Yersinia pseudotuberculosis IP 31758] gi|153997213|ref|ZP_02022320.1| preprotein translocase SecE subunit [Yersinia pestis CA88-4125] gi|161484891|ref|NP_667816.2| preprotein translocase subunit SecE [Yersinia pestis KIM 10] gi|161511332|ref|NP_994409.2| preprotein translocase subunit SecE [Yersinia pestis biovar Microtus str. 91001] gi|162419346|ref|YP_001607190.1| preprotein translocase subunit SecE [Yersinia pestis Angola] gi|165928319|ref|ZP_02224151.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Orientalis str. F1991016] gi|165938231|ref|ZP_02226790.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Orientalis str. IP275] gi|166012041|ref|ZP_02232939.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Antiqua str. E1979001] gi|166214395|ref|ZP_02240430.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Antiqua str. B42003004] gi|167402426|ref|ZP_02307886.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167422948|ref|ZP_02314701.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167426803|ref|ZP_02318556.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Mediaevalis str. K1973002] gi|170022591|ref|YP_001719096.1| preprotein translocase subunit SecE [Yersinia pseudotuberculosis YPIII] gi|186893633|ref|YP_001870745.1| preprotein translocase subunit SecE [Yersinia pseudotuberculosis PB1/+] gi|218930758|ref|YP_002348633.1| preprotein translocase subunit SecE [Yersinia pestis CO92] gi|229837499|ref|ZP_04457661.1| preprotein translocase membrane subunit [Yersinia pestis Pestoides A] gi|229839435|ref|ZP_04459594.1| preprotein translocase membrane subunit [Yersinia pestis biovar Orientalis str. PEXU2] gi|229900554|ref|ZP_04515680.1| preprotein translocase membrane subunit [Yersinia pestis Nepal516] gi|270488910|ref|ZP_06205984.1| preprotein translocase, SecE subunit [Yersinia pestis KIM D27] gi|294505421|ref|YP_003569483.1| translocase [Yersinia pestis Z176003] gi|51587914|emb|CAH19517.1| preprotein translocase SecE subunit [Yersinia pseudotuberculosis IP 32953] gi|108774027|gb|ABG16546.1| protein translocase subunit secE/sec61 gamma [Yersinia pestis Nepal516] gi|108781529|gb|ABG15587.1| protein translocase subunit secE/sec61 gamma [Yersinia pestis Antiqua] gi|115349369|emb|CAL22340.1| preprotein translocase SecE subunit [Yersinia pestis CO92] gi|145212690|gb|ABP42097.1| protein translocase subunit secE/sec61 gamma [Yersinia pestis Pestoides F] gi|149289321|gb|EDM39400.1| preprotein translocase SecE subunit [Yersinia pestis CA88-4125] gi|152959012|gb|ABS46473.1| preprotein translocase, SecE subunit [Yersinia pseudotuberculosis IP 31758] gi|162352161|gb|ABX86109.1| preprotein translocase, SecE subunit [Yersinia pestis Angola] gi|165913892|gb|EDR32510.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Orientalis str. IP275] gi|165919658|gb|EDR36991.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Orientalis str. F1991016] gi|165989036|gb|EDR41337.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Antiqua str. E1979001] gi|166204399|gb|EDR48879.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Antiqua str. B42003004] gi|166957159|gb|EDR55180.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167048206|gb|EDR59614.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167054185|gb|EDR64010.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Mediaevalis str. K1973002] gi|169749125|gb|ACA66643.1| preprotein translocase, SecE subunit [Yersinia pseudotuberculosis YPIII] gi|186696659|gb|ACC87288.1| preprotein translocase, SecE subunit [Yersinia pseudotuberculosis PB1/+] gi|229682374|gb|EEO78464.1| preprotein translocase membrane subunit [Yersinia pestis Nepal516] gi|229695801|gb|EEO85848.1| preprotein translocase membrane subunit [Yersinia pestis biovar Orientalis str. PEXU2] gi|229704187|gb|EEO91198.1| preprotein translocase membrane subunit [Yersinia pestis Pestoides A] gi|262367415|gb|ACY63972.1| translocase [Yersinia pestis D182038] gi|270337414|gb|EFA48191.1| preprotein translocase, SecE subunit [Yersinia pestis KIM D27] gi|294355880|gb|ADE66221.1| translocase [Yersinia pestis Z176003] gi|320013651|gb|ADV97222.1| preprotein translocase membrane subunit [Yersinia pestis biovar Medievalis str. Harbin 35] Length = 127 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|301047714|ref|ZP_07194774.1| preprotein translocase, SecE subunit [Escherichia coli MS 185-1] gi|300300399|gb|EFJ56784.1| preprotein translocase, SecE subunit [Escherichia coli MS 185-1] Length = 127 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|78358030|ref|YP_389479.1| preprotein translocase subunit SecE [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] gi|78220435|gb|ABB39784.1| protein translocase subunit secE/sec61 gamma [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] Length = 83 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 4/59 (6%) Query: 9 LNFFKQVRDESK----KIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L FK+ +ESK K+ WPSR E + I V++++ + S+F ++D + ++ FIL Sbjct: 24 LTQFKEFLEESKVEIRKVTWPSRKETTATSIAVLVLVFVMSLFLGIVDLGLTRIVEFIL 82 >gi|322834827|ref|YP_004214854.1| preprotein translocase SecE subunit [Rahnella sp. Y9602] gi|321170028|gb|ADW75727.1| preprotein translocase, SecE subunit [Rahnella sp. Y9602] Length = 127 Score = 38.9 bits (89), Expect = 0.25, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|22297837|ref|NP_681084.1| preprotein translocase subunit SecE [Thermosynechococcus elongatus BP-1] gi|22294014|dbj|BAC07846.1| preprotein translocase SecE subunit [Thermosynechococcus elongatus BP-1] Length = 71 Score = 38.9 bits (89), Expect = 0.26, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 30/53 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF++ ++E K+ WP R ++ VI+++S+S+ ++D+ WL I Sbjct: 18 EFFRETKEELNKVVWPDRQRLIGESAAVILIVSLSAAVIYLVDELFRWLATLI 70 >gi|300714841|ref|YP_003739644.1| Preprotein translocase SecE subunit [Erwinia billingiae Eb661] gi|299060677|emb|CAX57784.1| Preprotein translocase SecE subunit [Erwinia billingiae Eb661] Length = 127 Score = 38.9 bits (89), Expect = 0.26, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 STLAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|293375375|ref|ZP_06621656.1| preprotein translocase, SecE subunit [Turicibacter sanguinis PC909] gi|325844476|ref|ZP_08168203.1| preprotein translocase, SecE subunit [Turicibacter sp. HGF1] gi|292645928|gb|EFF63957.1| preprotein translocase, SecE subunit [Turicibacter sanguinis PC909] gi|325489150|gb|EGC91534.1| preprotein translocase, SecE subunit [Turicibacter sp. HGF1] Length = 59 Score = 38.5 bits (88), Expect = 0.27, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 32/55 (58%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V FFK V E KKI WP+ E+ V++ +++ +VFF V+D I +M+ + Sbjct: 4 VKGFFKGVSAELKKITWPTEKEMKSYTFQVLVFVALLTVFFFVVDLVISQVMNLL 58 >gi|329666016|pdb|3J01|B Chain B, Structure Of The Ribosome-Secye Complex In The Membrane Environment Length = 116 Score = 38.5 bits (88), Expect = 0.28, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 56 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 114 >gi|293394016|ref|ZP_06638320.1| preprotein translocase [Serratia odorifera DSM 4582] gi|291423456|gb|EFE96681.1| preprotein translocase [Serratia odorifera DSM 4582] Length = 127 Score = 38.5 bits (88), Expect = 0.28, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|261249251|emb|CBG27113.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580] Length = 142 Score = 38.5 bits (88), Expect = 0.28, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 82 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 140 >gi|86606431|ref|YP_475194.1| preprotein translocase subunit SecE [Synechococcus sp. JA-3-3Ab] gi|86554973|gb|ABC99931.1| preprotein translocase, SecE subunit [Synechococcus sp. JA-3-3Ab] Length = 88 Score = 38.5 bits (88), Expect = 0.28, Method: Compositional matrix adjust. Identities = 22/53 (41%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLV-SVIVVIIMLSISSVFFLVIDQSIGWL 58 + F ++ R E KI WPSR +++ SV V++I+L+ +S +LV DQ GWL Sbjct: 31 GIPGFLQETRAELAKIVWPSRQQLISESVGVLLIVLAFASFIYLV-DQLFGWL 82 >gi|39997960|ref|NP_953911.1| preprotein translocase subunit SecE [Geobacter sulfurreducens PCA] gi|39984905|gb|AAR36261.1| preprotein translocase, SecE subunit, putative [Geobacter sulfurreducens PCA] Length = 66 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F +V+ E K+ WP+R E + + VV+ ++ + SV+ V D + LM ILG Sbjct: 12 EFLTEVKAELDKVTWPTRKETVSTTWVVVAIVLLISVYLGVCDVVLAKLMRIILG 66 >gi|282896128|ref|ZP_06304154.1| SecE subunit of protein translocation complex [Raphidiopsis brookii D9] gi|281199046|gb|EFA73921.1| SecE subunit of protein translocation complex [Raphidiopsis brookii D9] Length = 73 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 29/48 (60%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 NFF+ ++E K+ WPSR +++ V++M+++S+ ++D W Sbjct: 20 NFFQGTKEELDKVVWPSRKQLVSESAAVLLMVTLSASLIYLVDGLFSW 67 >gi|261819560|ref|YP_003257666.1| preprotein translocase subunit SecE [Pectobacterium wasabiae WPP163] gi|261603573|gb|ACX86059.1| preprotein translocase, SecE subunit [Pectobacterium wasabiae WPP163] Length = 127 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|323490599|ref|ZP_08095804.1| preprotein translocase subunit [Planococcus donghaensis MPA1U2] gi|323395691|gb|EGA88532.1| preprotein translocase subunit [Planococcus donghaensis MPA1U2] Length = 61 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 19/56 (33%), Positives = 30/56 (53%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 +FFK V E +K+ WP R E+ IVV+ ++FF V+D I L + + + Sbjct: 6 SFFKNVVSEMRKVSWPKRKELTRYTIVVLATCIFMALFFTVVDAGISKLFRWFIAL 61 >gi|15607136|ref|NP_214325.1| preprotein translocase subunit SecE [Aquifex aeolicus VF5] gi|215794646|pdb|3DL8|C Chain C, Structure Of The Complex Of Aquifex Aeolicus Secyeg And Bacillus Subtilis Seca gi|215794647|pdb|3DL8|D Chain D, Structure Of The Complex Of Aquifex Aeolicus Secyeg And Bacillus Subtilis Seca Length = 65 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 32/56 (57%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K VRDE K++ WPSR V+ + I VII V+ ++D + ++ FIL + Sbjct: 6 EFLKGVRDELKRVVWPSRELVVKATISVIIFSLAIGVYLWILDLTFTKIISFILSL 61 >gi|21957174|gb|AAM84067.1|AE013648_9 preprotein translocase [Yersinia pestis KIM 10] gi|45437736|gb|AAS63286.1| preprotein translocase SecE subunit [Yersinia pestis biovar Microtus str. 91001] Length = 132 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 72 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 130 >gi|290477022|ref|YP_003469934.1| preprotein translocase membrane protein transport across inner membrane [Xenorhabdus bovienii SS-2004] gi|289176367|emb|CBJ83172.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Xenorhabdus bovienii SS-2004] Length = 127 Score = 38.5 bits (88), Expect = 0.30, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATLAFAREARVEMRKVIWPTRQEALHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|332159906|ref|YP_004296483.1| preprotein translocase subunit SecE [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|318607544|emb|CBY29042.1| preprotein translocase subunit SecE [Yersinia enterocolitica subsp. palearctica Y11] gi|325664136|gb|ADZ40780.1| preprotein translocase subunit SecE [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|330863584|emb|CBX73696.1| preprotein translocase subunit secE [Yersinia enterocolitica W22703] Length = 127 Score = 38.5 bits (88), Expect = 0.31, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|16762306|ref|NP_457923.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|16767401|ref|NP_463016.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|29143794|ref|NP_807136.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|56415974|ref|YP_153049.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|62182601|ref|YP_219018.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|161505372|ref|YP_001572484.1| preprotein translocase subunit SecE [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|161617283|ref|YP_001591248.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|167554341|ref|ZP_02348082.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|168264793|ref|ZP_02686766.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|194444349|ref|YP_002043399.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194449614|ref|YP_002048134.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194469508|ref|ZP_03075492.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194735761|ref|YP_002117050.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197248847|ref|YP_002149058.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197364901|ref|YP_002144538.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|198242551|ref|YP_002218064.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|200386796|ref|ZP_03213408.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|205354450|ref|YP_002228251.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|207859325|ref|YP_002245976.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|213022867|ref|ZP_03337314.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] gi|213163866|ref|ZP_03349576.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] gi|213417732|ref|ZP_03350852.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. E01-6750] gi|213425732|ref|ZP_03358482.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. E02-1180] gi|213623115|ref|ZP_03375898.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068] gi|213650882|ref|ZP_03380935.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. J185] gi|213852741|ref|ZP_03382273.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. M223] gi|224585689|ref|YP_002639488.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|238913726|ref|ZP_04657563.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] gi|289826707|ref|ZP_06545672.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. E98-3139] gi|61242522|sp|P0A2D3|SECE_SALTY RecName: Full=Preprotein translocase subunit secE gi|61242527|sp|P0A2D4|SECE_SALTI RecName: Full=Preprotein translocase subunit secE gi|25301348|pir||AC0934 preprotein translocase SecE chain [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gi|6960334|gb|AAF33494.1| 96% identity over 127 amino acids with E. coli protein-export protein (SECE) (SW:P16920); contains similarity to Pfam domain PF00584 (SecE), Score=96.3, E=6,2e-25, N=1 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|16422704|gb|AAL22975.1| preprotein translocase IISP family, membrane subunit [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|16504610|emb|CAD09493.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Typhi] gi|29139429|gb|AAO70996.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|56130231|gb|AAV79737.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|62130234|gb|AAX67937.1| preprotein translocase IISP family, membrane subunit [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|160866719|gb|ABX23342.1| hypothetical protein SARI_03517 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] gi|161366647|gb|ABX70415.1| hypothetical protein SPAB_05134 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|194403012|gb|ACF63234.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194407918|gb|ACF68137.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194455872|gb|EDX44711.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194711263|gb|ACF90484.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197096378|emb|CAR61983.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|197212550|gb|ACH49947.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197937067|gb|ACH74400.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|199603894|gb|EDZ02439.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|205274231|emb|CAR39250.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|205321447|gb|EDZ09286.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|205346819|gb|EDZ33450.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|206711128|emb|CAR35502.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|224470217|gb|ACN48047.1| translocase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|267996445|gb|ACY91330.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] gi|301160643|emb|CBW20174.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|312915252|dbj|BAJ39226.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240] gi|320088578|emb|CBY98337.1| Preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] gi|321223347|gb|EFX48414.1| Preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] gi|322616257|gb|EFY13167.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] gi|322617300|gb|EFY14202.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] gi|322625928|gb|EFY22743.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] gi|322626674|gb|EFY23476.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] gi|322631509|gb|EFY28266.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] gi|322635222|gb|EFY31940.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] gi|322642611|gb|EFY39205.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] gi|322646784|gb|EFY43288.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] gi|322650783|gb|EFY47176.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675] gi|322655918|gb|EFY52219.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] gi|322657317|gb|EFY53596.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] gi|322665579|gb|EFY61764.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] gi|322669762|gb|EFY65907.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] gi|322670959|gb|EFY67091.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] gi|322679217|gb|EFY75270.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] gi|322679375|gb|EFY75422.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] gi|322688142|gb|EFY84106.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] gi|322717097|gb|EFZ08668.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] gi|323132482|gb|ADX19912.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] gi|323193410|gb|EFZ78620.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] gi|323200670|gb|EFZ85743.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] gi|323202159|gb|EFZ87215.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] gi|323209270|gb|EFZ94205.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] gi|323211595|gb|EFZ96432.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] gi|323218067|gb|EGA02780.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] gi|323221356|gb|EGA05778.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] gi|323225717|gb|EGA09938.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] gi|323230995|gb|EGA15112.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] gi|323235777|gb|EGA19859.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] gi|323240091|gb|EGA24137.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] gi|323242576|gb|EGA26598.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] gi|323249716|gb|EGA33623.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] gi|323252599|gb|EGA36440.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] gi|323256907|gb|EGA40619.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283] gi|323262071|gb|EGA45635.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] gi|323263924|gb|EGA47438.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] gi|323268463|gb|EGA51933.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287] gi|326625857|gb|EGE32202.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Dublin str. 3246] gi|326629583|gb|EGE35926.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Gallinarum str. 9] Length = 127 Score = 38.5 bits (88), Expect = 0.31, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|283787346|ref|YP_003367211.1| preprotein translocase SecE subunit [Citrobacter rodentium ICC168] gi|282950800|emb|CBG90476.1| preprotein translocase SecE subunit [Citrobacter rodentium ICC168] Length = 127 Score = 38.5 bits (88), Expect = 0.31, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|157368520|ref|YP_001476509.1| preprotein translocase subunit SecE [Serratia proteamaculans 568] gi|157320284|gb|ABV39381.1| preprotein translocase, SecE subunit [Serratia proteamaculans 568] Length = 127 Score = 38.5 bits (88), Expect = 0.31, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|238752783|ref|ZP_04614251.1| Preprotein translocase subunit secE [Yersinia rohdei ATCC 43380] gi|238708981|gb|EEQ01231.1| Preprotein translocase subunit secE [Yersinia rohdei ATCC 43380] Length = 127 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|238794965|ref|ZP_04638562.1| Preprotein translocase subunit secE [Yersinia intermedia ATCC 29909] gi|238725723|gb|EEQ17280.1| Preprotein translocase subunit secE [Yersinia intermedia ATCC 29909] Length = 127 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|225076427|ref|ZP_03719626.1| hypothetical protein NEIFLAOT_01473 [Neisseria flavescens NRL30031/H210] gi|224952227|gb|EEG33436.1| hypothetical protein NEIFLAOT_01473 [Neisseria flavescens NRL30031/H210] Length = 91 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 30/60 (50%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + +FK E KK+ WPSR E + + VII +++ + F D I WL +L Sbjct: 27 KKEGLFAYFKSSWTEFKKVVWPSRDEAVKMTVFVIIFVAVLAAFIYAADTIISWLFFDVL 86 >gi|270265418|ref|ZP_06193677.1| preprotein translocase subunit SecE [Serratia odorifera 4Rx13] gi|270040611|gb|EFA13716.1| preprotein translocase subunit SecE [Serratia odorifera 4Rx13] Length = 132 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 72 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 130 >gi|261381380|ref|ZP_05985953.1| preprotein translocase, SecE subunit [Neisseria subflava NJ9703] gi|284795627|gb|EFC50974.1| preprotein translocase, SecE subunit [Neisseria subflava NJ9703] Length = 91 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 30/60 (50%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + +FK E KK+ WPSR E + + VII +++ + F D I WL +L Sbjct: 27 KKEGLFAYFKSSWTEFKKVVWPSRDEAVKMTVFVIIFVAVLAAFIYTADTIISWLFFDVL 86 >gi|213585781|ref|ZP_03367607.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. E98-0664] Length = 87 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 27 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 85 >gi|123440669|ref|YP_001004662.1| preprotein translocase subunit SecE [Yersinia enterocolitica subsp. enterocolitica 8081] gi|238760250|ref|ZP_04621394.1| Preprotein translocase subunit secE [Yersinia aldovae ATCC 35236] gi|238785544|ref|ZP_04629525.1| Preprotein translocase subunit secE [Yersinia bercovieri ATCC 43970] gi|122087630|emb|CAL10412.1| preprotein translocase SecE subunit [Yersinia enterocolitica subsp. enterocolitica 8081] gi|238701514|gb|EEP94087.1| Preprotein translocase subunit secE [Yersinia aldovae ATCC 35236] gi|238713529|gb|EEQ05560.1| Preprotein translocase subunit secE [Yersinia bercovieri ATCC 43970] Length = 127 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|260596080|ref|YP_003208651.1| preprotein translocase subunit SecE [Cronobacter turicensis z3032] gi|260215257|emb|CBA27160.1| Preprotein translocase subunit secE [Cronobacter turicensis z3032] Length = 127 Score = 38.5 bits (88), Expect = 0.33, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|317494919|ref|ZP_07953329.1| preprotein translocase [Enterobacteriaceae bacterium 9_2_54FAA] gi|316917107|gb|EFV38456.1| preprotein translocase [Enterobacteriaceae bacterium 9_2_54FAA] Length = 127 Score = 38.5 bits (88), Expect = 0.33, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEMRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|241760446|ref|ZP_04758540.1| preprotein translocase subunit SecE [Neisseria flavescens SK114] gi|241319115|gb|EER55608.1| preprotein translocase subunit SecE [Neisseria flavescens SK114] Length = 91 Score = 38.5 bits (88), Expect = 0.33, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 30/60 (50%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + +FK E KK+ WPSR E + + VII +++ + F D I WL +L Sbjct: 27 KKEGLFAYFKSSWTEFKKVVWPSRDEAVKMTVFVIIFVAVLAAFIYAADTIISWLFFDVL 86 >gi|227115001|ref|ZP_03828657.1| preprotein translocase subunit SecE [Pectobacterium carotovorum subsp. brasiliensis PBR1692] gi|227328358|ref|ZP_03832382.1| preprotein translocase subunit SecE [Pectobacterium carotovorum subsp. carotovorum WPP14] gi|253686605|ref|YP_003015795.1| preprotein translocase, SecE subunit [Pectobacterium carotovorum subsp. carotovorum PC1] gi|251753183|gb|ACT11259.1| preprotein translocase, SecE subunit [Pectobacterium carotovorum subsp. carotovorum PC1] Length = 127 Score = 38.5 bits (88), Expect = 0.33, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|83754006|pdb|2AKH|Z Chain Z, Normal Mode-Based Flexible Fitted Coordinates Of A Non- Translocating Secyeg Protein-Conducting Channel Into The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome Complex From E. Coli gi|83754009|pdb|2AKH|C Chain C, Normal Mode-Based Flexible Fitted Coordinates Of A Non- Translocating Secyeg Protein-Conducting Channel Into The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome Complex From E. Coli gi|83754012|pdb|2AKI|Z Chain Z, Normal Mode-Based Flexible Fitted Coordinates Of A Translocating Secyeg Protein-Conducting Channel Into The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome Complex From E. Coli gi|83754015|pdb|2AKI|C Chain C, Normal Mode-Based Flexible Fitted Coordinates Of A Translocating Secyeg Protein-Conducting Channel Into The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome Complex From E. Coli Length = 111 Score = 38.5 bits (88), Expect = 0.33, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 51 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 109 >gi|156935822|ref|YP_001439738.1| preprotein translocase subunit SecE [Cronobacter sakazakii ATCC BAA-894] gi|156534076|gb|ABU78902.1| hypothetical protein ESA_03698 [Cronobacter sakazakii ATCC BAA-894] Length = 132 Score = 38.5 bits (88), Expect = 0.33, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 72 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 130 >gi|50119177|ref|YP_048344.1| preprotein translocase subunit SecE [Pectobacterium atrosepticum SCRI1043] gi|49609703|emb|CAG73136.1| preprotein translocase SecE subunit [Pectobacterium atrosepticum SCRI1043] Length = 127 Score = 38.5 bits (88), Expect = 0.34, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|300865661|ref|ZP_07110432.1| preprotein translocase subunit SecE [Oscillatoria sp. PCC 6506] gi|300336339|emb|CBN55582.1| preprotein translocase subunit SecE [Oscillatoria sp. PCC 6506] Length = 76 Score = 38.5 bits (88), Expect = 0.34, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 30/48 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 +FFK+ ++E +K+ WPSR +++ V++M+ +S+ ++D W Sbjct: 21 SFFKETKEELEKVVWPSRQQLVSESFAVVLMVILSASLIYLVDNFFNW 68 >gi|257880336|ref|ZP_05659989.1| preprotein translocase [Enterococcus faecium 1,230,933] gi|257882190|ref|ZP_05661843.1| preprotein translocase [Enterococcus faecium 1,231,502] gi|257885383|ref|ZP_05665036.1| preprotein translocase [Enterococcus faecium 1,231,501] gi|257890995|ref|ZP_05670648.1| preprotein translocase [Enterococcus faecium 1,231,410] gi|257894249|ref|ZP_05673902.1| preprotein translocase [Enterococcus faecium 1,231,408] gi|258614713|ref|ZP_05712483.1| preprotein translocase, SecE subunit [Enterococcus faecium DO] gi|260562360|ref|ZP_05832874.1| preprotein translocase [Enterococcus faecium C68] gi|261209265|ref|ZP_05923657.1| preprotein translocase [Enterococcus faecium TC 6] gi|289566014|ref|ZP_06446452.1| preprotein translocase, SecE subunit [Enterococcus faecium D344SRF] gi|293557115|ref|ZP_06675670.1| preprotein translocase, SecE subunit [Enterococcus faecium E1039] gi|293559847|ref|ZP_06676361.1| preprotein translocase, SecE subunit [Enterococcus faecium E1162] gi|293568367|ref|ZP_06679688.1| preprotein translocase, SecE subunit [Enterococcus faecium E1071] gi|294616182|ref|ZP_06695979.1| preprotein translocase, SecE subunit [Enterococcus faecium E1636] gi|294618924|ref|ZP_06698431.1| preprotein translocase, SecE subunit [Enterococcus faecium E1679] gi|294623150|ref|ZP_06702036.1| preprotein translocase, SecE subunit [Enterococcus faecium U0317] gi|314937978|ref|ZP_07845289.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133a04] gi|314941597|ref|ZP_07848481.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133C] gi|314948418|ref|ZP_07851806.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0082] gi|314951394|ref|ZP_07854446.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133A] gi|314991323|ref|ZP_07856802.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133B] gi|314995339|ref|ZP_07860445.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133a01] gi|257814564|gb|EEV43322.1| preprotein translocase [Enterococcus faecium 1,230,933] gi|257817848|gb|EEV45176.1| preprotein translocase [Enterococcus faecium 1,231,502] gi|257821239|gb|EEV48369.1| preprotein translocase [Enterococcus faecium 1,231,501] gi|257827355|gb|EEV53981.1| preprotein translocase [Enterococcus faecium 1,231,410] gi|257830628|gb|EEV57235.1| preprotein translocase [Enterococcus faecium 1,231,408] gi|260073284|gb|EEW61625.1| preprotein translocase [Enterococcus faecium C68] gi|260076811|gb|EEW64546.1| preprotein translocase [Enterococcus faecium TC 6] gi|289162212|gb|EFD10074.1| preprotein translocase, SecE subunit [Enterococcus faecium D344SRF] gi|291588888|gb|EFF20715.1| preprotein translocase, SecE subunit [Enterococcus faecium E1071] gi|291590937|gb|EFF22649.1| preprotein translocase, SecE subunit [Enterococcus faecium E1636] gi|291594840|gb|EFF26210.1| preprotein translocase, SecE subunit [Enterococcus faecium E1679] gi|291597519|gb|EFF28684.1| preprotein translocase, SecE subunit [Enterococcus faecium U0317] gi|291600736|gb|EFF31033.1| preprotein translocase, SecE subunit [Enterococcus faecium E1039] gi|291606183|gb|EFF35603.1| preprotein translocase, SecE subunit [Enterococcus faecium E1162] gi|313590432|gb|EFR69277.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133a01] gi|313594096|gb|EFR72941.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133B] gi|313596452|gb|EFR75297.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133A] gi|313599617|gb|EFR78460.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133C] gi|313642653|gb|EFS07233.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133a04] gi|313645143|gb|EFS09723.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0082] Length = 56 Score = 38.5 bits (88), Expect = 0.34, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI----GWLMH 60 + F K V+DE K++ WPSR ++ +VVI I + F V+D +I GW++ Sbjct: 1 MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK 56 >gi|293602654|ref|ZP_06685096.1| preprotein translocase [Achromobacter piechaudii ATCC 43553] gi|292818964|gb|EFF78003.1| preprotein translocase [Achromobacter piechaudii ATCC 43553] Length = 126 Score = 38.5 bits (88), Expect = 0.35, Method: Compositional matrix adjust. Identities = 15/56 (26%), Positives = 32/56 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F + +E K++ WP+R E +V +++ +F V+D+ I W+++ +L Sbjct: 67 TLSFASESYNEVKRVAWPTRKETTQMTGIVFAFVAVMGIFMWVLDKGIEWILYGLL 122 >gi|152972838|ref|YP_001337984.1| preprotein translocase subunit SecE [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|206580360|ref|YP_002241082.1| preprotein translocase subunit secE [Klebsiella pneumoniae 342] gi|238892451|ref|YP_002917185.1| preprotein translocase subunit SecE [Klebsiella pneumoniae NTUH-K2044] gi|262043787|ref|ZP_06016889.1| preprotein translocase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|288937727|ref|YP_003441786.1| preprotein translocase subunit E [Klebsiella variicola At-22] gi|290513235|ref|ZP_06552596.1| preprotein translocase subunit secE [Klebsiella sp. 1_1_55] gi|330004994|ref|ZP_08305078.1| preprotein translocase, SecE subunit [Klebsiella sp. MS 92-3] gi|150957687|gb|ABR79717.1| translocase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|206569418|gb|ACI11194.1| preprotein translocase subunit secE [Klebsiella pneumoniae 342] gi|238544767|dbj|BAH61118.1| preprotein translocase membrane subunit [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] gi|259038874|gb|EEW40043.1| preprotein translocase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|288892436|gb|ADC60754.1| preprotein translocase, SecE subunit [Klebsiella variicola At-22] gi|289774332|gb|EFD82339.1| preprotein translocase subunit secE [Klebsiella sp. 1_1_55] gi|328536458|gb|EGF62806.1| preprotein translocase, SecE subunit [Klebsiella sp. MS 92-3] Length = 127 Score = 38.5 bits (88), Expect = 0.35, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|320185981|gb|EFW60729.1| Preprotein translocase subunit SecE [Shigella flexneri CDC 796-83] Length = 101 Score = 38.1 bits (87), Expect = 0.35, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 41 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 99 >gi|300725137|ref|YP_003714465.1| preprotein translocase membrane protein [Xenorhabdus nematophila ATCC 19061] gi|297631682|emb|CBJ92395.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Xenorhabdus nematophila ATCC 19061] Length = 127 Score = 38.1 bits (87), Expect = 0.35, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 AALAFAREARIEMRKVIWPTRQEALHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|158336004|ref|YP_001517178.1| hypothetical protein AM1_2863 [Acaryochloris marina MBIC11017] gi|158306245|gb|ABW27862.1| conserved domain protein [Acaryochloris marina MBIC11017] Length = 90 Score = 38.1 bits (87), Expect = 0.35, Method: Compositional matrix adjust. Identities = 16/55 (29%), Positives = 30/55 (54%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F + ++E +K+ WP R +++ I V +M+S+S+ F ID W+ + G Sbjct: 36 GFLQGTKEELEKVVWPDRQQLISESIAVFLMVSLSAFIFSFIDNLFRWVSTLVFG 90 >gi|294496968|ref|YP_003560668.1| preprotein translocase subunit SecE [Bacillus megaterium QM B1551] gi|295702335|ref|YP_003595410.1| preprotein translocase subunit SecE [Bacillus megaterium DSM 319] gi|294346905|gb|ADE67234.1| preprotein translocase, SecE subunit [Bacillus megaterium QM B1551] gi|294799994|gb|ADF37060.1| preprotein translocase, SecE subunit [Bacillus megaterium DSM 319] Length = 59 Score = 38.1 bits (87), Expect = 0.36, Method: Compositional matrix adjust. Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 2/59 (3%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 NR+ NF + V E KK+ WP ++E+ I VI + ++FF+V+D I L+ I Sbjct: 2 NRVG--NFLRDVGREMKKVSWPKKNELTRYTITVISTVVFMTLFFVVVDYGISSLIRLI 58 >gi|289551665|ref|YP_003472569.1| Preprotein translocase subunit SecE [Staphylococcus lugdunensis HKU09-01] gi|315659124|ref|ZP_07911989.1| preprotein translocase [Staphylococcus lugdunensis M23590] gi|289181196|gb|ADC88441.1| Preprotein translocase subunit SecE [Staphylococcus lugdunensis HKU09-01] gi|315495848|gb|EFU84178.1| preprotein translocase [Staphylococcus lugdunensis M23590] Length = 64 Score = 38.1 bits (87), Expect = 0.36, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 29/51 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 NFFK V+ E +K WP++ E+ ++V+ + FF V+D IG L+ Sbjct: 11 NFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVLFFMAFFYVLDIGIGNLIE 61 >gi|326392211|ref|ZP_08213672.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus JW 200] gi|325991750|gb|EGD50281.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus JW 200] Length = 49 Score = 38.1 bits (87), Expect = 0.36, Method: Compositional matrix adjust. Identities = 16/40 (40%), Positives = 28/40 (70%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVF 47 ++ FFK VR E KK+ WPSR ++ +V+I++++ +VF Sbjct: 8 IVKFFKDVRAEMKKVTWPSRETMITYTEIVLIVVALFTVF 47 >gi|238765323|ref|ZP_04626249.1| Preprotein translocase subunit secE [Yersinia kristensenii ATCC 33638] gi|238798657|ref|ZP_04642131.1| Preprotein translocase subunit secE [Yersinia mollaretii ATCC 43969] gi|238696450|gb|EEP89241.1| Preprotein translocase subunit secE [Yersinia kristensenii ATCC 33638] gi|238717475|gb|EEQ09317.1| Preprotein translocase subunit secE [Yersinia mollaretii ATCC 43969] Length = 132 Score = 38.1 bits (87), Expect = 0.36, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 72 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 130 >gi|297172923|gb|ADI23884.1| preprotein translocase subunit secE [uncultured gamma proteobacterium HF4000_48J03] Length = 123 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 26/43 (60%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 FF+ R E KK+ WP+R E L + + V + + I +FF V+D Sbjct: 69 EFFQGSRVEIKKVIWPTRQETLQTTLTVFVFVLIMGIFFWVLD 111 >gi|320108602|ref|YP_004184192.1| preprotein translocase subunit SecE [Terriglobus saanensis SP1PR4] gi|319927123|gb|ADV84198.1| preprotein translocase, SecE subunit [Terriglobus saanensis SP1PR4] Length = 86 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 34/55 (61%), Gaps = 4/55 (7%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID----QSIGWLMH 60 F + VR+E+KK+ P+ +EV + IVV++ + + + +F V+D ++G L+ Sbjct: 27 TFLEDVRNETKKLSTPTGAEVKSTTIVVLVTVFVFAAYFAVVDYIASHTVGALLE 81 >gi|254456161|ref|ZP_05069590.1| preprotein translocase, SecE subunit [Candidatus Pelagibacter sp. HTCC7211] gi|207083163|gb|EDZ60589.1| preprotein translocase, SecE subunit [Candidatus Pelagibacter sp. HTCC7211] Length = 63 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 29/45 (64%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQ 53 + F ++V+ E+ K+ WP+ E L ++V M I S+FFL++DQ Sbjct: 5 IKFIQEVKQEAFKVSWPTWKETLQGALMVFAMAVIMSLFFLLLDQ 49 >gi|82778844|ref|YP_405193.1| preprotein translocase subunit SecE [Shigella dysenteriae Sd197] gi|81242992|gb|ABB63702.1| preprotein translocase [Shigella dysenteriae Sd197] Length = 127 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVPLVSFIPGL 125 >gi|34762877|ref|ZP_00143860.1| PROTEIN TRANSLOCASE SUBUNIT SECE [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gi|237740929|ref|ZP_04571410.1| protein translocase subunit sece [Fusobacterium sp. 4_1_13] gi|256846756|ref|ZP_05552212.1| preprotein translocase, SecE subunit [Fusobacterium sp. 3_1_36A2] gi|294784293|ref|ZP_06749587.1| preprotein translocase, SecE subunit [Fusobacterium sp. 3_1_27] gi|27887441|gb|EAA24528.1| PROTEIN TRANSLOCASE SUBUNIT SECE [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gi|229430973|gb|EEO41185.1| protein translocase subunit sece [Fusobacterium sp. 4_1_13] gi|256717976|gb|EEU31533.1| preprotein translocase, SecE subunit [Fusobacterium sp. 3_1_36A2] gi|294488049|gb|EFG35401.1| preprotein translocase, SecE subunit [Fusobacterium sp. 3_1_27] Length = 58 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 29/44 (65%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +N F++V+ E K+ WPSR+EV+ S + V+ M + S++ V D Sbjct: 1 MNLFQKVKMEYSKVEWPSRTEVIHSTLWVVTMTVLVSIYLGVFD 44 >gi|308047967|ref|YP_003911533.1| protein translocase subunit secE/sec61 gamma [Ferrimonas balearica DSM 9799] gi|307630157|gb|ADN74459.1| protein translocase subunit secE/sec61 gamma [Ferrimonas balearica DSM 9799] Length = 123 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 14/59 (23%), Positives = 33/59 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A F ++ R+E +K+ WP+R E + + ++V + + ++D + W+++ I G+ Sbjct: 65 AAWAFAQESRNEVRKVVWPTRQETVQTTLIVFAATAFMAFCLWLLDMGLVWIVNLITGV 123 >gi|218960796|ref|YP_001740571.1| Preprotein translocase subunit SecE [Candidatus Cloacamonas acidaminovorans] gi|167729453|emb|CAO80364.1| Preprotein translocase subunit SecE [Candidatus Cloacamonas acidaminovorans] Length = 61 Score = 38.1 bits (87), Expect = 0.37, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 30/45 (66%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 + FF+ VR E K + WP+++++ +VVIIM +I ++F +ID Sbjct: 6 ITRFFRDVRSEMKCVSWPTKTDLKEGTLVVIIMSAIVAIFLSLID 50 >gi|320540640|ref|ZP_08040290.1| preprotein translocase membrane subunit [Serratia symbiotica str. Tucson] gi|320029571|gb|EFW11600.1| preprotein translocase membrane subunit [Serratia symbiotica str. Tucson] Length = 154 Score = 38.1 bits (87), Expect = 0.38, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 94 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSMILWGLDGVLVRLVSFITGL 152 >gi|238790610|ref|ZP_04634375.1| Preprotein translocase subunit secE [Yersinia frederiksenii ATCC 33641] gi|238721279|gb|EEQ12954.1| Preprotein translocase subunit secE [Yersinia frederiksenii ATCC 33641] Length = 97 Score = 38.1 bits (87), Expect = 0.38, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 37 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 95 >gi|88799205|ref|ZP_01114784.1| translocase [Reinekea sp. MED297] gi|88777964|gb|EAR09160.1| translocase [Reinekea sp. MED297] Length = 122 Score = 38.1 bits (87), Expect = 0.38, Method: Compositional matrix adjust. Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 5/63 (7%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 VNRL K+ E +K+ WP+R E + + +VVI + + ++ +D +GWL+ Sbjct: 65 AVNRLR-----KEAWVEVRKVVWPTRQETVQTTLVVIGFVLVVALILWAVDSLLGWLVSL 119 Query: 62 ILG 64 ++G Sbjct: 120 VIG 122 >gi|262038184|ref|ZP_06011578.1| preprotein translocase, SecE subunit [Leptotrichia goodfellowii F0264] gi|261747765|gb|EEY35210.1| preprotein translocase, SecE subunit [Leptotrichia goodfellowii F0264] Length = 59 Score = 38.1 bits (87), Expect = 0.38, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 32/45 (71%), Gaps = 2/45 (4%) Query: 17 DESKKIFWPSRSEVL-VSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 DE KKI+WP+RSEV V++IV++I L I +++ LV D L++ Sbjct: 3 DEYKKIYWPNRSEVFHVTIIVLLITLFI-ALYILVFDNVFDLLLN 46 >gi|304315926|ref|YP_003851071.1| preprotein translocase, SecE subunit [Thermoanaerobacterium thermosaccharolyticum DSM 571] gi|302777428|gb|ADL67987.1| preprotein translocase, SecE subunit [Thermoanaerobacterium thermosaccharolyticum DSM 571] Length = 66 Score = 38.1 bits (87), Expect = 0.39, Method: Compositional matrix adjust. Identities = 14/54 (25%), Positives = 34/54 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF++++ E KK+ WP+R+++L VV++++ ++ + D + +L+ I+ Sbjct: 11 KFFREIKAEMKKVTWPTRNDLLAYTEVVLVVVIAFTLLIFLADSAFSYLLKLII 64 >gi|288554710|ref|YP_003426645.1| preprotein translocase subunit, secE [Bacillus pseudofirmus OF4] gi|288545870|gb|ADC49753.1| preprotein translocase subunit, secE [Bacillus pseudofirmus OF4] Length = 64 Score = 38.1 bits (87), Expect = 0.39, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 32/55 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FFK V E K++ WP+R E+ VV+ ++ +VFF ++D I ++ +LG Sbjct: 10 KFFKDVVLEMKRVSWPTRKELTRYTWVVLGTVAFITVFFAIVDYGISSVVRLLLG 64 >gi|295111110|emb|CBL27860.1| preprotein translocase, SecE subunit, bacterial [Synergistetes bacterium SGP1] Length = 67 Score = 38.1 bits (87), Expect = 0.40, Method: Compositional matrix adjust. Identities = 19/63 (30%), Positives = 35/63 (55%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 VN + + F ++VR E KK+ WP++ +V ++VI+ S++ +ID + W Sbjct: 5 AVNSIPGVAFLREVRAELKKVTWPTKKQVWYWTLIVIVFTLGVSLYLGLIDFLLTWAFSG 64 Query: 62 ILG 64 +LG Sbjct: 65 MLG 67 >gi|323182078|gb|EFZ67488.1| preprotein translocase, SecE subunit [Escherichia coli 1357] gi|332091166|gb|EGI96256.1| preprotein translocase, SecE subunit [Shigella dysenteriae 155-74] gi|332092331|gb|EGI97406.1| preprotein translocase, SecE subunit [Shigella boydii 3594-74] Length = 106 Score = 38.1 bits (87), Expect = 0.42, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 46 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 104 >gi|317401590|gb|EFV82217.1| SecE protein [Achromobacter xylosoxidans C54] Length = 126 Score = 38.1 bits (87), Expect = 0.43, Method: Compositional matrix adjust. Identities = 15/56 (26%), Positives = 32/56 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F + +E K++ WP+R E +V +++ +F V+D+ I W+++ +L Sbjct: 67 TLSFASESYNEVKRVSWPTRKETTQMTGIVFAFVAVMGIFMWVLDKGIEWILYGLL 122 >gi|291295567|ref|YP_003506965.1| preprotein translocase subunit SecE [Meiothermus ruber DSM 1279] gi|290470526|gb|ADD27945.1| preprotein translocase, SecE subunit [Meiothermus ruber DSM 1279] Length = 72 Score = 38.1 bits (87), Expect = 0.43, Method: Compositional matrix adjust. Identities = 15/45 (33%), Positives = 29/45 (64%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 ++N+F++ R E ++ WPSR EV+ S V+++ ++ V +ID Sbjct: 17 IINYFREARAELTRVTWPSRQEVIESTQVILVFAVVAMVVLGLID 61 >gi|169837421|ref|ZP_02870609.1| hypothetical protein cdivTM_10033 [candidate division TM7 single-cell isolate TM7a] Length = 71 Score = 38.1 bits (87), Expect = 0.44, Method: Compositional matrix adjust. Identities = 16/54 (29%), Positives = 33/54 (61%) Query: 14 QVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 +R+E KKI+WP + E+ ++VI+M + +++ L+ D + +++ I I R Sbjct: 12 NLREEYKKIYWPDKIEIYHVTVIVILMTAFIAIYTLLFDTAFNFVLAKISDILR 65 >gi|119899719|ref|YP_934932.1| preprotein translocase subunit SecE [Azoarcus sp. BH72] gi|119672132|emb|CAL96046.1| preprotein translocase, SecE subunit [Azoarcus sp. BH72] Length = 115 Score = 37.7 bits (86), Expect = 0.46, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH-FILG 64 F ++ E+KK+ WPSR E + + +V + + ++F + D+S+ W+++ ILG Sbjct: 58 EFAREAVVETKKVVWPSRKETVQTTGMVFAFVVVMAIFLWLTDKSLEWVLYDLILG 113 >gi|224475683|ref|YP_002633289.1| preprotein translocase subunit SecE [Staphylococcus carnosus subsp. carnosus TM300] gi|548912|sp|P36253|SECE_STACT RecName: Full=Preprotein translocase subunit secE gi|426472|emb|CAA53737.1| secE [Staphylococcus carnosus] gi|222420290|emb|CAL27104.1| secE [Staphylococcus carnosus subsp. carnosus TM300] Length = 65 Score = 37.7 bits (86), Expect = 0.46, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 30/53 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +FFK V E +K WP++ E+L +VI+ + +FF +D IG L+ I Sbjct: 12 SFFKGVISEMEKTSWPTKEEILKYTTIVIVTVVFFLIFFYALDLGIGKLIELI 64 >gi|268316662|ref|YP_003290381.1| preprotein translocase, SecE subunit [Rhodothermus marinus DSM 4252] gi|262334196|gb|ACY47993.1| preprotein translocase, SecE subunit [Rhodothermus marinus DSM 4252] Length = 62 Score = 37.7 bits (86), Expect = 0.47, Method: Compositional matrix adjust. Identities = 15/58 (25%), Positives = 36/58 (62%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 V ++ ++V E +K+ WPSR E++ + I+ ++ ++ ++F + D+ I ++ FI + Sbjct: 5 VRDYLQEVYREMQKVSWPSRQELINNTILTLVASTVLALFIFLADRVIATVLEFIYSL 62 >gi|226309791|ref|YP_002769685.1| preprotein translocase SecE subunit [Brevibacillus brevis NBRC 100599] gi|226092739|dbj|BAH41181.1| preprotein translocase SecE subunit [Brevibacillus brevis NBRC 100599] Length = 82 Score = 37.7 bits (86), Expect = 0.47, Method: Compositional matrix adjust. Identities = 21/55 (38%), Positives = 33/55 (60%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF V E KK+ WP+R E+ +VV++ + + ++FF V+D I L+ ILG Sbjct: 27 GFFSDVMSELKKVRWPNRKELTTYTLVVLVTVVLLAIFFFVVDLGISRLIDLILG 81 >gi|205372083|ref|ZP_03224900.1| preprotein translocase subunit SecE [Bacillus coahuilensis m4-4] Length = 59 Score = 37.7 bits (86), Expect = 0.47, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 28/56 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+ V E KK WP R E+ I VI + ++FF +D I LM IL Sbjct: 4 IAKFFRNVSLEMKKTSWPKRKELTRYTITVISTVVFVALFFAAVDFGISTLMDLIL 59 >gi|163859292|ref|YP_001633590.1| preprotein translocase subunit SecE [Bordetella petrii DSM 12804] gi|163263020|emb|CAP45323.1| secE [Bordetella petrii] Length = 126 Score = 37.7 bits (86), Expect = 0.48, Method: Compositional matrix adjust. Identities = 15/56 (26%), Positives = 32/56 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F + +E+K++ WP+R E +V ++I + V+D+ I W+++ +L Sbjct: 67 TLSFANESYNEAKRVSWPTRKETTQMTGIVFAFVAIMGLLMWVLDKGIEWILYGLL 122 >gi|291286299|ref|YP_003503115.1| preprotein translocase, SecE subunit [Denitrovibrio acetiphilus DSM 12809] gi|290883459|gb|ADD67159.1| preprotein translocase, SecE subunit [Denitrovibrio acetiphilus DSM 12809] Length = 59 Score = 37.7 bits (86), Expect = 0.49, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 31/53 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F+ +V++E KK+ WP++ + + VVI + + ++F V+D + + FI Sbjct: 6 KFYNEVKEELKKVVWPTKESTIGTTGVVIAICIVCAIFMGVVDFGLAKITQFI 58 >gi|303239008|ref|ZP_07325538.1| preprotein translocase, SecE subunit [Acetivibrio cellulolyticus CD2] gi|302593346|gb|EFL63064.1| preprotein translocase, SecE subunit [Acetivibrio cellulolyticus CD2] Length = 74 Score = 37.7 bits (86), Expect = 0.49, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 29/56 (51%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FFK +R E KK+ WP+R +V+ + V+I + + + D G+L + I Sbjct: 19 KFFKDIRSELKKVVWPTRVQVVKNTATVLIACFLVGIIIWLADAGFGYLRTLVFKI 74 >gi|302871672|ref|YP_003840308.1| preprotein translocase, SecE subunit [Caldicellulosiruptor obsidiansis OB47] gi|302574531|gb|ADL42322.1| preprotein translocase, SecE subunit [Caldicellulosiruptor obsidiansis OB47] Length = 89 Score = 37.7 bits (86), Expect = 0.49, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 27/46 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 L FF+ VR E KK+ WPS+ +V+ IVV+ +VF L+ D Sbjct: 29 KTLKFFRDVRIEMKKVVWPSQKQVVKHTIVVLTFTLFFTVFILLAD 74 >gi|260890607|ref|ZP_05901870.1| e protein translocase, SecE subunit [Leptotrichia hofstadii F0254] gi|260859652|gb|EEX74152.1| e protein translocase, SecE subunit [Leptotrichia hofstadii F0254] Length = 71 Score = 37.7 bits (86), Expect = 0.50, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 31/48 (64%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 F +R+E KKI+WP + EV ++VI+M + +++ ++ D + +++ Sbjct: 10 FGNLREEYKKIYWPDKIEVYHVTVIVILMTAFIALYTVLFDTAFNFVL 57 >gi|289523626|ref|ZP_06440480.1| preprotein translocase, SecE subunit [Anaerobaculum hydrogeniformans ATCC BAA-1850] gi|289503318|gb|EFD24482.1| preprotein translocase, SecE subunit [Anaerobaculum hydrogeniformans ATCC BAA-1850] Length = 60 Score = 37.7 bits (86), Expect = 0.51, Method: Compositional matrix adjust. Identities = 15/45 (33%), Positives = 30/45 (66%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 V+NF ++ R E +++ WP+R +V +S ++VI + + S + V+D Sbjct: 4 VMNFLREARAELRRVTWPNRKQVWISTLLVIGVTLLVSAYLGVLD 48 >gi|254422067|ref|ZP_05035785.1| preprotein translocase, SecE subunit, putative [Synechococcus sp. PCC 7335] gi|196189556|gb|EDX84520.1| preprotein translocase, SecE subunit, putative [Synechococcus sp. PCC 7335] Length = 85 Score = 37.7 bits (86), Expect = 0.51, Method: Compositional matrix adjust. Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 10 NFFKQ-VRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 N F Q R+E K+ WP+R +++ VI+M+ +S+ +D+ GW I Sbjct: 31 NAFAQGTREELTKVIWPTRQQLISESAAVILMVGLSATLIYFVDKLFGWASRQI 84 >gi|291482472|dbj|BAI83547.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. natto BEST195] Length = 59 Score = 37.7 bits (86), Expect = 0.52, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 31/58 (53%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ FFK V E KK+ WP E+ I VI + +FF ++D I L+ FI+ Sbjct: 1 MRIMKFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFVIFFALLDTGISQLIRFIV 58 >gi|19705333|ref|NP_602828.1| protein translocase subunit SecE [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gi|296329160|ref|ZP_06871662.1| preprotein translocase [Fusobacterium nucleatum subsp. nucleatum ATCC 23726] gi|19713310|gb|AAL94127.1| Protein translocase subunit SecE [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gi|296153734|gb|EFG94550.1| preprotein translocase [Fusobacterium nucleatum subsp. nucleatum ATCC 23726] Length = 58 Score = 37.7 bits (86), Expect = 0.52, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 29/44 (65%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +N F++V+ E K+ WPSR+EV+ S + V+ M + S++ + D Sbjct: 1 MNLFQKVKMEYSKVEWPSRTEVIHSTLWVVTMTVLVSIYLGIFD 44 >gi|222529522|ref|YP_002573404.1| preprotein translocase, SecE subunit [Caldicellulosiruptor bescii DSM 6725] gi|312622248|ref|YP_004023861.1| preprotein translocase, sece subunit [Caldicellulosiruptor kronotskyensis 2002] gi|222456369|gb|ACM60631.1| preprotein translocase, SecE subunit [Caldicellulosiruptor bescii DSM 6725] gi|312202715|gb|ADQ46042.1| preprotein translocase, SecE subunit [Caldicellulosiruptor kronotskyensis 2002] Length = 89 Score = 37.7 bits (86), Expect = 0.53, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 27/46 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 L FF+ VR E KK+ WPS+ +V+ IVV+ +VF L+ D Sbjct: 29 KTLKFFRDVRIEMKKVVWPSQKQVVKHTIVVLTFTLFFTVFILLAD 74 >gi|323700794|ref|ZP_08112706.1| preprotein translocase, SecE subunit [Desulfovibrio sp. ND132] gi|323460726|gb|EGB16591.1| preprotein translocase, SecE subunit [Desulfovibrio desulfuricans ND132] Length = 85 Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 15/56 (26%), Positives = 35/56 (62%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FF++ + E KK+ WP+R E + + I V+++ + +++ V+D ++ ++ IL Sbjct: 30 IEFFEESKVEIKKVVWPTRKETVTTCIAVLVVSVVIALYLGVVDLALSKIVEAILS 85 >gi|312127419|ref|YP_003992293.1| preprotein translocase, sece subunit [Caldicellulosiruptor hydrothermalis 108] gi|311777438|gb|ADQ06924.1| preprotein translocase, SecE subunit [Caldicellulosiruptor hydrothermalis 108] Length = 89 Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 19/45 (42%), Positives = 27/45 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 L FF+ VR E KK+ WPS+ +V+ IVV+ +VF L+ D Sbjct: 30 TLKFFRDVRIEMKKVVWPSQKQVVKHTIVVLTFTLFFTVFILLAD 74 >gi|228989304|ref|ZP_04149295.1| preprotein translocase subunit SecE [Bacillus pseudomycoides DSM 12442] gi|228995486|ref|ZP_04155154.1| preprotein translocase subunit SecE [Bacillus mycoides Rock3-17] gi|229003109|ref|ZP_04160958.1| preprotein translocase subunit SecE [Bacillus mycoides Rock1-4] gi|228758145|gb|EEM07341.1| preprotein translocase subunit SecE [Bacillus mycoides Rock1-4] gi|228764215|gb|EEM13094.1| preprotein translocase subunit SecE [Bacillus mycoides Rock3-17] gi|228770382|gb|EEM18955.1| preprotein translocase subunit SecE [Bacillus pseudomycoides DSM 12442] Length = 59 Score = 37.7 bits (86), Expect = 0.54, Method: Compositional matrix adjust. Identities = 24/59 (40%), Positives = 33/59 (55%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + NFF V E KK+ WP + E+L S VI + +VFF V+D I L+ ILG Sbjct: 1 MRLTNFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAVFFAVVDMGISSLIRLILG 59 >gi|15612680|ref|NP_240983.1| preprotein translocase subunit [Bacillus halodurans C-125] gi|14548261|sp|Q9KGE8|SECE_BACHD RecName: Full=Preprotein translocase subunit secE gi|10172729|dbj|BAB03836.1| preprotein translocase subunit [Bacillus halodurans C-125] Length = 64 Score = 37.7 bits (86), Expect = 0.55, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 29/51 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 FF V E K++ WP+R E+ +VV+ ++ +VFF V+D I L+ Sbjct: 10 KFFGDVVAEMKRVSWPTRKELTRYTLVVLGTVAFITVFFAVVDYGISALVR 60 >gi|52078594|ref|YP_077385.1| preprotein translocase subunit SecE [Bacillus licheniformis ATCC 14580] gi|52783956|ref|YP_089785.1| preprotein translocase subunit SecE [Bacillus licheniformis ATCC 14580] gi|319649131|ref|ZP_08003339.1| preprotein translocase subunit secE [Bacillus sp. BT1B_CT2] gi|585979|sp|P38381|SECE_BACLI RecName: Full=Preprotein translocase subunit secE gi|52001805|gb|AAU21747.1| preprotein translocase subunit [Bacillus licheniformis ATCC 14580] gi|52346458|gb|AAU39092.1| SecE [Bacillus licheniformis ATCC 14580] gi|317388831|gb|EFV69650.1| preprotein translocase subunit secE [Bacillus sp. BT1B_CT2] Length = 59 Score = 37.7 bits (86), Expect = 0.56, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 30/58 (51%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ F K V E KK+ WP E+ I VI + ++FF +ID I L+ I+ Sbjct: 1 MGIIKFLKNVGKEMKKVTWPKGKELTRYTITVITTVIFFAIFFALIDSGITQLIRLIV 58 >gi|254431245|ref|ZP_05044948.1| putative preprotein translocase, SecE subunit [Cyanobium sp. PCC 7001] gi|197625698|gb|EDY38257.1| putative preprotein translocase, SecE subunit [Cyanobium sp. PCC 7001] Length = 101 Score = 37.7 bits (86), Expect = 0.56, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 26/47 (55%) Query: 18 ESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 E +K+ WPSR ++ + VI+M+ +S+ ID+ GW + G Sbjct: 55 ELRKVVWPSRQQLFSESVAVILMVGLSAAAIAAIDRFYGWAAAQVFG 101 >gi|294634228|ref|ZP_06712773.1| preprotein translocase, SecE subunit [Edwardsiella tarda ATCC 23685] gi|291092353|gb|EFE24914.1| preprotein translocase, SecE subunit [Edwardsiella tarda ATCC 23685] Length = 127 Score = 37.7 bits (86), Expect = 0.58, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ ++ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEMRKVIWPTRQEALHTTLIVAAVTAVMALILWGLDGILVRLVSFITGL 125 >gi|269121552|ref|YP_003309729.1| preprotein translocase, SecE subunit [Sebaldella termitidis ATCC 33386] gi|268615430|gb|ACZ09798.1| preprotein translocase, SecE subunit [Sebaldella termitidis ATCC 33386] Length = 59 Score = 37.7 bits (86), Expect = 0.59, Method: Compositional matrix adjust. Identities = 18/33 (54%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Query: 13 KQVRDESKKIFWPSRSEVL-VSVIVVIIMLSIS 44 K++ DE KK++WPS+ EVL V+VIV++I + IS Sbjct: 3 KEIIDEYKKVYWPSKQEVLHVTVIVLLITIFIS 35 >gi|284009038|emb|CBA75990.1| preprotein translocase SecE subunit [Arsenophonus nasoniae] Length = 127 Score = 37.4 bits (85), Expect = 0.61, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E L + ++V + ++ ++ +D + L+ FI G+ Sbjct: 67 ATLAFAREARIEMRKVIWPTRQETLQTTLIVAAVTAVMALILWGLDGILVRLVSFITGL 125 >gi|227497152|ref|ZP_03927400.1| preprotein translocase SecE [Actinomyces urogenitalis DSM 15434] gi|226833409|gb|EEH65792.1| preprotein translocase SecE [Actinomyces urogenitalis DSM 15434] Length = 80 Score = 37.4 bits (85), Expect = 0.61, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 37/59 (62%), Gaps = 6/59 (10%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEV----LVSVIVVIIMLSISSVFFLVIDQSIGWL 58 RLA+ FF+QV DE +K+ WP+R E+ LV V+ ++ +++ + + + D+ + W+ Sbjct: 22 GRLAL--FFRQVIDELRKVVWPTRKELWTYFLVVVVFIVAIMAYTGILDFIFDRIVMWV 78 >gi|311109631|ref|YP_003982484.1| preprotein translocase, SecE subunit [Achromobacter xylosoxidans A8] gi|310764320|gb|ADP19769.1| preprotein translocase, SecE subunit [Achromobacter xylosoxidans A8] Length = 126 Score = 37.4 bits (85), Expect = 0.66, Method: Compositional matrix adjust. Identities = 15/56 (26%), Positives = 32/56 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F + +E K++ WP+R E +V +++ +F V+D+ I W+++ +L Sbjct: 67 TLSFASESYNEVKRVSWPTRKETTQMTGIVFAFVAVMGLFMWVLDKGIEWILYGLL 122 >gi|254283529|ref|ZP_04958497.1| preprotein translocase, SecE subunit [gamma proteobacterium NOR51-B] gi|219679732|gb|EED36081.1| preprotein translocase, SecE subunit [gamma proteobacterium NOR51-B] Length = 137 Score = 37.4 bits (85), Expect = 0.66, Method: Compositional matrix adjust. Identities = 14/58 (24%), Positives = 31/58 (53%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A + K R E +K+ WP+R E + ++V++ + + ++ +D +GW+ +G Sbjct: 80 AFWSLVKGARTEIRKVVWPTRQETTQTTLIVVVFVIVMALILWALDSLLGWVASMFIG 137 >gi|317126841|ref|YP_004093123.1| preprotein translocase, SecE subunit [Bacillus cellulosilyticus DSM 2522] gi|315471789|gb|ADU28392.1| preprotein translocase, SecE subunit [Bacillus cellulosilyticus DSM 2522] Length = 59 Score = 37.4 bits (85), Expect = 0.67, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 30/58 (51%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F K V E K++ WP R E++ VVI ++ +V+F + D I L+ IL Sbjct: 1 MGATKFLKDVSTEMKRVSWPKRKELVRYTGVVIATVAFVAVYFAITDFGISELIRAIL 58 >gi|238918137|ref|YP_002931651.1| preprotein translocase subunit SecE [Edwardsiella ictaluri 93-146] gi|238867705|gb|ACR67416.1| preprotein translocase subunit SecE, putative [Edwardsiella ictaluri 93-146] Length = 111 Score = 37.4 bits (85), Expect = 0.67, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ ++ +D + L+ FI G+ Sbjct: 51 ATVAFAREARTEMRKVIWPTRQEALHTTLIVAAVTAVMALILWGLDGVLVRLVSFITGL 109 >gi|220935505|ref|YP_002514404.1| preprotein translocase subunit SecE [Thioalkalivibrio sp. HL-EbGR7] gi|219996815|gb|ACL73417.1| preprotein translocase subunit SecE [Thioalkalivibrio sp. HL-EbGR7] Length = 125 Score = 37.4 bits (85), Expect = 0.70, Method: Compositional matrix adjust. Identities = 16/57 (28%), Positives = 34/57 (59%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F K+ R E +K+ WP+R+E + ++VI+++ + +F ++D + W + +G G Sbjct: 68 GFLKESRTEVRKMVWPTRAEATQTTLIVIVVVILVGIFLWLLDMLLAWGVRMFIGTG 124 >gi|126209180|ref|YP_001054405.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae L20] gi|126097972|gb|ABN74800.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 5b str. L20] Length = 137 Score = 37.4 bits (85), Expect = 0.72, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 31/59 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 77 TAIGFIKEARTELRKIIWPTRPEATQTTLIVLAMCVVVSLVLWGIDSIIVTLVTFLTNL 135 >gi|146297209|ref|YP_001180980.1| preprotein translocase, SecE subunit [Caldicellulosiruptor saccharolyticus DSM 8903] gi|145410785|gb|ABP67789.1| protein translocase subunit secE/sec61 gamma [Caldicellulosiruptor saccharolyticus DSM 8903] Length = 89 Score = 37.4 bits (85), Expect = 0.72, Method: Compositional matrix adjust. Identities = 19/46 (41%), Positives = 27/46 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 + FFK VR E KK+ WPS+ +V+ IVV+ +VF L+ D Sbjct: 29 KTVKFFKDVRIEMKKVVWPSQKQVIKHTIVVLTFTLFFTVFILLAD 74 >gi|271498786|ref|YP_003331811.1| preprotein translocase subunit SecE [Dickeya dadantii Ech586] gi|270342341|gb|ACZ75106.1| preprotein translocase, SecE subunit [Dickeya dadantii Ech586] Length = 127 Score = 37.4 bits (85), Expect = 0.74, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVLFVREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|225850722|ref|YP_002730956.1| preprotein translocase, SecE subunit [Persephonella marina EX-H1] gi|225645496|gb|ACO03682.1| preprotein translocase, SecE subunit [Persephonella marina EX-H1] Length = 62 Score = 37.4 bits (85), Expect = 0.74, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 27/44 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 + F K+VR+E KK+ WPS+ V + I VI+ I SV+ +D Sbjct: 7 IKFLKEVREELKKVTWPSKQLVRTATIAVIVFTLIVSVYLWGLD 50 >gi|307128973|ref|YP_003880989.1| preprotein translocase membrane subunit [Dickeya dadantii 3937] gi|306526502|gb|ADM96432.1| preprotein translocase membrane subunit [Dickeya dadantii 3937] Length = 127 Score = 37.4 bits (85), Expect = 0.74, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVLFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|251791449|ref|YP_003006170.1| preprotein translocase subunit SecE [Dickeya zeae Ech1591] gi|247540070|gb|ACT08691.1| preprotein translocase, SecE subunit [Dickeya zeae Ech1591] Length = 127 Score = 37.4 bits (85), Expect = 0.74, Method: Compositional matrix adjust. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVLFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|117924142|ref|YP_864759.1| protein translocase subunit secE/sec61 gamma [Magnetococcus sp. MC-1] gi|117607898|gb|ABK43353.1| protein translocase subunit secE/sec61 gamma [Magnetococcus sp. MC-1] Length = 63 Score = 37.4 bits (85), Expect = 0.74, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + VR E +K+ WPSR E + + IVV M+ S+F ++D + + I+G Sbjct: 10 YLGDVRSEMRKVVWPSRKETMQTTIVVFGMVVAVSLFLWLVDAILSSTVQAIIG 63 >gi|225849561|ref|YP_002729726.1| preprotein translocase subunit SecE [Sulfurihydrogenibium azorense Az-Fu1] gi|225643578|gb|ACN98628.1| preprotein translocase, SecE subunit [Sulfurihydrogenibium azorense Az-Fu1] Length = 61 Score = 37.4 bits (85), Expect = 0.75, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 31/55 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +NF K+V +E KK+ WPSR V + VI+ I +V+ +D ++ FIL Sbjct: 5 INFLKEVYEELKKVTWPSRELVKTATATVIVFTLIIAVYLWGLDLLFAKIITFIL 59 >gi|206890191|ref|YP_002249162.1| preprotein translocase, SecE subunit [Thermodesulfovibrio yellowstonii DSM 11347] gi|206742129|gb|ACI21186.1| preprotein translocase, SecE subunit [Thermodesulfovibrio yellowstonii DSM 11347] Length = 61 Score = 37.4 bits (85), Expect = 0.75, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 34/55 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF +V+ E+KK+ +P + EV+ S VVI+ + + S F +ID + ++ +G Sbjct: 7 NFFNEVKIEAKKVNYPKKDEVIASTWVVIVTVVLISFFLGLIDLVLSRIISAFIG 61 >gi|188996252|ref|YP_001930503.1| preprotein translocase, SecE subunit [Sulfurihydrogenibium sp. YO3AOP1] gi|188931319|gb|ACD65949.1| preprotein translocase, SecE subunit [Sulfurihydrogenibium sp. YO3AOP1] Length = 61 Score = 37.4 bits (85), Expect = 0.75, Method: Compositional matrix adjust. Identities = 17/44 (38%), Positives = 29/44 (65%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 LNF K+V +E KK+ WPS++ V + I VI++ I +++ +D Sbjct: 5 LNFLKEVFEELKKVTWPSKNLVKTATIAVIVLTLIMALYLWSLD 48 >gi|282875014|ref|ZP_06283889.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis SK135] gi|281296342|gb|EFA88861.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis SK135] gi|319399716|gb|EFV87965.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis FRI909] gi|329729441|gb|EGG65844.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis VCU144] gi|329734655|gb|EGG70962.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis VCU028] gi|329738044|gb|EGG74265.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis VCU045] Length = 61 Score = 37.4 bits (85), Expect = 0.76, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +FFK V+ E +K WP++ E+ I+V+ + VFF +D I L LG Sbjct: 7 SFFKGVKSEMEKTSWPTKEELFKYTIIVVSTVIFFLVFFYALDIGINALKQLFLG 61 >gi|27467216|ref|NP_763853.1| preprotein translocase subunit SecE [Staphylococcus epidermidis ATCC 12228] gi|57866120|ref|YP_187772.1| preprotein translocase subunit SecE [Staphylococcus epidermidis RP62A] gi|242241867|ref|ZP_04796312.1| preprotein translocase subunit SecE [Staphylococcus epidermidis W23144] gi|251809952|ref|ZP_04824425.1| preprotein translocase subunit SecE [Staphylococcus epidermidis BCM-HMP0060] gi|293367911|ref|ZP_06614549.1| preprotein translocase subunit SecE [Staphylococcus epidermidis M23864:W2(grey)] gi|38605281|sp|Q8CQ86|SECE_STAES RecName: Full=Preprotein translocase subunit secE gi|81675391|sp|Q5HRL7|SECE_STAEQ RecName: Full=Preprotein translocase subunit secE gi|27314758|gb|AAO03895.1|AE016744_298 preprotein translocase subunit [Staphylococcus epidermidis ATCC 12228] gi|57636778|gb|AAW53566.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis RP62A] gi|242234645|gb|EES36957.1| preprotein translocase subunit SecE [Staphylococcus epidermidis W23144] gi|251806495|gb|EES59152.1| preprotein translocase subunit SecE [Staphylococcus epidermidis BCM-HMP0060] gi|291317940|gb|EFE58348.1| preprotein translocase subunit SecE [Staphylococcus epidermidis M23864:W2(grey)] Length = 60 Score = 37.4 bits (85), Expect = 0.77, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +FFK V+ E +K WP++ E+ I+V+ + VFF +D I L LG Sbjct: 6 SFFKGVKSEMEKTSWPTKEELFKYTIIVVSTVIFFLVFFYALDIGINALKQLFLG 60 >gi|284034042|ref|YP_003383973.1| preprotein translocase subunit SecE [Kribbella flavida DSM 17836] gi|283813335|gb|ADB35174.1| preprotein translocase, SecE subunit [Kribbella flavida DSM 17836] Length = 80 Score = 37.4 bits (85), Expect = 0.78, Method: Compositional matrix adjust. Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 2/61 (3%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NRL L F++QV E +K+ WP+R ++ +VV+ + F V+D + GW M I Sbjct: 22 NRL--LRFYRQVVAELRKVVWPTRKQLSTYFVVVLTFVVFVIAFVSVLDLAFGWAMFKIF 79 Query: 64 G 64 G Sbjct: 80 G 80 >gi|269793112|ref|YP_003318016.1| preprotein translocase, SecE subunit [Thermanaerovibrio acidaminovorans DSM 6589] gi|269100747|gb|ACZ19734.1| preprotein translocase, SecE subunit [Thermanaerovibrio acidaminovorans DSM 6589] Length = 60 Score = 37.0 bits (84), Expect = 0.78, Method: Compositional matrix adjust. Identities = 15/45 (33%), Positives = 28/45 (62%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 V++F ++ R E KK+ WP+R +V S +VV+ + S + ++D Sbjct: 4 VIDFLREARGELKKVAWPTRQQVWYSTLVVLFVTFAVSAYLGLVD 48 >gi|24115266|ref|NP_709776.1| preprotein translocase subunit SecE [Shigella flexneri 2a str. 301] gi|24054559|gb|AAN45483.1| preprotein translocase [Shigella flexneri 2a str. 301] Length = 127 Score = 37.0 bits (84), Expect = 0.79, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R + L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATIAFAREARTEVRKVIWPTRQKTLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|218438015|ref|YP_002376344.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 7424] gi|218170743|gb|ACK69476.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 7424] Length = 78 Score = 37.0 bits (84), Expect = 0.80, Method: Compositional matrix adjust. Identities = 13/55 (23%), Positives = 31/55 (56%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 N+ + F + ++E +K+ WPSR +++ VI+M+++ + ++D W+ Sbjct: 19 NQFKLTEFANETKEELEKVVWPSRQQLISESAAVILMVTLVATVIYLVDNFFAWI 73 >gi|284928832|ref|YP_003421354.1| protein translocase subunit secE/sec61 gamma [cyanobacterium UCYN-A] gi|284809291|gb|ADB94996.1| protein translocase subunit secE/sec61 gamma [cyanobacterium UCYN-A] Length = 75 Score = 37.0 bits (84), Expect = 0.81, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 27/50 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 V NF R+E KI WPSR ++L VI+M+S+ + ++D W Sbjct: 20 VKNFVIDTREELAKIVWPSRQQLLSESAAVILMVSLVATVIYLVDNFFTW 69 >gi|312135328|ref|YP_004002666.1| preprotein translocase, sece subunit [Caldicellulosiruptor owensensis OL] gi|311775379|gb|ADQ04866.1| preprotein translocase, SecE subunit [Caldicellulosiruptor owensensis OL] Length = 89 Score = 37.0 bits (84), Expect = 0.83, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 27/45 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 L FF+ VR E KK+ WPS+ +V+ +VV+ +VF L+ D Sbjct: 30 TLKFFRDVRIEMKKVVWPSQKQVVKHTVVVLAFTLFFTVFILLAD 74 >gi|254361448|ref|ZP_04977588.1| possible Sec family Type II general secretory pathway preprotein translocase SecE subunit [Mannheimia haemolytica PHL213] gi|261491949|ref|ZP_05988526.1| putative Sec family Type II general secretory pathway preprotein translocase SecE subunit [Mannheimia haemolytica serotype A2 str. BOVINE] gi|261496248|ref|ZP_05992653.1| putative Sec family Type II general secretory pathway preprotein translocase SecE subunit [Mannheimia haemolytica serotype A2 str. OVINE] gi|153092958|gb|EDN73984.1| possible Sec family Type II general secretory pathway preprotein translocase SecE subunit [Mannheimia haemolytica PHL213] gi|261308079|gb|EEY09377.1| putative Sec family Type II general secretory pathway preprotein translocase SecE subunit [Mannheimia haemolytica serotype A2 str. OVINE] gi|261312416|gb|EEY13542.1| putative Sec family Type II general secretory pathway preprotein translocase SecE subunit [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 137 Score = 37.0 bits (84), Expect = 0.84, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 32/58 (55%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 78 AIHFIKESRTELRKIIWPTRPEATQTTLIVLAMCVVVSLVLWGIDSIIVALITFVTSL 135 >gi|315301177|ref|ZP_07872441.1| preprotein translocase, SecE subunit [Listeria ivanovii FSL F6-596] gi|313630447|gb|EFR98316.1| preprotein translocase, SecE subunit [Listeria ivanovii FSL F6-596] Length = 59 Score = 37.0 bits (84), Expect = 0.87, Method: Compositional matrix adjust. Identities = 20/57 (35%), Positives = 34/57 (59%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ FF+ V E K+ WP+R E+L + V+I + + ++FF+ ID I L+ I+ Sbjct: 3 AIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVILFALFFMFIDFGIEQLIKLIM 59 >gi|226328677|ref|ZP_03804195.1| hypothetical protein PROPEN_02572 [Proteus penneri ATCC 35198] gi|225201863|gb|EEG84217.1| hypothetical protein PROPEN_02572 [Proteus penneri ATCC 35198] Length = 125 Score = 37.0 bits (84), Expect = 0.87, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 33/59 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E L + ++V + +I S+ +D + + FI G+ Sbjct: 67 ATLAFAREARIEMRKVVWPTRQETLQTTLIVAAVTAIVSLVLWGLDGILVRFVSFITGL 125 >gi|242241133|ref|YP_002989314.1| preprotein translocase subunit SecE [Dickeya dadantii Ech703] gi|242133190|gb|ACS87492.1| preprotein translocase, SecE subunit [Dickeya dadantii Ech703] Length = 127 Score = 37.0 bits (84), Expect = 0.89, Method: Compositional matrix adjust. Identities = 16/55 (29%), Positives = 32/55 (58%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 71 FAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|118444061|ref|YP_877184.1| preprotein translocase subunit SecE [Clostridium novyi NT] gi|118134517|gb|ABK61561.1| Preprotein translocase secE subunit [Clostridium novyi NT] Length = 73 Score = 37.0 bits (84), Expect = 0.89, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 29/53 (54%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F K+++ E+K+I WP + EV S I+V+ ++S+ ++D L I Sbjct: 19 KFLKELKAETKRITWPPKEEVKKSTIIVLFFCAVSAFIIGLMDSGFNGLYKII 71 >gi|288573183|ref|ZP_06391540.1| preprotein translocase, SecE subunit [Dethiosulfovibrio peptidovorans DSM 11002] gi|288568924|gb|EFC90481.1| preprotein translocase, SecE subunit [Dethiosulfovibrio peptidovorans DSM 11002] Length = 60 Score = 37.0 bits (84), Expect = 0.90, Method: Compositional matrix adjust. Identities = 16/57 (28%), Positives = 33/57 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V F ++ R E KK+ WP + +V S +VVI + + +V+ ++D ++ + ++G Sbjct: 4 VFGFIREARAELKKVTWPGKQQVWYSTLVVIFVTLLVAVYLGIVDMALTGIFSRVIG 60 >gi|269137528|ref|YP_003294228.1| preprotein translocase subunit SecE [Edwardsiella tarda EIB202] gi|267983188|gb|ACY83017.1| preprotein translocase subunit SecE [Edwardsiella tarda EIB202] gi|304557601|gb|ADM40265.1| Preprotein translocase subunit SecE [Edwardsiella tarda FL6-60] Length = 111 Score = 37.0 bits (84), Expect = 0.91, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ ++ +D + L+ FI G+ Sbjct: 51 ATVAFAREARTEMRKVIWPTRQEALHTTLIVAAVTAVMALILWGLDGILVRLVSFITGL 109 >gi|187476521|ref|YP_784545.1| preprotein translocase subunit SecE [Bordetella avium 197N] gi|115421107|emb|CAJ47591.1| preprotein translocase SecE subunit [Bordetella avium 197N] Length = 126 Score = 37.0 bits (84), Expect = 0.91, Method: Compositional matrix adjust. Identities = 13/56 (23%), Positives = 35/56 (62%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++++ ++ +E K++ WP+R E + +V +++ +F V+D+ I W+++ +L Sbjct: 67 LISYAQESYNEVKRVSWPTRKETVQMTGIVFAFVAVMGIFMWVLDKGIEWILYGLL 122 >gi|261378972|ref|ZP_05983545.1| preprotein translocase, SecE subunit [Neisseria cinerea ATCC 14685] gi|269144587|gb|EEZ71005.1| preprotein translocase, SecE subunit [Neisseria cinerea ATCC 14685] Length = 92 Score = 37.0 bits (84), Expect = 0.93, Method: Compositional matrix adjust. Identities = 17/62 (27%), Positives = 31/62 (50%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + R + +F E KK+ WP R + + + VI+ +++ S+F D +I WL Sbjct: 26 NIGREGLFAYFSNSWLEFKKVVWPKREDAVKMTMFVIVFVAVLSIFIYAADTAISWLFFD 85 Query: 62 IL 63 +L Sbjct: 86 VL 87 >gi|215489313|ref|YP_002331744.1| preprotein translocase subunit SecE [Escherichia coli O127:H6 str. E2348/69] gi|215267385|emb|CAS11836.1| preprotein translocase membrane subunit [Escherichia coli O127:H6 str. E2348/69] Length = 127 Score = 37.0 bits (84), Expect = 0.93, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 33/59 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVALAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|146328849|ref|YP_001210164.1| preprotein translocase, SecE subunit [Dichelobacter nodosus VCS1703A] gi|146232319|gb|ABQ13297.1| preprotein translocase, SecE subunit [Dichelobacter nodosus VCS1703A] Length = 123 Score = 37.0 bits (84), Expect = 0.93, Method: Compositional matrix adjust. Identities = 15/51 (29%), Positives = 30/51 (58%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + R E +K+FWP + E L + +V ++ + ++F L +D + WL+ +L Sbjct: 73 RGARIEMRKVFWPGKQEWLRATGMVFAVVIVFAIFLLTVDMLLAWLIRMVL 123 >gi|223041759|ref|ZP_03611952.1| preprotein translocase subunit SecE [Actinobacillus minor 202] gi|240948038|ref|ZP_04752455.1| preprotein translocase subunit SecE [Actinobacillus minor NM305] gi|223017443|gb|EEF15861.1| preprotein translocase subunit SecE [Actinobacillus minor 202] gi|240297654|gb|EER48131.1| preprotein translocase subunit SecE [Actinobacillus minor NM305] Length = 135 Score = 36.6 bits (83), Expect = 1.0, Method: Compositional matrix adjust. Identities = 18/55 (32%), Positives = 30/55 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ Sbjct: 78 AIGFAKESRTELRKIIWPTRPEATQTTLIVLAMCVVVSLVLWGIDSLIVALITFL 132 >gi|239993446|ref|ZP_04713970.1| Preprotein translocase subunit SecE [Alteromonas macleodii ATCC 27126] Length = 125 Score = 36.6 bits (83), Expect = 1.0, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 33/58 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 L+F K+ R E +K+ WP+R E + ++V+ I ++ +D I ++ FI GIG Sbjct: 67 LSFAKESRTEVRKVVWPTRQEANQTTLIVLAATLIMALILWGLDGIIVRVVGFITGIG 124 >gi|298531098|ref|ZP_07018499.1| preprotein translocase, SecE subunit [Desulfonatronospira thiodismutans ASO3-1] gi|298509121|gb|EFI33026.1| preprotein translocase, SecE subunit [Desulfonatronospira thiodismutans ASO3-1] Length = 79 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 13/43 (30%), Positives = 27/43 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 + ++V+ E KK+ WP+R E L + + V+ ++ I S++ + D Sbjct: 25 EYLEEVKGELKKVTWPTRKETLSTALAVVALVIIVSIYLGIAD 67 >gi|209520976|ref|ZP_03269712.1| preprotein translocase, SecE subunit [Burkholderia sp. H160] gi|209498578|gb|EDZ98697.1| preprotein translocase, SecE subunit [Burkholderia sp. H160] Length = 126 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 16/49 (32%), Positives = 27/49 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 + F K E +K+ WP+R E + +VV + + ++F V D+SI W Sbjct: 68 IAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVVVMAIFLWVCDKSIEW 116 >gi|325294361|ref|YP_004280875.1| preprotein translocase, SecE subunit [Desulfurobacterium thermolithotrophum DSM 11699] gi|325064809|gb|ADY72816.1| preprotein translocase, SecE subunit [Desulfurobacterium thermolithotrophum DSM 11699] Length = 60 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 16/58 (27%), Positives = 34/58 (58%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ + F K+VR+E ++ WPS+ EV+ + ++I + +V+F +D L+ I+ Sbjct: 1 MSPITFLKEVREELSRVTWPSKEEVIEATAGIVIFCIVVAVYFWALDFVFSELLKLII 58 >gi|319942158|ref|ZP_08016475.1| preprotein translocase SecE subunit [Sutterella wadsworthensis 3_1_45B] gi|319804293|gb|EFW01182.1| preprotein translocase SecE subunit [Sutterella wadsworthensis 3_1_45B] Length = 127 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 16/55 (29%), Positives = 33/55 (60%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 LN+ +Q +E +++ WP+R E L + +V+ + I + F + D+ I W ++ +L Sbjct: 68 LNYGQQSWEELRRVVWPTRKETLNTTGLVMAFVVIIAFFLFICDKLIEWGLYDVL 122 >gi|224827265|ref|ZP_03700359.1| preprotein translocase, SecE subunit [Lutiella nitroferrum 2002] gi|224600554|gb|EEG06743.1| preprotein translocase, SecE subunit [Lutiella nitroferrum 2002] Length = 117 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 A + + ++ E +K+ WP+R E L +V + + I ++F ++D + WL + +L +G Sbjct: 57 AFVGYAQESVAEGRKVVWPTRKEALQMTGLVFVFVLILALFMWLVDSGLSWLFYDVL-LG 115 Query: 67 R 67 R Sbjct: 116 R 116 >gi|212709020|ref|ZP_03317148.1| hypothetical protein PROVALCAL_00052 [Providencia alcalifaciens DSM 30120] gi|212688309|gb|EEB47837.1| hypothetical protein PROVALCAL_00052 [Providencia alcalifaciens DSM 30120] Length = 128 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 32/56 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A L F ++ R E KK+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 67 ATLAFAREARIEVKKVIWPTRQEALQTTLIVAAVTAVMSLILWGLDGILVRLVSFI 122 >gi|256545059|ref|ZP_05472426.1| preprotein translocase, SecE subunit [Anaerococcus vaginalis ATCC 51170] gi|256399262|gb|EEU12872.1| preprotein translocase, SecE subunit [Anaerococcus vaginalis ATCC 51170] Length = 60 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 33/53 (62%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK V E KKI WP+++E L ++VII+ I+ + ++D G ++ F++ Sbjct: 8 FFKSVSREFKKITWPTKNETLNYSLLVIIVSVITGLLIWLLDIVFGNMLGFLM 60 >gi|116871628|ref|YP_848409.1| preprotein translocase subunit SecE [Listeria welshimeri serovar 6b str. SLCC5334] gi|116740506|emb|CAK19626.1| preprotein translocase, SecE subunit [Listeria welshimeri serovar 6b str. SLCC5334] Length = 59 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 35/57 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ FF+ V E K+ WP+R E+L + V+I + + ++FF++ID I ++ I+ Sbjct: 3 AIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVILFALFFMLIDFGIEQIIKLIM 59 >gi|323141143|ref|ZP_08076046.1| preprotein translocase, SecE subunit [Phascolarctobacterium sp. YIT 12067] gi|322414409|gb|EFY05225.1| preprotein translocase, SecE subunit [Phascolarctobacterium sp. YIT 12067] Length = 72 Score = 36.6 bits (83), Expect = 1.1, Method: Compositional matrix adjust. Identities = 17/57 (29%), Positives = 31/57 (54%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ F + + E KK+ WP++ E++ + IVVII + + + +ID L IL Sbjct: 15 SITTFLSETKVELKKVTWPTKQELIANTIVVIIAVVLCAALIWIIDSIFSMLFRMIL 71 >gi|194337667|ref|YP_002019461.1| preprotein translocase, SecE subunit [Pelodictyon phaeoclathratiforme BU-1] gi|194310144|gb|ACF44844.1| preprotein translocase, SecE subunit [Pelodictyon phaeoclathratiforme BU-1] Length = 63 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 16/55 (29%), Positives = 34/55 (61%), Gaps = 4/55 (7%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +++ V E +K+ WPS+ E+ IVV+ + I ++F ++D W+++F++G Sbjct: 10 QYYRDVISEMRKVIWPSKEEIKDLTIVVLTVSGILALFTFLVD----WVINFVMG 60 >gi|317495155|ref|ZP_07953525.1| preprotein translocase [Gemella moribillum M424] gi|316914577|gb|EFV36053.1| preprotein translocase [Gemella moribillum M424] Length = 57 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI-GWLMHF 61 L FFK+V E KK+ WP+ +E++ ++VI+++ I +F V+D I + HF Sbjct: 2 LRFFKKVVSEMKKVSWPTFNELVRKTLIVIVVVGILMLFSYVVDLGITAGIRHF 55 >gi|150392174|ref|YP_001322223.1| preprotein translocase, SecE subunit [Alkaliphilus metalliredigens QYMF] gi|149952036|gb|ABR50564.1| preprotein translocase, SecE subunit [Alkaliphilus metalliredigens QYMF] Length = 71 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 31/53 (58%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F + VR E KK+ WP+R+E+ VVII ++ V ++D G+ ++ ++ Sbjct: 19 FLRGVRSELKKVNWPNRAEIKNHTGVVIIATLMAVVLLWILDSVFGFGLNLLI 71 >gi|237654009|ref|YP_002890323.1| preprotein translocase subunit SecE [Thauera sp. MZ1T] gi|237625256|gb|ACR01946.1| preprotein translocase, SecE subunit [Thauera sp. MZ1T] Length = 115 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 14/52 (26%), Positives = 30/52 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + F ++ E+KK+ WPSR E + +V + ++F + D+S+ W+++ Sbjct: 57 IGFARESITETKKVVWPSRKETTQTTGLVFAFAVVMALFLWLTDKSLEWVLY 108 >gi|37524442|ref|NP_927786.1| preprotein translocase subunit SecE [Photorhabdus luminescens subsp. laumondii TTO1] gi|36783866|emb|CAE12728.1| Preprotein translocase SecE subunit [Photorhabdus luminescens subsp. laumondii TTO1] Length = 127 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 17/58 (29%), Positives = 33/58 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 68 TLAFAREARIEMRKVIWPTRQEALHTTLIVAAVTALMSLILWGLDGILVRLVSFITGL 125 >gi|59802178|ref|YP_208890.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae FA 1090] gi|239997907|ref|ZP_04717831.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae 35/02] gi|240015114|ref|ZP_04722027.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae DGI18] gi|240017563|ref|ZP_04724103.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae FA6140] gi|240081706|ref|ZP_04726249.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae FA19] gi|240113982|ref|ZP_04728472.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae MS11] gi|240116718|ref|ZP_04730780.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID18] gi|240118940|ref|ZP_04733002.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID1] gi|240122185|ref|ZP_04735147.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID24-1] gi|240124478|ref|ZP_04737434.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID332] gi|240124654|ref|ZP_04737540.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae SK-92-679] gi|254494739|ref|ZP_05107910.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae 1291] gi|260439523|ref|ZP_05793339.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae DGI2] gi|268593757|ref|ZP_06127924.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae 35/02] gi|268597804|ref|ZP_06131971.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae FA19] gi|268600047|ref|ZP_06134214.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae MS11] gi|268602389|ref|ZP_06136556.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID18] gi|268604651|ref|ZP_06138818.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID1] gi|268683109|ref|ZP_06149971.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID332] gi|268683228|ref|ZP_06150090.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae SK-92-679] gi|291042758|ref|ZP_06568499.1| preprotein translocase subunit secE [Neisseria gonorrhoeae DGI2] gi|293398221|ref|ZP_06642426.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae F62] gi|59719073|gb|AAW90478.1| putative preprotein translocase SecE subunit [Neisseria gonorrhoeae FA 1090] gi|226513779|gb|EEH63124.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae 1291] gi|268547146|gb|EEZ42564.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae 35/02] gi|268551592|gb|EEZ46611.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae FA19] gi|268584178|gb|EEZ48854.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae MS11] gi|268586520|gb|EEZ51196.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID18] gi|268588782|gb|EEZ53458.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID1] gi|268623393|gb|EEZ55793.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID332] gi|268623512|gb|EEZ55912.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae SK-92-679] gi|291013192|gb|EFE05158.1| preprotein translocase subunit secE [Neisseria gonorrhoeae DGI2] gi|291611484|gb|EFF40554.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae F62] Length = 92 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +F E KK+ WP R + + + VI+ +++ S+F D +I WL +L Sbjct: 35 YFSNSWSEFKKVVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAISWLFFDVL 87 >gi|323705647|ref|ZP_08117221.1| preprotein translocase, SecE subunit [Thermoanaerobacterium xylanolyticum LX-11] gi|323535124|gb|EGB24901.1| preprotein translocase, SecE subunit [Thermoanaerobacterium xylanolyticum LX-11] Length = 66 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 15/60 (25%), Positives = 34/60 (56%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R V FF++++ E KK+ WP+R ++ VV++++ ++ + D + +L+ I+ Sbjct: 5 ERRKVGKFFREIKAEMKKVTWPTRDNLIAYTEVVLVVVIAFTLLIFLADSAFSYLLKLII 64 >gi|253987826|ref|YP_003039182.1| preprotein translocase subunit SecE [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] gi|253779276|emb|CAQ82437.1| inner membrane preprotein translocase [Photorhabdus asymbiotica] Length = 127 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 17/58 (29%), Positives = 33/58 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 68 TLAFAREARIEMRKVIWPTRQEALHTTLIVAAVTALMSLILWGLDGILVRLVSFITGL 125 >gi|261344395|ref|ZP_05972039.1| preprotein translocase, SecE subunit [Providencia rustigianii DSM 4541] gi|282567668|gb|EFB73203.1| preprotein translocase, SecE subunit [Providencia rustigianii DSM 4541] Length = 128 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 32/56 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A L F ++ R E KK+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 67 ATLAFAREARIEVKKVIWPTRQEALQTTLIVAAVTAVMSLILWGLDGILVRLVSFI 122 >gi|227552593|ref|ZP_03982642.1| preprotein translocase, SecE subunit [Enterococcus faecium TX1330] gi|257888178|ref|ZP_05667831.1| preprotein translocase [Enterococcus faecium 1,141,733] gi|257896931|ref|ZP_05676584.1| preprotein translocase [Enterococcus faecium Com12] gi|257899608|ref|ZP_05679261.1| preprotein translocase [Enterococcus faecium Com15] gi|293379126|ref|ZP_06625277.1| preprotein translocase, SecE subunit [Enterococcus faecium PC4.1] gi|293571553|ref|ZP_06682575.1| preprotein translocase, SecE subunit [Enterococcus faecium E980] gi|227178219|gb|EEI59191.1| preprotein translocase, SecE subunit [Enterococcus faecium TX1330] gi|257824232|gb|EEV51164.1| preprotein translocase [Enterococcus faecium 1,141,733] gi|257833496|gb|EEV59917.1| preprotein translocase [Enterococcus faecium Com12] gi|257837520|gb|EEV62594.1| preprotein translocase [Enterococcus faecium Com15] gi|291608359|gb|EFF37659.1| preprotein translocase, SecE subunit [Enterococcus faecium E980] gi|292642267|gb|EFF60426.1| preprotein translocase, SecE subunit [Enterococcus faecium PC4.1] Length = 56 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 4/56 (7%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI----GWLMH 60 + F K V+DE K++ WP+R ++ +VVI + + F V+D +I GW++ Sbjct: 1 MKFLKSVKDEIKQVTWPNRKQLRKDTLVVIETSILFGLMFYVMDTAIQSLFGWILK 56 >gi|261401759|ref|ZP_05987884.1| preprotein translocase, SecE subunit [Neisseria lactamica ATCC 23970] gi|313667420|ref|YP_004047704.1| preprotein translocase SecE subunit [Neisseria lactamica ST-640] gi|269208097|gb|EEZ74552.1| preprotein translocase, SecE subunit [Neisseria lactamica ATCC 23970] gi|313004882|emb|CBN86308.1| putative preprotein translocase SecE subunit [Neisseria lactamica 020-06] Length = 92 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +F E KK+ WP R + + + VI+ +++ S+F D +I WL +L Sbjct: 35 YFSNSWSEFKKVVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAISWLFFDVL 87 >gi|15676053|ref|NP_273183.1| preprotein translocase subunit SecE [Neisseria meningitidis MC58] gi|121634003|ref|YP_974248.1| preprotein translocase subunit SecE [Neisseria meningitidis FAM18] gi|161870929|ref|YP_001600109.1| preprotein translocase subunit SecE [Neisseria meningitidis 053442] gi|254805829|ref|YP_003084050.1| putative preprotein translocase SecE subunit [Neisseria meningitidis alpha14] gi|304388926|ref|ZP_07370973.1| preprotein translocase [Neisseria meningitidis ATCC 13091] gi|7225342|gb|AAF40584.1| preprotein translocase SecE subunit [Neisseria meningitidis MC58] gi|120865709|emb|CAM09436.1| putative preprotein translocase SecE subunit [Neisseria meningitidis FAM18] gi|161596482|gb|ABX74142.1| preprotein translocase SECE subunit [Neisseria meningitidis 053442] gi|254669371|emb|CBA08490.1| putative preprotein translocase SecE subunit [Neisseria meningitidis alpha14] gi|261391663|emb|CAX49111.1| preprotein translocase SecE subunit [Neisseria meningitidis 8013] gi|304337060|gb|EFM03247.1| preprotein translocase [Neisseria meningitidis ATCC 13091] gi|308388343|gb|ADO30663.1| preprotein translocase subunit SecE [Neisseria meningitidis alpha710] gi|325127119|gb|EGC50073.1| preprotein translocase, SecE subunit [Neisseria meningitidis N1568] gi|325131100|gb|EGC53822.1| preprotein translocase, SecE subunit [Neisseria meningitidis OX99.30304] gi|325133039|gb|EGC55711.1| preprotein translocase, SecE subunit [Neisseria meningitidis M6190] gi|325135131|gb|EGC57757.1| preprotein translocase, SecE subunit [Neisseria meningitidis M13399] gi|325137184|gb|EGC59779.1| preprotein translocase, SecE subunit [Neisseria meningitidis M0579] gi|325139018|gb|EGC61564.1| preprotein translocase, SecE subunit [Neisseria meningitidis ES14902] gi|325141140|gb|EGC63640.1| preprotein translocase, SecE subunit [Neisseria meningitidis CU385] gi|325145323|gb|EGC67600.1| preprotein translocase, SecE subunit [Neisseria meningitidis M01-240013] gi|325197414|gb|ADY92870.1| preprotein translocase, SecE subunit [Neisseria meningitidis G2136] gi|325199339|gb|ADY94794.1| preprotein translocase, SecE subunit [Neisseria meningitidis H44/76] gi|325203040|gb|ADY98494.1| preprotein translocase, SecE subunit [Neisseria meningitidis M01-240149] gi|325203245|gb|ADY98698.1| preprotein translocase, SecE subunit [Neisseria meningitidis M01-240355] gi|325205218|gb|ADZ00671.1| preprotein translocase, SecE subunit [Neisseria meningitidis M04-240196] Length = 92 Score = 36.6 bits (83), Expect = 1.3, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +F E KK+ WP R + + + VI+ +++ S+F D +I WL +L Sbjct: 35 YFSNSWSEFKKVVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAISWLFFDVL 87 >gi|126659913|ref|ZP_01731037.1| SecE subunit of protein translocation complex [Cyanothece sp. CCY0110] gi|172035144|ref|YP_001801645.1| preprotein translocase subunit SecE [Cyanothece sp. ATCC 51142] gi|126618777|gb|EAZ89522.1| SecE subunit of protein translocation complex [Cyanothece sp. CCY0110] gi|171696598|gb|ACB49579.1| preprotein translocase SecE subunit [Cyanothece sp. ATCC 51142] Length = 75 Score = 36.2 bits (82), Expect = 1.3, Method: Compositional matrix adjust. Identities = 15/48 (31%), Positives = 27/48 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 NF + ++E K+ WPSR ++L VI+M+S+ + ++D W Sbjct: 22 NFVVETKEELAKVVWPSRQQLLSESAAVILMVSLVATVIYLVDNLFSW 69 >gi|240129152|ref|ZP_04741813.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae SK-93-1035] gi|268687536|ref|ZP_06154398.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae SK-93-1035] gi|268627820|gb|EEZ60220.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae SK-93-1035] Length = 92 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +F E KK+ WP R + + + VI+ +++ S+F D +I WL +L Sbjct: 35 YFSNSWSEFKKVVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAISWLFFDVL 87 >gi|46143567|ref|ZP_00204513.1| COG0690: Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 1 str. 4074] Length = 89 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 31/59 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 29 TAIGFIKESRTELRKIIWPTRPEATQTTLIVLAMCVVVSLVLWGIDSIIVTLVTFLTNL 87 >gi|312882840|ref|ZP_07742573.1| preprotein translocase subunit SecE [Vibrio caribbenthicus ATCC BAA-2122] gi|309369532|gb|EFP97051.1| preprotein translocase subunit SecE [Vibrio caribbenthicus ATCC BAA-2122] Length = 141 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 15/59 (25%), Positives = 35/59 (59%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F K+ R E +K+ WP+R E + + ++V+ + + ++ ID + +++F+ G+ Sbjct: 83 AAIEFAKESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALILYGIDSIMYHIVNFVTGV 141 >gi|165977152|ref|YP_001652745.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|303249958|ref|ZP_07336160.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|307246642|ref|ZP_07528713.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|307253388|ref|ZP_07535259.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|307255627|ref|ZP_07537432.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|307260078|ref|ZP_07541790.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|165877253|gb|ABY70301.1| preprotein translocase SecE subunit [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|302651021|gb|EFL81175.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306852514|gb|EFM84748.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|306859067|gb|EFM91109.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306861476|gb|EFM93465.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|306865914|gb|EFM97790.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 11 str. 56153] Length = 137 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 31/59 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 77 TAIGFIKESRTELRKIIWPTRPEATQTTLIVLAMCVVVSLVLWGIDSIIVTLVTFLTNL 135 >gi|253682129|ref|ZP_04862926.1| preprotein translocase, SecE subunit [Clostridium botulinum D str. 1873] gi|331268399|ref|YP_004394891.1| Preprotein translocase secE subunit [Clostridium botulinum BKT015925] gi|253561841|gb|EES91293.1| preprotein translocase, SecE subunit [Clostridium botulinum D str. 1873] gi|329124949|gb|AEB74894.1| Preprotein translocase secE subunit [Clostridium botulinum BKT015925] Length = 73 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 14/56 (25%), Positives = 31/56 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F K+++ E+K+I WP + + S I+V+ ++S++ ++D L I Sbjct: 16 GIVKFLKELKAETKRITWPPKEQTKKSTIIVLFFCAVSAIIIGLMDSGFSSLYKII 71 >gi|190151045|ref|YP_001969570.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|303253130|ref|ZP_07339279.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|307248769|ref|ZP_07530782.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|307251012|ref|ZP_07532937.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|307257803|ref|ZP_07539560.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|307262207|ref|ZP_07543857.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|307264408|ref|ZP_07545994.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 13 str. N273] gi|189916176|gb|ACE62428.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|302647812|gb|EFL78019.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|306854696|gb|EFM86886.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|306856952|gb|EFM89083.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|306863709|gb|EFM95635.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|306868081|gb|EFM99907.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|306870224|gb|EFN01982.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 13 str. N273] Length = 137 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 31/59 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 77 TAIGFIKESRTELRKIIWPTRPEATQTTLIVLAMCVVVSLVLWGIDSIIVTLVTFLTNL 135 >gi|307152581|ref|YP_003887965.1| preprotein translocase subunit SecE [Cyanothece sp. PCC 7822] gi|306982809|gb|ADN14690.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 7822] Length = 78 Score = 36.2 bits (82), Expect = 1.4, Method: Compositional matrix adjust. Identities = 13/56 (23%), Positives = 30/56 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 + + F K+ ++E K+ WPSR +++ VI+M+++ + ++D W+ Sbjct: 18 TQKFQLTEFTKETKEELGKVVWPSRQQLISESAAVILMVTLVATIIYLVDNFFAWV 73 >gi|313620926|gb|EFR92100.1| preprotein translocase, SecE subunit [Listeria innocua FSL S4-378] Length = 51 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 17/46 (36%), Positives = 30/46 (65%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 A+ FF+ V E K+ WP+R E+L + V+I + + ++FF++ID Sbjct: 3 AIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVILFALFFMLID 48 >gi|313887244|ref|ZP_07820938.1| preprotein translocase, SecE subunit [Porphyromonas asaccharolytica PR426713P-I] gi|312923297|gb|EFR34112.1| preprotein translocase, SecE subunit [Porphyromonas asaccharolytica PR426713P-I] gi|332177001|gb|AEE12691.1| preprotein translocase, SecE subunit [Porphyromonas asaccharolytica DSM 20707] Length = 66 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 8/65 (12%) Query: 9 LNFFKQVRDESK--------KIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 +NFFK++ +K K+ WP+RSE++ S +VV+I I ++F +D LM Sbjct: 1 MNFFKRIGTYTKNCYNELVHKVSWPTRSELINSTVVVMIASVIIAIFVAGVDFIFQQLMQ 60 Query: 61 FILGI 65 + G+ Sbjct: 61 LVYGL 65 >gi|254412608|ref|ZP_05026381.1| preprotein translocase, SecE subunit [Microcoleus chthonoplastes PCC 7420] gi|196180343|gb|EDX75334.1| preprotein translocase, SecE subunit [Microcoleus chthonoplastes PCC 7420] Length = 76 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 14/57 (24%), Positives = 31/57 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V+ F ++ ++E K+ WPSR +++ V++M+ +S+ ++D W + G Sbjct: 20 VVTFLQETKEELSKVVWPSRQQLISESAAVLLMVVLSATLIYLVDGLFLWASQQVFG 76 >gi|148244884|ref|YP_001219578.1| preprotein translocase SecE subunit [Candidatus Vesicomyosocius okutanii HA] gi|146326711|dbj|BAF61854.1| preprotein translocase SecE subunit [Candidatus Vesicomyosocius okutanii HA] Length = 123 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 13/53 (24%), Positives = 32/53 (60%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +F + + E +K+ WP+R E + + ++++ + I ++F +ID W++H + Sbjct: 69 SFLIETKIELRKVVWPTRDETIKTTGMIMVAVVIVAIFLWIIDALFSWMVHLL 121 >gi|315639709|ref|ZP_07894848.1| preprotein translocase subunit SecE [Enterococcus italicus DSM 15952] gi|315484486|gb|EFU74943.1| preprotein translocase subunit SecE [Enterococcus italicus DSM 15952] Length = 56 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 31/55 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F + VR+E KK+ WPS ++ +VVI I +V F ++D I L +IL Sbjct: 1 MKFIRSVREEMKKVTWPSGKQLRKDTLVVIETSLIFAVLFFLMDTGIQQLFAWIL 55 >gi|16802291|ref|NP_463776.1| preprotein translocase subunit SecE [Listeria monocytogenes EGD-e] gi|224498909|ref|ZP_03667258.1| preprotein translocase subunit SecE [Listeria monocytogenes Finland 1988] gi|224502461|ref|ZP_03670768.1| preprotein translocase subunit SecE [Listeria monocytogenes FSL R2-561] gi|254825711|ref|ZP_05230712.1| predicted protein [Listeria monocytogenes FSL J1-194] gi|254828705|ref|ZP_05233392.1| predicted protein [Listeria monocytogenes FSL N3-165] gi|254831930|ref|ZP_05236585.1| preprotein translocase subunit SecE [Listeria monocytogenes 10403S] gi|254853488|ref|ZP_05242836.1| predicted protein [Listeria monocytogenes FSL R2-503] gi|255026644|ref|ZP_05298630.1| preprotein translocase subunit SecE [Listeria monocytogenes FSL J2-003] gi|255030087|ref|ZP_05302038.1| preprotein translocase subunit SecE [Listeria monocytogenes LO28] gi|255520311|ref|ZP_05387548.1| preprotein translocase subunit SecE [Listeria monocytogenes FSL J1-175] gi|284800539|ref|YP_003412404.1| preprotein translocase subunit SecE [Listeria monocytogenes 08-5578] gi|284993725|ref|YP_003415493.1| preprotein translocase subunit SecE [Listeria monocytogenes 08-5923] gi|300764630|ref|ZP_07074622.1| preprotein translocase, SecE subunit [Listeria monocytogenes FSL N1-017] gi|16409610|emb|CAD00772.1| secE [Listeria monocytogenes EGD-e] gi|258601110|gb|EEW14435.1| predicted protein [Listeria monocytogenes FSL N3-165] gi|258606860|gb|EEW19468.1| predicted protein [Listeria monocytogenes FSL R2-503] gi|284056101|gb|ADB67042.1| preprotein translocase subunit SecE [Listeria monocytogenes 08-5578] gi|284059192|gb|ADB70131.1| preprotein translocase subunit SecE [Listeria monocytogenes 08-5923] gi|293594955|gb|EFG02716.1| predicted protein [Listeria monocytogenes FSL J1-194] gi|300514737|gb|EFK41792.1| preprotein translocase, SecE subunit [Listeria monocytogenes FSL N1-017] Length = 59 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 17/46 (36%), Positives = 30/46 (65%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 A+ FF+ V E K+ WP+R E+L + V+I + + ++FF++ID Sbjct: 3 AIAKFFRNVSSEMHKVTWPTRKELLTYTVTVVITVVLFALFFMLID 48 >gi|295677946|ref|YP_003606470.1| preprotein translocase, SecE subunit [Burkholderia sp. CCGE1002] gi|295437789|gb|ADG16959.1| preprotein translocase, SecE subunit [Burkholderia sp. CCGE1002] Length = 111 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 16/49 (32%), Positives = 27/49 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 + F K E +K+ WP+R E + +VV + + ++F V D+SI W Sbjct: 53 IAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVVVMAIFLWVCDKSIEW 101 >gi|15923524|ref|NP_371058.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus Mu50] gi|15926212|ref|NP_373745.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus N315] gi|21282219|ref|NP_645307.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus MW2] gi|49482765|ref|YP_039989.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus MRSA252] gi|49485400|ref|YP_042621.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus MSSA476] gi|82750243|ref|YP_415984.1| preprotein translocase subunit SecE [Staphylococcus aureus RF122] gi|148266995|ref|YP_001245938.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus JH9] gi|150393042|ref|YP_001315717.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus JH1] gi|156978863|ref|YP_001441122.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus Mu3] gi|161353533|ref|YP_499089.2| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus NCTC 8325] gi|253315645|ref|ZP_04838858.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus str. CF-Marseille] gi|253731140|ref|ZP_04865305.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus USA300_TCH959] gi|253732543|ref|ZP_04866708.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus TCH130] gi|255005329|ref|ZP_05143930.2| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus Mu50-omega] gi|257424649|ref|ZP_05601076.1| preprotein translocase subunit secE [Staphylococcus aureus subsp. aureus 55/2053] gi|257427317|ref|ZP_05603716.1| preprotein translocase subunit secE [Staphylococcus aureus subsp. aureus 65-1322] gi|257429953|ref|ZP_05606337.1| translocase subunit SecE [Staphylococcus aureus subsp. aureus 68-397] gi|257432655|ref|ZP_05609015.1| translocase subunit secE [Staphylococcus aureus subsp. aureus E1410] gi|257435559|ref|ZP_05611607.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus M876] gi|258439336|ref|ZP_05690268.1| translocase subunit secE [Staphylococcus aureus A9299] gi|258444076|ref|ZP_05692413.1| translocase subunit secE [Staphylococcus aureus A8115] gi|258446344|ref|ZP_05694502.1| preprotein translocase subunit secE [Staphylococcus aureus A6300] gi|258448437|ref|ZP_05696552.1| preprotein translocase, SecE subunit [Staphylococcus aureus A6224] gi|258453793|ref|ZP_05701767.1| preprotein translocase, SecE subunit [Staphylococcus aureus A5937] gi|269202158|ref|YP_003281427.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus ED98] gi|282894970|ref|ZP_06303193.1| preprotein translocase, SecE subunit [Staphylococcus aureus A8117] gi|282903123|ref|ZP_06311014.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus C160] gi|282904913|ref|ZP_06312771.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus Btn1260] gi|282913368|ref|ZP_06321157.1| conserved domain protein [Staphylococcus aureus subsp. aureus M899] gi|282915858|ref|ZP_06323623.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus D139] gi|282918323|ref|ZP_06326060.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus C427] gi|282923285|ref|ZP_06330965.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus C101] gi|282928872|ref|ZP_06336463.1| preprotein translocase, SecE subunit [Staphylococcus aureus A10102] gi|283769691|ref|ZP_06342583.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus H19] gi|283957333|ref|ZP_06374786.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus A017934/97] gi|293500414|ref|ZP_06666265.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus 58-424] gi|293509359|ref|ZP_06668070.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus M809] gi|293523946|ref|ZP_06670633.1| conserved domain protein [Staphylococcus aureus subsp. aureus M1015] gi|295406912|ref|ZP_06816715.1| preprotein translocase [Staphylococcus aureus A8819] gi|295427073|ref|ZP_06819709.1| preprotein translocase [Staphylococcus aureus subsp. aureus EMRSA16] gi|296275781|ref|ZP_06858288.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus MR1] gi|297208751|ref|ZP_06925179.1| preprotein translocase [Staphylococcus aureus subsp. aureus ATCC 51811] gi|297246264|ref|ZP_06930113.1| preprotein translocase [Staphylococcus aureus A8796] gi|297590574|ref|ZP_06949213.1| preprotein translocase [Staphylococcus aureus subsp. aureus MN8] gi|300912841|ref|ZP_07130283.1| preprotein translocase [Staphylococcus aureus subsp. aureus TCH70] gi|60390819|sp|Q6GBV2|SECE_STAAS RecName: Full=Preprotein translocase subunit secE gi|60390826|sp|Q6GJD3|SECE_STAAR RecName: Full=Preprotein translocase subunit secE gi|60409398|sp|P0A0I1|SECE_STAAM RecName: Full=Preprotein translocase subunit secE gi|60409401|sp|P0A0I2|SECE_STAAN RecName: Full=Preprotein translocase subunit secE gi|60409405|sp|P0A0I3|SECE_STAAW RecName: Full=Preprotein translocase subunit secE gi|60409408|sp|P0A0I4|SECE_STAA8 RecName: Full=Preprotein translocase subunit secE gi|2078376|gb|AAB54017.1| SecE [Staphylococcus aureus] gi|13700425|dbj|BAB41723.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus N315] gi|14246302|dbj|BAB56696.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus Mu50] gi|21203655|dbj|BAB94355.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus MW2] gi|49240894|emb|CAG39561.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus MRSA252] gi|49243843|emb|CAG42268.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus MSSA476] gi|82655774|emb|CAI80174.1| preprotein translocase subunit [Staphylococcus aureus RF122] gi|147740064|gb|ABQ48362.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus JH9] gi|149945494|gb|ABR51430.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus JH1] gi|156720998|dbj|BAF77415.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus Mu3] gi|253725105|gb|EES93834.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus USA300_TCH959] gi|253729472|gb|EES98201.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus TCH130] gi|257272219|gb|EEV04342.1| preprotein translocase subunit secE [Staphylococcus aureus subsp. aureus 55/2053] gi|257275510|gb|EEV06983.1| preprotein translocase subunit secE [Staphylococcus aureus subsp. aureus 65-1322] gi|257279150|gb|EEV09751.1| translocase subunit SecE [Staphylococcus aureus subsp. aureus 68-397] gi|257282070|gb|EEV12205.1| translocase subunit secE [Staphylococcus aureus subsp. aureus E1410] gi|257284750|gb|EEV14869.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus M876] gi|257847673|gb|EEV71672.1| translocase subunit secE [Staphylococcus aureus A9299] gi|257850746|gb|EEV74691.1| translocase subunit secE [Staphylococcus aureus A8115] gi|257854938|gb|EEV77883.1| preprotein translocase subunit secE [Staphylococcus aureus A6300] gi|257858306|gb|EEV81193.1| preprotein translocase, SecE subunit [Staphylococcus aureus A6224] gi|257864049|gb|EEV86803.1| preprotein translocase, SecE subunit [Staphylococcus aureus A5937] gi|262074448|gb|ACY10421.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus ED98] gi|282314153|gb|EFB44543.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus C101] gi|282317457|gb|EFB47829.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus C427] gi|282320154|gb|EFB50499.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus D139] gi|282322400|gb|EFB52722.1| conserved domain protein [Staphylococcus aureus subsp. aureus M899] gi|282331738|gb|EFB61249.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus Btn1260] gi|282589480|gb|EFB94569.1| preprotein translocase, SecE subunit [Staphylococcus aureus A10102] gi|282596078|gb|EFC01039.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus C160] gi|282762652|gb|EFC02789.1| preprotein translocase, SecE subunit [Staphylococcus aureus A8117] gi|283459838|gb|EFC06928.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus H19] gi|283469827|emb|CAQ49038.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus ST398] gi|283790784|gb|EFC29599.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus A017934/97] gi|285816235|gb|ADC36722.1| Preprotein translocase subunit SecE [Staphylococcus aureus 04-02981] gi|290920909|gb|EFD97970.1| conserved domain protein [Staphylococcus aureus subsp. aureus M1015] gi|291095419|gb|EFE25680.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus 58-424] gi|291467456|gb|EFF09971.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus M809] gi|294968143|gb|EFG44169.1| preprotein translocase [Staphylococcus aureus A8819] gi|295128861|gb|EFG58491.1| preprotein translocase [Staphylococcus aureus subsp. aureus EMRSA16] gi|296886696|gb|EFH25601.1| preprotein translocase [Staphylococcus aureus subsp. aureus ATCC 51811] gi|297176862|gb|EFH36120.1| preprotein translocase [Staphylococcus aureus A8796] gi|297576873|gb|EFH95588.1| preprotein translocase [Staphylococcus aureus subsp. aureus MN8] gi|298693866|gb|ADI97088.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus ED133] gi|300885945|gb|EFK81148.1| preprotein translocase [Staphylococcus aureus subsp. aureus TCH70] gi|302332248|gb|ADL22441.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus JKD6159] gi|312439045|gb|ADQ78116.1| preprotein translocase [Staphylococcus aureus subsp. aureus TCH60] gi|312829031|emb|CBX33873.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus ECT-R 2] gi|315128828|gb|EFT84827.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus CGS03] gi|315193899|gb|EFU24293.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus CGS00] gi|329727923|gb|EGG64372.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus 21172] gi|329731028|gb|EGG67401.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus 21189] gi|329731958|gb|EGG68314.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus 21193] Length = 60 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 30/55 (54%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +FFK V+ E +K WP++ E+ ++V+ + VFF +D I L + + G Sbjct: 6 SFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFG 60 >gi|186477602|ref|YP_001859072.1| preprotein translocase subunit SecE [Burkholderia phymatum STM815] gi|184194061|gb|ACC72026.1| preprotein translocase, SecE subunit [Burkholderia phymatum STM815] Length = 126 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 27/49 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 + F K E +K+ WP+R E + +VV + I +VF + D+SI W Sbjct: 68 IAFAKDSYKEVRKVVWPTRKEASQTTLVVFGFVLIMAVFLWICDKSIEW 116 >gi|317133007|ref|YP_004092321.1| preprotein translocase, SecE subunit [Ethanoligenens harbinense YUAN-3] gi|315470986|gb|ADU27590.1| preprotein translocase, SecE subunit [Ethanoligenens harbinense YUAN-3] Length = 91 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 14/42 (33%), Positives = 25/42 (59%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 F + R E KKI WP+R +V + IVV++ +++ + +D Sbjct: 38 FLSETRAEFKKIIWPTRRQVTSNTIVVLVTIAVIGAVVMALD 79 >gi|304405634|ref|ZP_07387293.1| preprotein translocase, SecE subunit [Paenibacillus curdlanolyticus YK9] gi|304345673|gb|EFM11508.1| preprotein translocase, SecE subunit [Paenibacillus curdlanolyticus YK9] Length = 69 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +FF E KK+ WPSR E+ IVV++ + + +++F V+D I L+ ++ Sbjct: 13 TTFSFFADSWAELKKVRWPSRKELTSYTIVVLVTIILVTIYFWVLDIGISELVELVV 69 >gi|16799354|ref|NP_469622.1| preprotein translocase subunit SecE [Listeria innocua Clip11262] gi|16412706|emb|CAC95510.1| secE [Listeria innocua Clip11262] gi|313625358|gb|EFR95150.1| preprotein translocase, SecE subunit [Listeria innocua FSL J1-023] Length = 59 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 17/46 (36%), Positives = 30/46 (65%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 A+ FF+ V E K+ WP+R E+L + V+I + + ++FF++ID Sbjct: 3 AIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVILFALFFMLID 48 >gi|46906478|ref|YP_012867.1| preprotein translocase subunit SecE [Listeria monocytogenes str. 4b F2365] gi|47094613|ref|ZP_00232253.1| preprotein translocase, SecE subunit [Listeria monocytogenes str. 4b H7858] gi|217965668|ref|YP_002351346.1| preprotein translocase, SecE subunit [Listeria monocytogenes HCC23] gi|226222873|ref|YP_002756980.1| preprotein translocase subunit [Listeria monocytogenes Clip81459] gi|254900574|ref|ZP_05260498.1| preprotein translocase subunit SecE [Listeria monocytogenes J0161] gi|254913475|ref|ZP_05263487.1| predicted protein [Listeria monocytogenes J2818] gi|254932464|ref|ZP_05265823.1| predicted protein [Listeria monocytogenes HPB2262] gi|254937944|ref|ZP_05269641.1| predicted protein [Listeria monocytogenes F6900] gi|254991755|ref|ZP_05273945.1| preprotein translocase subunit SecE [Listeria monocytogenes FSL J2-064] gi|255022531|ref|ZP_05294517.1| preprotein translocase subunit SecE [Listeria monocytogenes FSL J1-208] gi|290892614|ref|ZP_06555607.1| predicted protein [Listeria monocytogenes FSL J2-071] gi|315274662|ref|ZP_07869501.1| preprotein translocase, SecE subunit [Listeria marthii FSL S4-120] gi|46879742|gb|AAT03044.1| preprotein translocase, SecE subunit [Listeria monocytogenes serotype 4b str. F2365] gi|47017010|gb|EAL07903.1| preprotein translocase, SecE subunit [Listeria monocytogenes str. 4b H7858] gi|217334938|gb|ACK40732.1| preprotein translocase, SecE subunit [Listeria monocytogenes HCC23] gi|225875335|emb|CAS04032.1| Putative preprotein translocase subunit [Listeria monocytogenes serotype 4b str. CLIP 80459] gi|258610553|gb|EEW23161.1| predicted protein [Listeria monocytogenes F6900] gi|290557923|gb|EFD91444.1| predicted protein [Listeria monocytogenes FSL J2-071] gi|293584020|gb|EFF96052.1| predicted protein [Listeria monocytogenes HPB2262] gi|293591483|gb|EFF99817.1| predicted protein [Listeria monocytogenes J2818] gi|307569784|emb|CAR82963.1| preprotein translocase, SecE subunit [Listeria monocytogenes L99] gi|313611162|gb|EFR85987.1| preprotein translocase, SecE subunit [Listeria monocytogenes FSL F2-208] gi|313615708|gb|EFR88997.1| preprotein translocase, SecE subunit [Listeria marthii FSL S4-120] gi|328467854|gb|EGF38894.1| preprotein translocase subunit SecE [Listeria monocytogenes 1816] gi|328476086|gb|EGF46795.1| preprotein translocase subunit SecE [Listeria monocytogenes 220] Length = 59 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 17/46 (36%), Positives = 30/46 (65%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 A+ FF+ V E K+ WP+R E+L + V+I + + ++FF++ID Sbjct: 3 AIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVVLFALFFMLID 48 >gi|71278783|ref|YP_271422.1| preprotein translocase subunit SecE [Colwellia psychrerythraea 34H] gi|71144523|gb|AAZ24996.1| preprotein translocase, SecE subunit [Colwellia psychrerythraea 34H] Length = 126 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 15/55 (27%), Positives = 32/55 (58%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K+ R E +K+ WP+R E + + +V+++ + S+ +D + WL+ + G+ Sbjct: 70 FAKEARTEVRKVVWPTRQEAVQTTGIVLVVTLLMSLLLWGLDSVLFWLVGLVTGM 124 >gi|317052116|ref|YP_004113232.1| preprotein translocase subunit SecE [Desulfurispirillum indicum S5] gi|316947200|gb|ADU66676.1| preprotein translocase, SecE subunit [Desulfurispirillum indicum S5] Length = 59 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 15/59 (25%), Positives = 33/59 (55%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + F K V+ E K+ WP + EV +VV+++++ +V+F +D ++ ++G Sbjct: 1 MKTVEFLKSVKSEFGKVVWPKKDEVKGMTLVVLVLVAFMTVYFGALDAVFSRMISLLIG 59 >gi|331701824|ref|YP_004398783.1| preprotein translocase subunit SecE [Lactobacillus buchneri NRRL B-30929] gi|329129167|gb|AEB73720.1| preprotein translocase, SecE subunit [Lactobacillus buchneri NRRL B-30929] Length = 58 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 30/55 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++NFFK+V E K + WP+ S+ VI I ++F ++D + W + F+ Sbjct: 3 LINFFKKVAQEMKVVTWPNASQTRTDTSTVIGTSIIMAIFLGLVDWIVQWALQFL 57 >gi|312793746|ref|YP_004026669.1| preprotein translocase, sece subunit [Caldicellulosiruptor kristjanssonii 177R1B] gi|312876855|ref|ZP_07736832.1| preprotein translocase, SecE subunit [Caldicellulosiruptor lactoaceticus 6A] gi|311796370|gb|EFR12722.1| preprotein translocase, SecE subunit [Caldicellulosiruptor lactoaceticus 6A] gi|312180886|gb|ADQ41056.1| preprotein translocase, SecE subunit [Caldicellulosiruptor kristjanssonii 177R1B] Length = 89 Score = 36.2 bits (82), Expect = 1.7, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 27/45 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 + FF+ VR E KK+ WPS+ +V+ IVV+ +VF L+ D Sbjct: 30 TVKFFRDVRIEMKKVVWPSQKQVVKHTIVVLTFTLFFTVFILLAD 74 >gi|257795366|ref|ZP_05644345.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9781] gi|258408947|ref|ZP_05681228.1| preprotein translocase subunit SecE [Staphylococcus aureus A9763] gi|258420415|ref|ZP_05683358.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9719] gi|258422618|ref|ZP_05685524.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9635] gi|282907863|ref|ZP_06315698.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus WW2703/97] gi|282910176|ref|ZP_06317980.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus WBG10049] gi|257789338|gb|EEV27678.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9781] gi|257840298|gb|EEV64761.1| preprotein translocase subunit SecE [Staphylococcus aureus A9763] gi|257843605|gb|EEV68011.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9719] gi|257847190|gb|EEV71198.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9635] gi|282325568|gb|EFB55876.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus WBG10049] gi|282328247|gb|EFB58525.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus WW2703/97] gi|323439805|gb|EGA97522.1| preprotein translocase subunit SecE [Staphylococcus aureus O11] gi|323443093|gb|EGB00713.1| preprotein translocase subunit SecE [Staphylococcus aureus O46] Length = 65 Score = 35.8 bits (81), Expect = 1.7, Method: Compositional matrix adjust. Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Query: 1 MGVNRLAVL-NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M V ++A +FFK V+ E +K WP++ E+ ++V+ + VFF +D I L Sbjct: 1 MEVEQMAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALK 60 Query: 60 HFILG 64 + + G Sbjct: 61 NLLFG 65 >gi|297582434|ref|YP_003698214.1| preprotein translocase subunit SecE [Bacillus selenitireducens MLS10] gi|297140891|gb|ADH97648.1| preprotein translocase, SecE subunit [Bacillus selenitireducens MLS10] Length = 68 Score = 35.8 bits (81), Expect = 1.7, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 30/56 (53%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F K V E K++ WP+R E+ IVV + I ++FF + D +I ++ I Sbjct: 13 IKFLKDVSTEMKRVTWPNRQELTKYTIVVSTTVIIMAIFFAISDFAISGILDLITN 68 >gi|229917373|ref|YP_002886019.1| preprotein translocase, SecE subunit [Exiguobacterium sp. AT1b] gi|229468802|gb|ACQ70574.1| preprotein translocase, SecE subunit [Exiguobacterium sp. AT1b] Length = 56 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 30/56 (53%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +NF + V E KK WP+R E+ I VI + + +F +D + +L++ ++ Sbjct: 1 MNFLRDVWKELKKTSWPTRKELTKYTITVIATVVVIGLFVFGVDTGVSYLVNLLIN 56 >gi|159028398|emb|CAO89840.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 78 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 14/50 (28%), Positives = 28/50 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 V F + ++E K+ WPSR ++L V++M+++ + +ID+ W Sbjct: 22 VKEFVNETKEELAKVVWPSRQQLLSESAAVMLMVTLVATLIYLIDKFFAW 71 >gi|322513222|ref|ZP_08066348.1| preprotein translocase [Actinobacillus ureae ATCC 25976] gi|322120998|gb|EFX92839.1| preprotein translocase [Actinobacillus ureae ATCC 25976] Length = 158 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 18/59 (30%), Positives = 31/59 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 98 TAIGFIKESRTELRKIIWPTRPEATQATLIVLAMCVVVSLVLWGIDSIIVTLITFLTNL 156 >gi|237743081|ref|ZP_04573562.1| protein translocase subunit sece [Fusobacterium sp. 7_1] gi|256028512|ref|ZP_05442346.1| protein translocase subunit SecE [Fusobacterium sp. D11] gi|260495682|ref|ZP_05815805.1| preprotein translocase, SecE subunit [Fusobacterium sp. 3_1_33] gi|289766432|ref|ZP_06525810.1| translocase subunit sece [Fusobacterium sp. D11] gi|229433377|gb|EEO43589.1| protein translocase subunit sece [Fusobacterium sp. 7_1] gi|260196747|gb|EEW94271.1| preprotein translocase, SecE subunit [Fusobacterium sp. 3_1_33] gi|289717987|gb|EFD81999.1| translocase subunit sece [Fusobacterium sp. D11] Length = 58 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 28/44 (63%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +N F++V+ E K+ WPS++EV+ S + V+ M S++ V D Sbjct: 1 MNLFQKVKMEYSKVEWPSKTEVIHSTLWVVTMTVFVSIYLGVFD 44 >gi|110598843|ref|ZP_01387099.1| SecE subunit of protein translocation complex [Chlorobium ferrooxidans DSM 13031] gi|110339551|gb|EAT58070.1| SecE subunit of protein translocation complex [Chlorobium ferrooxidans DSM 13031] Length = 63 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 15/55 (27%), Positives = 34/55 (61%), Gaps = 4/55 (7%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +++ V +E +K+ WP + E+ IVV+ + I ++F ++D W+++F++G Sbjct: 10 QYYRDVINEMRKVVWPGKEEIKDLTIVVLTVSGILALFTFLVD----WVINFVMG 60 >gi|257462551|ref|ZP_05626962.1| protein translocase subunit SecE [Fusobacterium sp. D12] gi|317060204|ref|ZP_07924689.1| predicted protein [Fusobacterium sp. D12] gi|313685880|gb|EFS22715.1| predicted protein [Fusobacterium sp. D12] Length = 60 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 15/44 (34%), Positives = 27/44 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 ++ F+ VR E K+ WP + E++ S + V++M I S++ V D Sbjct: 1 MSLFQDVRKEYSKVQWPKKKEIISSTVWVVVMAVILSIYLGVFD 44 >gi|323143687|ref|ZP_08078358.1| preprotein translocase, SecE subunit [Succinatimonas hippei YIT 12066] gi|322416520|gb|EFY07183.1| preprotein translocase, SecE subunit [Succinatimonas hippei YIT 12066] Length = 160 Score = 35.8 bits (81), Expect = 1.8, Method: Compositional matrix adjust. Identities = 14/46 (30%), Positives = 28/46 (60%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 A+L F ++ E +K+ WP+R E + + I+V + + + S+F + D Sbjct: 103 ALLTFAREAYVELRKVVWPTRQEAVQTTIIVFVGVCVVSLFLYLCD 148 >gi|328949967|ref|YP_004367302.1| preprotein translocase, SecE subunit [Marinithermus hydrothermalis DSM 14884] gi|328450291|gb|AEB11192.1| preprotein translocase, SecE subunit [Marinithermus hydrothermalis DSM 14884] Length = 60 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 29/56 (51%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ +F++ R E ++ WPSR E++ S +++ S V D G LM I+ Sbjct: 4 IIAYFREARAELARVTWPSREEIIQSTEAILLFTLFSMTILWVYDLVFGQLMRLII 59 >gi|326793545|ref|YP_004311365.1| preprotein translocase, SecE subunit [Marinomonas mediterranea MMB-1] gi|326544309|gb|ADZ89529.1| preprotein translocase, SecE subunit [Marinomonas mediterranea MMB-1] Length = 122 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 13/58 (22%), Positives = 33/58 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A K+ + E ++ WP+R E + + ++V+ ++ S+ +D ++GW++ ++G Sbjct: 65 AFFTLAKEAKKEIGRVVWPTRQETVQTTLIVLAVVIFMSLVLWGVDSALGWVVSAVIG 122 >gi|307731269|ref|YP_003908493.1| preprotein translocase, SecE subunit [Burkholderia sp. CCGE1003] gi|323527616|ref|YP_004229769.1| preprotein translocase subunit SecE [Burkholderia sp. CCGE1001] gi|307585804|gb|ADN59202.1| preprotein translocase, SecE subunit [Burkholderia sp. CCGE1003] gi|323384618|gb|ADX56709.1| preprotein translocase, SecE subunit [Burkholderia sp. CCGE1001] Length = 126 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW-LMHFILG 64 + F K E +K+ WP+R E + +VV + I ++F V D+SI W + ILG Sbjct: 68 IAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVFIMAIFLWVSDKSIEWAIFSVILG 124 >gi|157690883|ref|YP_001485345.1| preprotein translocase subunit SecE [Bacillus pumilus SAFR-032] gi|194017439|ref|ZP_03056050.1| preprotein translocase, SecE subunit [Bacillus pumilus ATCC 7061] gi|157679641|gb|ABV60785.1| Sec family Type II general secretory pathway preprotein translocase SecE [Bacillus pumilus SAFR-032] gi|194010711|gb|EDW20282.1| preprotein translocase, SecE subunit [Bacillus pumilus ATCC 7061] Length = 58 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 33/57 (57%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + +++F K V E KK+ WP ++E++ I VI+ + ++FF +D I L+ I Sbjct: 1 MRIISFLKSVGKEMKKVSWPKKNEMIRYTITVILTVVFFAIFFSFLDIGISQLIELI 57 >gi|317153970|ref|YP_004122018.1| preprotein translocase subunit SecE [Desulfovibrio aespoeensis Aspo-2] gi|316944221|gb|ADU63272.1| preprotein translocase, SecE subunit [Desulfovibrio aespoeensis Aspo-2] Length = 85 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 13/55 (23%), Positives = 34/55 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F ++ + E KK+ WP+R E + + + V+I+ + +++ ++D ++ ++ IL Sbjct: 30 IEFLEESKVEIKKVVWPTRKETITTCVAVLIVSLVVALYLGIVDLALSKIVEAIL 84 >gi|87201855|gb|ABD29665.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus NCTC 8325] Length = 72 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 30/55 (54%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +FFK V+ E +K WP++ E+ ++V+ + VFF +D I L + + G Sbjct: 18 SFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFG 72 >gi|268592955|ref|ZP_06127176.1| preprotein translocase, SecE subunit [Providencia rettgeri DSM 1131] gi|291311426|gb|EFE51879.1| preprotein translocase, SecE subunit [Providencia rettgeri DSM 1131] Length = 128 Score = 35.8 bits (81), Expect = 2.1, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 32/56 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 67 ATLAFAREARVEMRKVIWPTRQETLQTTLIVAAVTAVMSLILWGLDGILVRLVSFI 122 >gi|253998001|ref|YP_003050064.1| preprotein translocase subunit SecE [Methylovorus sp. SIP3-4] gi|313200069|ref|YP_004038727.1| preprotein translocase subunit SecE [Methylovorus sp. MP688] gi|253984680|gb|ACT49537.1| preprotein translocase, SecE subunit [Methylovorus sp. SIP3-4] gi|312439385|gb|ADQ83491.1| preprotein translocase, SecE subunit [Methylovorus sp. MP688] Length = 115 Score = 35.8 bits (81), Expect = 2.1, Method: Compositional matrix adjust. Identities = 13/57 (22%), Positives = 32/57 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F + E++++ WP+R E + + + V +++ + +VF ++D W + ++G G Sbjct: 58 AFVQDSAAEARRVVWPTRKETIQTTVAVFVLVMVMAVFLWLVDIGFLWGVKMLMGRG 114 >gi|73663529|ref|YP_302310.1| preprotein translocase subunit SecE [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] gi|72496044|dbj|BAE19365.1| preprotein translocase subunit SecE [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] Length = 59 Score = 35.8 bits (81), Expect = 2.1, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 30/53 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +FF+ V+ E +K WP++ E+ ++V+ + VFF +D IG ++ I Sbjct: 6 SFFQGVKSEMEKTSWPTKEELFKYTVIVVATVVFFLVFFYALDLGIGRIIELI 58 >gi|325288564|ref|YP_004264745.1| preprotein translocase, SecE subunit [Syntrophobotulus glycolicus DSM 8271] gi|324963965|gb|ADY54744.1| preprotein translocase, SecE subunit [Syntrophobotulus glycolicus DSM 8271] Length = 79 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 15/43 (34%), Positives = 28/43 (65%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQ 53 FF++V +E KK+ WP+R +++V VV + + I +V ++D Sbjct: 26 FFREVWNELKKVHWPTRKQMMVYTGVVFVTVGIFAVLIWIVDS 68 >gi|297567071|ref|YP_003686043.1| preprotein translocase subunit SecE [Meiothermus silvanus DSM 9946] gi|296851520|gb|ADH64535.1| preprotein translocase, SecE subunit [Meiothermus silvanus DSM 9946] Length = 73 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 15/44 (34%), Positives = 31/44 (70%), Gaps = 4/44 (9%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVI 51 V+N+F++ R E ++ WP+R E++ S V++++ +VFF+V+ Sbjct: 17 VVNYFRESRAELSRVTWPTRQEIVQSTEVILLV----TVFFMVV 56 >gi|194476831|ref|YP_002049010.1| Preprotein translocase subunit SecE [Paulinella chromatophora] gi|171191838|gb|ACB42800.1| Preprotein translocase subunit SecE [Paulinella chromatophora] Length = 96 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 15/52 (28%), Positives = 28/52 (53%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 L FF +E K + WPSR +++ +VV+ ++ +S++ +D GW Sbjct: 38 LTRFGFFVSTLEELKLVVWPSRQQIISEAVVVMAIVGLSTLAIAAVDNFYGW 89 >gi|42524389|ref|NP_969769.1| preprotein translocase SecE subunit [Bdellovibrio bacteriovorus HD100] gi|39576598|emb|CAE80762.1| preprotein translocase SecE subunit [Bdellovibrio bacteriovorus HD100] Length = 125 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 30/51 (58%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++V E +K+ WPSR + I ++M+ ISSV D G+L++F++ Sbjct: 74 EEVVSEIRKVVWPSRKDTTAMTIACVVMVLISSVIISSFDLISGFLINFLM 124 >gi|325972674|ref|YP_004248865.1| preprotein translocase, SecE subunit [Spirochaeta sp. Buddy] gi|324027912|gb|ADY14671.1| preprotein translocase, SecE subunit [Spirochaeta sp. Buddy] Length = 59 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 17/43 (39%), Positives = 26/43 (60%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +FK+ E KK+ WPSR V+ S VV++ I +VF ++D Sbjct: 6 KYFKESHQELKKVVWPSREAVISSTKVVLVSTVIVAVFLGLVD 48 >gi|297201704|ref|ZP_06919101.1| preprotein translocase subunit SecE [Streptomyces sviceus ATCC 29083] gi|197710923|gb|EDY54957.1| preprotein translocase subunit SecE [Streptomyces sviceus ATCC 29083] Length = 95 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 RLA F++Q+ E +K+ WPSR+++ VVI+ + + VID + ++ Sbjct: 37 KRLA--TFYRQIVAELRKVVWPSRNQLTTYTTVVIVFVLVMIGLVTVIDYGLNHAAKYVF 94 Query: 64 G 64 G Sbjct: 95 G 95 >gi|289806725|ref|ZP_06537354.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. AG3] Length = 93 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 13/46 (28%), Positives = 27/46 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D Sbjct: 35 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLD 80 >gi|78213981|ref|YP_382760.1| preprotein translocase subunit SecE [Synechococcus sp. CC9605] gi|78198440|gb|ABB36205.1| SecE subunit of protein translocation complex [Synechococcus sp. CC9605] Length = 96 Score = 35.8 bits (81), Expect = 2.3, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 25/48 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 F DE K + WPSR ++ I VI+M+S+S+ + + GW Sbjct: 42 GFLADTVDELKLVVWPSRQQLFSESIAVILMVSLSAATIAAVSRLFGW 89 >gi|218767187|ref|YP_002341699.1| preprotein translocase subunit SecE [Neisseria meningitidis Z2491] gi|121051195|emb|CAM07466.1| putative preprotein translocase SECE subunit [Neisseria meningitidis Z2491] gi|319411392|emb|CBY91803.1| preprotein translocase SecE subunit [Neisseria meningitidis WUE 2594] Length = 92 Score = 35.8 bits (81), Expect = 2.3, Method: Compositional matrix adjust. Identities = 15/46 (32%), Positives = 26/46 (56%) Query: 18 ESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 E KK+ WP R + + + VI+ +++ S+F D +I WL +L Sbjct: 42 EFKKVVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAISWLFFDVL 87 >gi|262373976|ref|ZP_06067253.1| preprotein translocase subunit SecE [Acinetobacter junii SH205] gi|262310987|gb|EEY92074.1| preprotein translocase subunit SecE [Acinetobacter junii SH205] Length = 145 Score = 35.4 bits (80), Expect = 2.3, Method: Compositional matrix adjust. Identities = 13/54 (24%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + R E +++ WP++ E + + V++++ I+S+ D +GW + I+G Sbjct: 92 LLQDARIELRRVTWPTKQETITTSWQVLLVVIIASLVLWCFDYGLGWFIKLIIG 145 >gi|33591282|ref|NP_878926.1| preprotein translocase subunit SecE [Bordetella pertussis Tohama I] gi|33594731|ref|NP_882374.1| preprotein translocase subunit SecE [Bordetella parapertussis 12822] gi|33599001|ref|NP_886561.1| preprotein translocase subunit SecE [Bordetella bronchiseptica RB50] gi|33564807|emb|CAE39749.1| preprotein translocase SecE subunit [Bordetella parapertussis] gi|33570924|emb|CAE40388.1| preprotein translocase SecE subunit [Bordetella pertussis Tohama I] gi|33575047|emb|CAE30510.1| preprotein translocase SecE subunit [Bordetella bronchiseptica RB50] Length = 126 Score = 35.4 bits (80), Expect = 2.3, Method: Compositional matrix adjust. Identities = 14/56 (25%), Positives = 32/56 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F + +E K++ WP+R E + +V +++ + V+D+ I W+++ +L Sbjct: 67 TLSFAGESYNEVKRVSWPTRKETIQMTGIVFAFVAVMGLLMWVLDKGIEWVLYGLL 122 >gi|85058106|ref|YP_453808.1| preprotein translocase subunit SecE [Sodalis glossinidius str. 'morsitans'] gi|84778626|dbj|BAE73403.1| preprotein translocase SecE subunit [Sodalis glossinidius str. 'morsitans'] Length = 127 Score = 35.4 bits (80), Expect = 2.3, Method: Compositional matrix adjust. Identities = 15/59 (25%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + ++ FI G+ Sbjct: 67 STVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRVVSFITGL 125 >gi|308272992|emb|CBX29596.1| hypothetical protein N47_J05770 [uncultured Desulfobacterium sp.] Length = 132 Score = 35.4 bits (80), Expect = 2.4, Method: Compositional matrix adjust. Identities = 23/54 (42%), Positives = 36/54 (66%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F ++V+ E KKI WP+R + + S +VVII++ I S+F V+D + L+H IL Sbjct: 78 QFLREVKIELKKITWPTRKQTIGSTVVVIILVLIVSLFLSVVDMGLQSLVHIIL 131 >gi|94500509|ref|ZP_01307040.1| translocase [Oceanobacter sp. RED65] gi|94427299|gb|EAT12278.1| translocase [Oceanobacter sp. RED65] Length = 122 Score = 35.4 bits (80), Expect = 2.4, Method: Compositional matrix adjust. Identities = 14/58 (24%), Positives = 32/58 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A L K+ E +K+ WP+R E + ++VI ++ + ++ +D + W++ ++G Sbjct: 65 AFLVLLKEANIERRKVVWPTRQETTQTTLIVIAVVILVAILLWGLDSLLAWMVSSVIG 122 >gi|329938258|ref|ZP_08287709.1| preprotein translocase SecE subunit [Streptomyces griseoaurantiacus M045] gi|329302747|gb|EGG46637.1| preprotein translocase SecE subunit [Streptomyces griseoaurantiacus M045] Length = 95 Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + RLA+ F++Q+ E +K+ WPSR+++ VVI ++I VID + ++ Sbjct: 36 LKRLAL--FYRQIVAELRKVVWPSRNQLTSYTTVVIFFVAIMIGLVTVIDYGLNHAAKYV 93 Query: 63 LG 64 G Sbjct: 94 FG 95 >gi|16077168|ref|NP_387981.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. subtilis str. 168] gi|221307912|ref|ZP_03589759.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. subtilis str. 168] gi|221312233|ref|ZP_03594038.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. subtilis str. NCIB 3610] gi|221317167|ref|ZP_03598461.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. subtilis str. JH642] gi|221321430|ref|ZP_03602724.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. subtilis str. SMY] gi|321313771|ref|YP_004206058.1| preprotein translocase subunit SecE [Bacillus subtilis BSn5] gi|549784|sp|Q06799|SECE_BACSU RecName: Full=Preprotein translocase subunit secE gi|285627|dbj|BAA02559.1| E.coli SecE homologous protein [Bacillus subtilis] gi|2632367|emb|CAB11876.1| preprotein translocase subunit [Bacillus subtilis subsp. subtilis str. 168] gi|320020045|gb|ADV95031.1| preprotein translocase subunit SecE [Bacillus subtilis BSn5] Length = 59 Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 30/58 (51%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ FFK V E KK+ WP E+ I VI + +FF ++D I L+ I+ Sbjct: 1 MRIMKFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFVIFFALLDTGISQLIRLIV 58 >gi|313204186|ref|YP_004042843.1| preprotein translocase, sece subunit [Paludibacter propionicigenes WB4] gi|312443502|gb|ADQ79858.1| preprotein translocase, SecE subunit [Paludibacter propionicigenes WB4] Length = 63 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 6 LAVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + ++N+ K+ E +K+ WPS+SE+ S IVV+I I ++ ++D S +M FI G Sbjct: 1 MKIINYIKESYSELVQKVSWPSKSELTNSAIVVLIASIILALIVWLMDVSFERIMKFIYG 60 Query: 65 I 65 + Sbjct: 61 L 61 >gi|326319232|ref|YP_004236904.1| preprotein translocase subunit SecE [Acidovorax avenae subsp. avenae ATCC 19860] gi|323376068|gb|ADX48337.1| preprotein translocase, SecE subunit [Acidovorax avenae subsp. avenae ATCC 19860] Length = 128 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH-FILG 64 F K E KK+ WP+R E L V + + ++F D+++ W+++ ILG Sbjct: 70 GFAKDAWKEVKKVVWPTRKETLQMTAYVFAFVLVMALFLWFTDKTLEWVLYDLILG 125 >gi|120613170|ref|YP_972848.1| preprotein translocase subunit SecE [Acidovorax citrulli AAC00-1] gi|120591634|gb|ABM35074.1| protein translocase subunit secE/sec61 gamma [Acidovorax citrulli AAC00-1] Length = 128 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH-FILG 64 F K E KK+ WP+R E L V + + ++F D+++ W+++ ILG Sbjct: 70 GFAKDAWKEVKKVVWPTRKETLQMTAYVFAFVLVMALFLWFTDKTLEWVLYDLILG 125 >gi|77359187|ref|YP_338762.1| preprotein translocase subunit SecE [Pseudoalteromonas haloplanktis TAC125] gi|76874098|emb|CAI85319.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Pseudoalteromonas haloplanktis TAC125] Length = 125 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 13/44 (29%), Positives = 27/44 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 L F K+ R E +K+ WP+R E + + ++V++ +I ++ +D Sbjct: 67 LTFAKEARIEVRKVIWPTRQETIHTTLIVMVATAIMALILWGLD 110 >gi|284050919|ref|ZP_06381129.1| preprotein translocase subunit SecE [Arthrospira platensis str. Paraca] Length = 92 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 16/58 (27%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +V F K ++E K+ WP+R ++L V++M+ +S+ +ID W + G Sbjct: 35 SVGGFLKGTKEELDKVVWPTRQQLLSESAGVLLMVMLSATLIYLIDNFFRWSSGQVFG 92 >gi|326392848|ref|ZP_08214085.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus JW 200] gi|325991110|gb|EGD49865.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus JW 200] Length = 50 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 14/36 (38%), Positives = 25/36 (69%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSI 43 ++ FFK VR E KK+ WPSR ++ +V+I++++ Sbjct: 8 IVKFFKDVRAEMKKVTWPSRETMITYTEIVLIVVAL 43 >gi|291565934|dbj|BAI88206.1| putative preprotein translocase, SecE subunit [Arthrospira platensis NIES-39] Length = 74 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 16/58 (27%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +V F K ++E K+ WP+R ++L V++M+ +S+ +ID W + G Sbjct: 17 SVGGFLKGTKEELDKVVWPTRQQLLSESAGVLLMVMLSATLIYLIDNFFRWSSGQVFG 74 >gi|260434840|ref|ZP_05788810.1| preprotein translocase, SecE subunit [Synechococcus sp. WH 8109] gi|260412714|gb|EEX06010.1| preprotein translocase, SecE subunit [Synechococcus sp. WH 8109] Length = 80 Score = 35.4 bits (80), Expect = 2.9, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 25/48 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 F DE K + WPSR ++ I VI+M+S+S+ + + GW Sbjct: 26 GFLADTVDELKLVVWPSRQQLFSESIAVILMVSLSAATIAAVSRFFGW 73 >gi|228475255|ref|ZP_04059980.1| preprotein translocase, SecE subunit [Staphylococcus hominis SK119] gi|314937160|ref|ZP_07844507.1| preprotein translocase, SecE subunit [Staphylococcus hominis subsp. hominis C80] gi|228270720|gb|EEK12129.1| preprotein translocase, SecE subunit [Staphylococcus hominis SK119] gi|313655779|gb|EFS19524.1| preprotein translocase, SecE subunit [Staphylococcus hominis subsp. hominis C80] Length = 66 Score = 35.4 bits (80), Expect = 2.9, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 30/51 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 +FF+ V+ E +K WP++ E+ ++V+ + VFF V+D IG L+ Sbjct: 13 SFFQGVKSEMEKTSWPTKEELFKYTVIVVATVIFFMVFFWVLDVGIGNLIQ 63 >gi|91785479|ref|YP_560685.1| preprotein translocase subunit SecE [Burkholderia xenovorans LB400] gi|91689433|gb|ABE32633.1| protein translocase subunit secE/sec61 gamma [Burkholderia xenovorans LB400] Length = 126 Score = 35.4 bits (80), Expect = 2.9, Method: Compositional matrix adjust. Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW-LMHFILG 64 + F K E +K+ WP+R E + +VV + + ++F V D+SI W + ILG Sbjct: 68 IAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVFVMAIFLWVSDKSIEWAIFSVILG 124 >gi|167949632|ref|ZP_02536706.1| preprotein translocase subunit SecE [Endoriftia persephone 'Hot96_1+Hot96_2'] Length = 125 Score = 35.0 bits (79), Expect = 3.0, Method: Compositional matrix adjust. Identities = 15/58 (25%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V F + E +++ WPSR E + + ++V +M+ I + D +GW++ + G Sbjct: 67 TVWQFASDSKVEVRRVVWPSRQETVQTTLIVFVMVLIMGFVLWMFDMMLGWVLRTLTG 124 >gi|156744235|ref|YP_001434364.1| preprotein translocase subunit SecE [Roseiflexus castenholzii DSM 13941] gi|156235563|gb|ABU60346.1| preprotein translocase, SecE subunit [Roseiflexus castenholzii DSM 13941] Length = 84 Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 14/51 (27%), Positives = 27/51 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 A++ ++ R E +K+ WP+R E + +VVI++ ++ S D W Sbjct: 22 AIVQPLRESRAEMRKVVWPTREETIRLTVVVILLSAVMSAILFAADALFSW 72 >gi|42519936|ref|NP_965851.1| preprotein translocase subunit SecE [Wolbachia endosymbiont of Drosophila melanogaster] gi|225629887|ref|YP_002726678.1| preprotein translocase, SecE subunit [Wolbachia sp. wRi] gi|225631287|ref|ZP_03787966.1| protein translocase subunit SecE [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|42409673|gb|AAS13785.1| protein translocase subunit SecE [Wolbachia endosymbiont of Drosophila melanogaster] gi|225591021|gb|EEH12224.1| protein translocase subunit SecE [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|225591868|gb|ACN94887.1| preprotein translocase, SecE subunit [Wolbachia sp. wRi] Length = 69 Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 16/46 (34%), Positives = 29/46 (63%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 ++ FF ++ E ++I W + EVL S+ VV+I++ S+FF +D Sbjct: 7 SLCGFFCDIKQEIRRIAWVKKQEVLSSLFVVMIVILCFSIFFCFVD 52 >gi|168187828|ref|ZP_02622463.1| preprotein translocase, SecE subunit [Clostridium botulinum C str. Eklund] gi|169294355|gb|EDS76488.1| preprotein translocase, SecE subunit [Clostridium botulinum C str. Eklund] Length = 73 Score = 35.0 bits (79), Expect = 3.1, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F K+++ E+K+I WP + EV S I+V+ +S+ ++D L I Sbjct: 19 KFLKELKAETKRITWPPKEEVKKSTIIVLFFCVVSAFIIGLMDSGFNGLYKII 71 >gi|296163265|ref|ZP_06846029.1| preprotein translocase, SecE subunit [Burkholderia sp. Ch1-1] gi|295886501|gb|EFG66355.1| preprotein translocase, SecE subunit [Burkholderia sp. Ch1-1] Length = 110 Score = 35.0 bits (79), Expect = 3.2, Method: Compositional matrix adjust. Identities = 16/49 (32%), Positives = 27/49 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 + F K E +K+ WP+R E + +VV + + ++F V D+SI W Sbjct: 52 IAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVFVMAIFLWVSDKSIEW 100 >gi|315168711|gb|EFU12728.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1341] Length = 56 Score = 35.0 bits (79), Expect = 3.2, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 34/56 (60%), Gaps = 4/56 (7%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVI-IMLSISSVFFL---VIDQSIGWLMH 60 + FF+ V DE K++ WP++ ++ +VVI + +++FF+ VI + GW++ Sbjct: 1 MKFFRSVTDEMKQVTWPTKKQLRKDTLVVIETSILFAALFFIMDTVIQTAFGWILK 56 >gi|254483547|ref|ZP_05096773.1| preprotein translocase, SecE subunit, putative [marine gamma proteobacterium HTCC2148] gi|214036204|gb|EEB76885.1| preprotein translocase, SecE subunit, putative [marine gamma proteobacterium HTCC2148] Length = 120 Score = 35.0 bits (79), Expect = 3.2, Method: Compositional matrix adjust. Identities = 16/58 (27%), Positives = 32/58 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A K R E +K+ WPSR E + + ++V++ + + ++ +D +GWL+ +G Sbjct: 63 AFWTLVKGSRTEIRKVVWPSRQETVQTTMIVVVFVVLVALMLWGLDSFLGWLVSLAIG 120 >gi|330976627|gb|EGH76671.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. aptata str. DSM 50252] Length = 122 Score = 35.0 bits (79), Expect = 3.3, Method: Compositional matrix adjust. Identities = 15/52 (28%), Positives = 31/52 (59%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ R E +K+ WP+R E + ++V+ + + ++ +D +GWL+ I+G Sbjct: 71 KEARAEIRKVVWPTRQETTQTTLIVVAGVLVMALLLWGLDSLLGWLVSLIVG 122 >gi|29377207|ref|NP_816361.1| preprotein translocase, SecE subunit [Enterococcus faecalis V583] gi|227519485|ref|ZP_03949534.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0104] gi|227554215|ref|ZP_03984262.1| preprotein translocase, SecE subunit [Enterococcus faecalis HH22] gi|229544888|ref|ZP_04433613.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1322] gi|229549154|ref|ZP_04437879.1| preprotein translocase, SecE subunit [Enterococcus faecalis ATCC 29200] gi|255971872|ref|ZP_05422458.1| predicted protein [Enterococcus faecalis T1] gi|255974867|ref|ZP_05425453.1| predicted protein [Enterococcus faecalis T2] gi|256616770|ref|ZP_05473616.1| predicted protein [Enterococcus faecalis ATCC 4200] gi|256763354|ref|ZP_05503934.1| predicted protein [Enterococcus faecalis T3] gi|256854028|ref|ZP_05559393.1| preprotein translocase [Enterococcus faecalis T8] gi|256957956|ref|ZP_05562127.1| predicted protein [Enterococcus faecalis DS5] gi|256961024|ref|ZP_05565195.1| predicted protein [Enterococcus faecalis Merz96] gi|256963834|ref|ZP_05568005.1| predicted protein [Enterococcus faecalis HIP11704] gi|257079894|ref|ZP_05574255.1| predicted protein [Enterococcus faecalis JH1] gi|257081707|ref|ZP_05576068.1| preprotein translocase, SecE subunit [Enterococcus faecalis E1Sol] gi|257084304|ref|ZP_05578665.1| preprotein translocase, SecE subunit [Enterococcus faecalis Fly1] gi|257087697|ref|ZP_05582058.1| predicted protein [Enterococcus faecalis D6] gi|257090915|ref|ZP_05585276.1| preprotein translocase secE [Enterococcus faecalis CH188] gi|257416899|ref|ZP_05593893.1| predicted protein [Enterococcus faecalis AR01/DG] gi|257420121|ref|ZP_05597115.1| predicted protein [Enterococcus faecalis T11] gi|257421658|ref|ZP_05598648.1| preprotein translocase subunit secE [Enterococcus faecalis X98] gi|293384586|ref|ZP_06630452.1| preprotein translocase, SecE subunit [Enterococcus faecalis R712] gi|293386815|ref|ZP_06631386.1| preprotein translocase, SecE subunit [Enterococcus faecalis S613] gi|294779910|ref|ZP_06745292.1| preprotein translocase, SecE subunit [Enterococcus faecalis PC1.1] gi|300860433|ref|ZP_07106520.1| preprotein translocase, SecE subunit [Enterococcus faecalis TUSoD Ef11] gi|307269241|ref|ZP_07550595.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX4248] gi|307271781|ref|ZP_07553052.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0855] gi|307276966|ref|ZP_07558076.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX2134] gi|307278723|ref|ZP_07559790.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0860] gi|307288651|ref|ZP_07568632.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0109] gi|307290266|ref|ZP_07570182.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0411] gi|312900091|ref|ZP_07759407.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0470] gi|312902554|ref|ZP_07761760.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0635] gi|312906412|ref|ZP_07765420.1| preprotein translocase, SecE subunit [Enterococcus faecalis DAPTO 512] gi|312951904|ref|ZP_07770792.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0102] gi|312979429|ref|ZP_07791117.1| preprotein translocase, SecE subunit [Enterococcus faecalis DAPTO 516] gi|29344673|gb|AAO82431.1| preprotein translocase, SecE subunit [Enterococcus faecalis V583] gi|227073097|gb|EEI11060.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0104] gi|227176662|gb|EEI57634.1| preprotein translocase, SecE subunit [Enterococcus faecalis HH22] gi|229305708|gb|EEN71704.1| preprotein translocase, SecE subunit [Enterococcus faecalis ATCC 29200] gi|229309989|gb|EEN75976.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1322] gi|255962890|gb|EET95366.1| predicted protein [Enterococcus faecalis T1] gi|255967739|gb|EET98361.1| predicted protein [Enterococcus faecalis T2] gi|256596297|gb|EEU15473.1| predicted protein [Enterococcus faecalis ATCC 4200] gi|256684605|gb|EEU24300.1| predicted protein [Enterococcus faecalis T3] gi|256710971|gb|EEU26014.1| preprotein translocase [Enterococcus faecalis T8] gi|256948452|gb|EEU65084.1| predicted protein [Enterococcus faecalis DS5] gi|256951520|gb|EEU68152.1| predicted protein [Enterococcus faecalis Merz96] gi|256954330|gb|EEU70962.1| predicted protein [Enterococcus faecalis HIP11704] gi|256987924|gb|EEU75226.1| predicted protein [Enterococcus faecalis JH1] gi|256989737|gb|EEU77039.1| preprotein translocase, SecE subunit [Enterococcus faecalis E1Sol] gi|256992334|gb|EEU79636.1| preprotein translocase, SecE subunit [Enterococcus faecalis Fly1] gi|256995727|gb|EEU83029.1| predicted protein [Enterococcus faecalis D6] gi|256999727|gb|EEU86247.1| preprotein translocase secE [Enterococcus faecalis CH188] gi|257158727|gb|EEU88687.1| predicted protein [Enterococcus faecalis ARO1/DG] gi|257161949|gb|EEU91909.1| predicted protein [Enterococcus faecalis T11] gi|257163482|gb|EEU93442.1| preprotein translocase subunit secE [Enterococcus faecalis X98] gi|291078132|gb|EFE15496.1| preprotein translocase, SecE subunit [Enterococcus faecalis R712] gi|291083818|gb|EFE20781.1| preprotein translocase, SecE subunit [Enterococcus faecalis S613] gi|294453022|gb|EFG21442.1| preprotein translocase, SecE subunit [Enterococcus faecalis PC1.1] gi|295113672|emb|CBL32309.1| protein translocase subunit secE/sec61 gamma [Enterococcus sp. 7L76] gi|300849472|gb|EFK77222.1| preprotein translocase, SecE subunit [Enterococcus faecalis TUSoD Ef11] gi|306498687|gb|EFM68188.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0411] gi|306500405|gb|EFM69741.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0109] gi|306504584|gb|EFM73787.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0860] gi|306506389|gb|EFM75549.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX2134] gi|306511659|gb|EFM80658.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0855] gi|306514460|gb|EFM83021.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX4248] gi|310627566|gb|EFQ10849.1| preprotein translocase, SecE subunit [Enterococcus faecalis DAPTO 512] gi|310630093|gb|EFQ13376.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0102] gi|310634224|gb|EFQ17507.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0635] gi|311287800|gb|EFQ66356.1| preprotein translocase, SecE subunit [Enterococcus faecalis DAPTO 516] gi|311292726|gb|EFQ71282.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0470] gi|315025504|gb|EFT37436.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX2137] gi|315030450|gb|EFT42382.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX4000] gi|315032578|gb|EFT44510.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0017] gi|315035101|gb|EFT47033.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0027] gi|315143880|gb|EFT87896.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX2141] gi|315148691|gb|EFT92707.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX4244] gi|315151765|gb|EFT95781.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0012] gi|315154306|gb|EFT98322.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0031] gi|315155592|gb|EFT99608.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0043] gi|315159601|gb|EFU03618.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0312] gi|315162107|gb|EFU06124.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0645] gi|315165298|gb|EFU09315.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1302] gi|315170472|gb|EFU14489.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1342] gi|315174936|gb|EFU18953.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1346] gi|315573768|gb|EFU85959.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0309B] gi|315579637|gb|EFU91828.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0630] gi|315580282|gb|EFU92473.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0309A] gi|323481652|gb|ADX81091.1| preprotein translocase, SecE subunit [Enterococcus faecalis 62] gi|327535946|gb|AEA94780.1| preprotein translocase [Enterococcus faecalis OG1RF] gi|329578048|gb|EGG59462.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1467] Length = 56 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 34/56 (60%), Gaps = 4/56 (7%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVI-IMLSISSVFFL---VIDQSIGWLMH 60 + FF+ V DE K++ WP++ ++ +VVI + +++FF+ VI + GW++ Sbjct: 1 MKFFRSVADEMKQVTWPTKKQLRKDTLVVIETSILFAALFFIMDTVIQTAFGWILK 56 >gi|74316410|ref|YP_314150.1| preprotein translocase subunit SecE [Thiobacillus denitrificans ATCC 25259] gi|74055905|gb|AAZ96345.1| SecE subunit of protein translocation complex [Thiobacillus denitrificans ATCC 25259] Length = 115 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 19/60 (31%), Positives = 34/60 (56%), Gaps = 3/60 (5%) Query: 10 NFFK---QVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 +FF+ RDE+KK+ WP+R E + VV+ + + ++F +D + WL+ +G G Sbjct: 55 HFFRFALDSRDEAKKVVWPTRKETIQMTGVVMAFVVVMALFLWAVDGVLLWLVKLAMGQG 114 >gi|166366401|ref|YP_001658674.1| preprotein translocase SecE subunit [Microcystis aeruginosa NIES-843] gi|166088774|dbj|BAG03482.1| preprotein translocase SecE subunit [Microcystis aeruginosa NIES-843] Length = 78 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 14/50 (28%), Positives = 28/50 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 V F + ++E K+ WPSR ++L V++M+++ + +ID+ W Sbjct: 22 VKEFVNESKEELAKVVWPSRQQLLSESAAVMLMVTLVATLIYLIDKFFAW 71 >gi|33866875|ref|NP_898434.1| preprotein translocase subunit SecE [Synechococcus sp. WH 8102] gi|33639476|emb|CAE08860.1| putative preprotein translocase, SecE subunit [Synechococcus sp. WH 8102] Length = 80 Score = 35.0 bits (79), Expect = 3.5, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 26/51 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 A F DE K + WPSR ++ I VI+M+S+S+ + + GW Sbjct: 23 APRGFLPATVDELKLVVWPSRQQLFSESIAVILMVSLSAAGIAAVSRFFGW 73 >gi|312144261|ref|YP_003995707.1| preprotein translocase, SecE subunit [Halanaerobium sp. 'sapolanicus'] gi|311904912|gb|ADQ15353.1| preprotein translocase, SecE subunit [Halanaerobium sp. 'sapolanicus'] Length = 67 Score = 35.0 bits (79), Expect = 3.6, Method: Compositional matrix adjust. Identities = 16/49 (32%), Positives = 30/49 (61%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG 56 + F KQVR E KK+ WP++ E+ + +VVI+ + +F ++D ++ Sbjct: 11 ITKFIKQVRGELKKVNWPNKKELTSNTLVVILTIIALIIFIGILDLTLA 59 >gi|239636934|ref|ZP_04677932.1| preprotein translocase, SecE subunit [Staphylococcus warneri L37603] gi|239597482|gb|EEQ79981.1| preprotein translocase, SecE subunit [Staphylococcus warneri L37603] gi|330686256|gb|EGG97868.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis VCU121] Length = 60 Score = 35.0 bits (79), Expect = 3.7, Method: Compositional matrix adjust. Identities = 16/55 (29%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +FF+ V+ E +K WP++ E+ ++V+ + VFF +D I L + ++G Sbjct: 6 SFFQGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLIG 60 >gi|303228895|ref|ZP_07315706.1| preprotein translocase, SecE subunit [Veillonella atypica ACS-134-V-Col7a] gi|303231167|ref|ZP_07317905.1| preprotein translocase, SecE subunit [Veillonella atypica ACS-049-V-Sch6] gi|302514074|gb|EFL56078.1| preprotein translocase, SecE subunit [Veillonella atypica ACS-049-V-Sch6] gi|302516421|gb|EFL58352.1| preprotein translocase, SecE subunit [Veillonella atypica ACS-134-V-Col7a] Length = 73 Score = 35.0 bits (79), Expect = 3.8, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 31/56 (55%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF+ V+ E KK+ WP+R E++ IVV ++ ++ V D L++ +L I Sbjct: 16 KFFRGVKAELKKVVWPTRKELINYTIVVFLVTIFIALLIYVFDAIFAQLINMLLRI 71 >gi|242278646|ref|YP_002990775.1| preprotein translocase, SecE subunit [Desulfovibrio salexigens DSM 2638] gi|242121540|gb|ACS79236.1| preprotein translocase, SecE subunit [Desulfovibrio salexigens DSM 2638] Length = 83 Score = 35.0 bits (79), Expect = 3.8, Method: Compositional matrix adjust. Identities = 17/54 (31%), Positives = 33/54 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF+Q + E KK+ WP++ E + + V++++ + S+F V+D + L+ IL Sbjct: 29 EFFEQSKVEIKKVVWPTQKETIQTCTAVLVLVVVMSLFLGVVDMGLSKLVEAIL 82 >gi|254495697|ref|ZP_05108614.1| truncated preprotein translocase subunit SecE [Legionella drancourtii LLAP12] gi|254355076|gb|EET13694.1| truncated preprotein translocase subunit SecE [Legionella drancourtii LLAP12] Length = 74 Score = 35.0 bits (79), Expect = 3.8, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 32/59 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 V F ++ + E K+ WP+R E + + +VI+M++++ ID + W + I +G Sbjct: 16 VYQFAQESKIELLKVVWPTRQETIQTTTIVIVMVTLTGFILWGIDSMMMWAIAKITHLG 74 >gi|154684618|ref|YP_001419779.1| preprotein translocase subunit SecE [Bacillus amyloliquefaciens FZB42] gi|308171991|ref|YP_003918696.1| preprotein translocase subunit [Bacillus amyloliquefaciens DSM 7] gi|311070747|ref|YP_003975670.1| preprotein translocase subunit SecE [Bacillus atrophaeus 1942] gi|154350469|gb|ABS72548.1| SecE [Bacillus amyloliquefaciens FZB42] gi|307604855|emb|CBI41226.1| preprotein translocase subunit [Bacillus amyloliquefaciens DSM 7] gi|310871264|gb|ADP34739.1| preprotein translocase subunit SecE [Bacillus atrophaeus 1942] gi|328551801|gb|AEB22293.1| preprotein translocase subunit SecE [Bacillus amyloliquefaciens TA208] gi|328910062|gb|AEB61658.1| preprotein translocase subunit SecE [Bacillus amyloliquefaciens LL3] Length = 59 Score = 35.0 bits (79), Expect = 3.8, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 31/58 (53%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + +++FFK V E KK+ WP E+ I VI + +FF ++D I L+ I+ Sbjct: 1 MRMMSFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFVIFFALLDTGISQLIRLIV 58 >gi|323498409|ref|ZP_08103406.1| preprotein translocase subunit SecE [Vibrio sinaloensis DSM 21326] gi|323316551|gb|EGA69565.1| preprotein translocase subunit SecE [Vibrio sinaloensis DSM 21326] Length = 126 Score = 34.7 bits (78), Expect = 3.9, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVI 51 A ++F K+ R E +K+ WP+R E + + ++V L++S V LV+ Sbjct: 68 AAIDFAKESRMEVRKVVWPTRQETMQTTLIV---LAVSIVMALVL 109 >gi|260774685|ref|ZP_05883590.1| preprotein translocase subunit SecE [Vibrio coralliilyticus ATCC BAA-450] gi|260609404|gb|EEX35553.1| preprotein translocase subunit SecE [Vibrio coralliilyticus ATCC BAA-450] Length = 126 Score = 34.7 bits (78), Expect = 3.9, Method: Compositional matrix adjust. Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 6/62 (9%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLV---IDQSIGWLMHFIL 63 A + F K+ R E +K+ WP+R E +V +I+L++S V L ID + L++F+ Sbjct: 68 AAIEFAKESRMEVRKVVWPTRQE---TVQTTLIVLAVSIVMALALWGIDGIMVRLVNFVT 124 Query: 64 GI 65 G+ Sbjct: 125 GV 126 >gi|94266156|ref|ZP_01289868.1| SecE subunit of protein translocation complex [delta proteobacterium MLMS-1] gi|94272782|ref|ZP_01292184.1| SecE subunit of protein translocation complex [delta proteobacterium MLMS-1] gi|93450013|gb|EAT01402.1| SecE subunit of protein translocation complex [delta proteobacterium MLMS-1] gi|93453271|gb|EAT03720.1| SecE subunit of protein translocation complex [delta proteobacterium MLMS-1] Length = 83 Score = 34.7 bits (78), Expect = 4.0, Method: Compositional matrix adjust. Identities = 15/54 (27%), Positives = 31/54 (57%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F +VR E K+ WP + + ++S VV+ ++ + +++ ID +G ++ IL Sbjct: 29 QFIAEVRQEFGKVVWPGKKQAIMSTTVVMALVIVVAIYLGTIDLVLGKVVGAIL 82 >gi|91774622|ref|YP_544378.1| protein translocase subunit secE/sec61 gamma [Methylobacillus flagellatus KT] gi|91708609|gb|ABE48537.1| protein translocase subunit secE/sec61 gamma [Methylobacillus flagellatus KT] Length = 115 Score = 34.7 bits (78), Expect = 4.0, Method: Compositional matrix adjust. Identities = 14/58 (24%), Positives = 33/58 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 ++F ++ E++K+ WP+R E + + V ++ I ++F ++D W + ++G G Sbjct: 57 ISFAREAVLETRKVVWPTRKETIQTTAAVFGLVIIMAIFLWIVDVGFMWAVKQLMGRG 114 >gi|319791329|ref|YP_004152969.1| preprotein translocase, sece subunit [Variovorax paradoxus EPS] gi|315593792|gb|ADU34858.1| preprotein translocase, SecE subunit [Variovorax paradoxus EPS] Length = 127 Score = 34.7 bits (78), Expect = 4.1, Method: Compositional matrix adjust. Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query: 18 ESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW-LMHFILG 64 E KK+ WP+R E + V ++I SVF + D+++ W ILG Sbjct: 77 EVKKVVWPTRKEAMQMTAYVFAFVAIMSVFLWLTDKTLEWVFFDLILG 124 >gi|294630859|ref|ZP_06709419.1| preprotein translocase subunit SecE [Streptomyces sp. e14] gi|292834192|gb|EFF92541.1| preprotein translocase subunit SecE [Streptomyces sp. e14] Length = 95 Score = 34.7 bits (78), Expect = 4.1, Method: Compositional matrix adjust. Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + RLA+ F++Q+ E +K+ WP+R ++ VVI ++I VID + ++ Sbjct: 36 LKRLAL--FYRQIVAELRKVVWPTRGQLSSYTTVVIFFVAIMIALVTVIDYGLNHAAKYV 93 Query: 63 LG 64 G Sbjct: 94 FG 95 >gi|260655341|ref|ZP_05860829.1| preprotein translocase, SecE subunit [Jonquetella anthropi E3_33 E1] gi|260629789|gb|EEX47983.1| preprotein translocase, SecE subunit [Jonquetella anthropi E3_33 E1] Length = 59 Score = 34.7 bits (78), Expect = 4.1, Method: Compositional matrix adjust. Identities = 19/54 (35%), Positives = 31/54 (57%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F ++ R E KKI WP+R +V S +VVI + + S + ++D + + ILG Sbjct: 6 FIRESRAEFKKITWPTRKQVWYSTLVVIAVTLLLSAYLGILDLILTGVFSKILG 59 >gi|237756124|ref|ZP_04584697.1| preprotein translocase, SecE subunit [Sulfurihydrogenibium yellowstonense SS-5] gi|237691709|gb|EEP60744.1| preprotein translocase, SecE subunit [Sulfurihydrogenibium yellowstonense SS-5] Length = 61 Score = 34.7 bits (78), Expect = 4.2, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 29/44 (65%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 L+F K+V +E KK+ WPS++ V + I VI++ I +++ +D Sbjct: 5 LSFLKEVFEELKKVTWPSKNLVKTATIAVIVLTLIMALYLWSLD 48 >gi|328949289|ref|YP_004366626.1| preprotein translocase, SecE subunit [Treponema succinifaciens DSM 2489] gi|328449613|gb|AEB15329.1| preprotein translocase, SecE subunit [Treponema succinifaciens DSM 2489] Length = 59 Score = 34.7 bits (78), Expect = 4.2, Method: Compositional matrix adjust. Identities = 15/32 (46%), Positives = 21/32 (65%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVII 39 + FFK+ E +K+ WP+RS+VL S VV I Sbjct: 4 IFQFFKECAGELRKVTWPTRSDVLSSTKVVFI 35 >gi|328953171|ref|YP_004370505.1| preprotein translocase, SecE subunit [Desulfobacca acetoxidans DSM 11109] gi|328453495|gb|AEB09324.1| preprotein translocase, SecE subunit [Desulfobacca acetoxidans DSM 11109] Length = 110 Score = 34.7 bits (78), Expect = 4.3, Method: Compositional matrix adjust. Identities = 16/55 (29%), Positives = 32/55 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F ++ E KK+ WP + E L + VVI+++ + S + ++D + L+ +I+G Sbjct: 56 QFIQEAWVELKKVTWPGQKETLGATAVVIVLVFLVSFYLGIVDLGLSRLVKYIIG 110 >gi|1711363|sp|P52853|SECE_STRGB RecName: Full=Preprotein translocase subunit secE gi|1213237|emb|CAA65164.1| membrane translocase [Streptomyces galbus] Length = 94 Score = 34.7 bits (78), Expect = 4.3, Method: Compositional matrix adjust. Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + RLA F++Q+ E +K+ WP+R+++ VVI ++I VID + ++ Sbjct: 35 LKRLAT--FYRQIIAELRKVVWPTRNQLTSYTTVVIFFVAIMIRLVTVIDYGLNHAAKYV 92 Query: 63 LG 64 G Sbjct: 93 FG 94 >gi|262273345|ref|ZP_06051160.1| preprotein translocase subunit SecE [Grimontia hollisae CIP 101886] gi|262222718|gb|EEY74028.1| preprotein translocase subunit SecE [Grimontia hollisae CIP 101886] Length = 123 Score = 34.7 bits (78), Expect = 4.4, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 33/59 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V+ + + ++ ID + L+ I G+ Sbjct: 65 AAITFARESRMEVRKVVWPTRQETLQTTLIVLAVTVVMALILWGIDGIMVRLVRLITGV 123 >gi|86608695|ref|YP_477457.1| preprotein translocase subunit SecE [Synechococcus sp. JA-2-3B'a(2-13)] gi|86557237|gb|ABD02194.1| preprotein translocase, SecE subunit [Synechococcus sp. JA-2-3B'a(2-13)] Length = 90 Score = 34.7 bits (78), Expect = 4.4, Method: Compositional matrix adjust. Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVL-VSVIVVIIMLSISSVFFLVIDQSIGWL 58 + F ++ R E KI WPSR +++ SV V++I+L+ +S +LV DQ W+ Sbjct: 33 GIPGFIQETRTELSKIVWPSRRQLIGESVGVLLIVLAFASFIYLV-DQVFAWV 84 >gi|309379176|emb|CBX22307.1| unnamed protein product [Neisseria lactamica Y92-1009] Length = 92 Score = 34.7 bits (78), Expect = 4.5, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 25/48 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 +F E KK+ WP R + + + VI+ +++ S+F D + WL Sbjct: 35 YFSNSWSEFKKVVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAFSWL 82 >gi|161523415|ref|YP_001578427.1| preprotein translocase subunit SecE [Burkholderia multivorans ATCC 17616] gi|189351812|ref|YP_001947440.1| preprotein translocase subunit SecE [Burkholderia multivorans ATCC 17616] gi|221201551|ref|ZP_03574589.1| preprotein translocase, SecE subunit [Burkholderia multivorans CGD2M] gi|221207374|ref|ZP_03580384.1| preprotein translocase, SecE subunit [Burkholderia multivorans CGD2] gi|221213512|ref|ZP_03586487.1| preprotein translocase, SecE subunit [Burkholderia multivorans CGD1] gi|160340844|gb|ABX13930.1| preprotein translocase, SecE subunit [Burkholderia multivorans ATCC 17616] gi|189335834|dbj|BAG44904.1| preprotein translocase SecE subunit [Burkholderia multivorans ATCC 17616] gi|221166964|gb|EED99435.1| preprotein translocase, SecE subunit [Burkholderia multivorans CGD1] gi|221172962|gb|EEE05399.1| preprotein translocase, SecE subunit [Burkholderia multivorans CGD2] gi|221178367|gb|EEE10776.1| preprotein translocase, SecE subunit [Burkholderia multivorans CGD2M] Length = 126 Score = 34.7 bits (78), Expect = 4.5, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 31/53 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 +++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 66 SLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 118 >gi|167629452|ref|YP_001679951.1| sece subunit of protein translocation complex, putative [Heliobacterium modesticaldum Ice1] gi|167592192|gb|ABZ83940.1| sece subunit of protein translocation complex, putative [Heliobacterium modesticaldum Ice1] Length = 105 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NF + V E KK+ WP+R EV+ VV+ + + V+D+++ + ++ Sbjct: 51 NFARGVASEMKKVHWPTRQEVITYTGVVLTAVVFVAALIFVVDEALSLTLKALI 104 >gi|13880187|gb|AAK44892.1| preprotein translocase SecE subunit [Mycobacterium tuberculosis CDC1551] Length = 80 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query: 3 VNRLA-VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLS 42 VN +A V N+ KQV E +K+ WP+R ++L VV+ L+ Sbjct: 18 VNPIAFVYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLA 58 >gi|21672990|ref|NP_661055.1| preprotein translocase subunit SecE [Chlorobium tepidum TLS] gi|21646052|gb|AAM71397.1| preprotein translocase SecE subunit [Chlorobium tepidum TLS] Length = 63 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 4/55 (7%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +++ V E +K+ WP+R EV IVV+ + I ++F V+D W++ ++G Sbjct: 10 KYYRDVVGEMRKVSWPTREEVKDMTIVVLTVSGILALFTFVVD----WVISTVMG 60 >gi|110801669|ref|YP_699677.1| preprotein translocase subunit SecE [Clostridium perfringens SM101] gi|110682170|gb|ABG85540.1| preprotein translocase, SecE subunit [Clostridium perfringens SM101] Length = 74 Score = 34.7 bits (78), Expect = 4.6, Method: Compositional matrix adjust. Identities = 18/60 (30%), Positives = 29/60 (48%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + FF+ V+ E K+I WP + E ++I VI+ IS V+D L + G+ Sbjct: 14 FGITKFFRGVKAEIKRITWPPKEEAKKAIIAVIVFTVISIALIGVMDFVFKNLFELVFGL 73 >gi|18311401|ref|NP_563335.1| preprotein translocase subunit SecE [Clostridium perfringens str. 13] gi|110799456|ref|YP_697108.1| preprotein translocase subunit SecE [Clostridium perfringens ATCC 13124] gi|18146085|dbj|BAB82125.1| probable protein translocase [Clostridium perfringens str. 13] gi|110674103|gb|ABG83090.1| preprotein translocase, SecE subunit [Clostridium perfringens ATCC 13124] Length = 74 Score = 34.7 bits (78), Expect = 4.7, Method: Compositional matrix adjust. Identities = 18/60 (30%), Positives = 29/60 (48%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + FF+ V+ E K+I WP + E ++I VI+ IS V+D L + G+ Sbjct: 14 FGITKFFRGVKAEIKRITWPPKEEAKKAIIAVIVFTVISIALIGVMDFVFKNLFELVFGL 73 >gi|325529723|gb|EGD06580.1| preprotein translocase subunit SecE [Burkholderia sp. TJI49] Length = 110 Score = 34.7 bits (78), Expect = 4.7, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 31/53 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 +++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 50 SLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 102 >gi|315917858|ref|ZP_07914098.1| predicted protein [Fusobacterium gonidiaformans ATCC 25563] gi|317059455|ref|ZP_07923940.1| predicted protein [Fusobacterium sp. 3_1_5R] gi|313685131|gb|EFS21966.1| predicted protein [Fusobacterium sp. 3_1_5R] gi|313691733|gb|EFS28568.1| predicted protein [Fusobacterium gonidiaformans ATCC 25563] Length = 78 Score = 34.7 bits (78), Expect = 4.7, Method: Compositional matrix adjust. Identities = 14/45 (31%), Positives = 28/45 (62%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +++ F+ VR E K+ WP + +++ S + V++M I S++ V D Sbjct: 18 LMSLFQDVRKEYSKVQWPKKKDIISSTVWVVVMAVILSIYLGVFD 62 >gi|171319352|ref|ZP_02908462.1| preprotein translocase, SecE subunit [Burkholderia ambifaria MEX-5] gi|171095423|gb|EDT40395.1| preprotein translocase, SecE subunit [Burkholderia ambifaria MEX-5] Length = 126 Score = 34.7 bits (78), Expect = 4.8, Method: Compositional matrix adjust. Identities = 16/59 (27%), Positives = 31/59 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M ++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 60 MSAPGKGLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 118 >gi|167587785|ref|ZP_02380173.1| preprotein translocase subunit SecE [Burkholderia ubonensis Bu] Length = 110 Score = 34.7 bits (78), Expect = 4.8, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 31/53 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 +++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 50 SLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 102 >gi|70727473|ref|YP_254389.1| preprotein translocase subunit SecE [Staphylococcus haemolyticus JCSC1435] gi|68448199|dbj|BAE05783.1| preprotein translocase subunit SecE [Staphylococcus haemolyticus JCSC1435] Length = 66 Score = 34.7 bits (78), Expect = 4.8, Method: Compositional matrix adjust. Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 G N+ +FF+ V+ E +K WP++ E+ ++V+ + VFF V+D IG L+ Sbjct: 6 GTNK-EKDSFFQGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFMVFFWVLDIGIGNLIE 63 >gi|107024317|ref|YP_622644.1| preprotein translocase subunit SecE [Burkholderia cenocepacia AU 1054] gi|116688358|ref|YP_833981.1| preprotein translocase subunit SecE [Burkholderia cenocepacia HI2424] gi|170731668|ref|YP_001763615.1| preprotein translocase subunit SecE [Burkholderia cenocepacia MC0-3] gi|254246608|ref|ZP_04939929.1| SecE subunit of protein translocation complex [Burkholderia cenocepacia PC184] gi|105894506|gb|ABF77671.1| protein translocase subunit secE/sec61 gamma [Burkholderia cenocepacia AU 1054] gi|116646447|gb|ABK07088.1| protein translocase subunit secE/sec61 gamma [Burkholderia cenocepacia HI2424] gi|124871384|gb|EAY63100.1| SecE subunit of protein translocation complex [Burkholderia cenocepacia PC184] gi|169814910|gb|ACA89493.1| preprotein translocase, SecE subunit [Burkholderia cenocepacia MC0-3] Length = 126 Score = 34.7 bits (78), Expect = 4.8, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 31/53 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 +++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 66 SLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 118 >gi|78064910|ref|YP_367679.1| preprotein translocase subunit SecE [Burkholderia sp. 383] gi|134294429|ref|YP_001118164.1| preprotein translocase subunit SecE [Burkholderia vietnamiensis G4] gi|206558627|ref|YP_002229387.1| preprotein translocase subunit SecE [Burkholderia cenocepacia J2315] gi|77965655|gb|ABB07035.1| protein translocase subunit secE/sec61 gamma [Burkholderia sp. 383] gi|134137586|gb|ABO53329.1| protein translocase subunit secE/sec61 gamma [Burkholderia vietnamiensis G4] gi|198034664|emb|CAR50531.1| preprotein translocase SecE subunit [Burkholderia cenocepacia J2315] Length = 126 Score = 34.7 bits (78), Expect = 4.9, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 31/53 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 +++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 66 SLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 118 >gi|187925630|ref|YP_001897272.1| preprotein translocase subunit SecE [Burkholderia phytofirmans PsJN] gi|187716824|gb|ACD18048.1| preprotein translocase, SecE subunit [Burkholderia phytofirmans PsJN] Length = 126 Score = 34.7 bits (78), Expect = 4.9, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW-LMHFILG 64 + F K E +K+ WP+R E + +VV + + ++F + D+SI W + ILG Sbjct: 68 IAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVFVMAIFLWIGDKSIEWAIFSVILG 124 >gi|115350308|ref|YP_772147.1| preprotein translocase subunit SecE [Burkholderia ambifaria AMMD] gi|170701414|ref|ZP_02892372.1| preprotein translocase, SecE subunit [Burkholderia ambifaria IOP40-10] gi|172059327|ref|YP_001806979.1| preprotein translocase subunit SecE [Burkholderia ambifaria MC40-6] gi|115280296|gb|ABI85813.1| protein translocase subunit secE/sec61 gamma [Burkholderia ambifaria AMMD] gi|170133666|gb|EDT02036.1| preprotein translocase, SecE subunit [Burkholderia ambifaria IOP40-10] gi|171991844|gb|ACB62763.1| preprotein translocase, SecE subunit [Burkholderia ambifaria MC40-6] Length = 126 Score = 34.7 bits (78), Expect = 4.9, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 30/53 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 ++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 66 GLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 118 >gi|284047640|ref|YP_003397979.1| preprotein translocase, SecE subunit [Acidaminococcus fermentans DSM 20731] gi|283951861|gb|ADB46664.1| preprotein translocase, SecE subunit [Acidaminococcus fermentans DSM 20731] Length = 74 Score = 34.7 bits (78), Expect = 4.9, Method: Compositional matrix adjust. Identities = 18/65 (27%), Positives = 35/65 (53%), Gaps = 2/65 (3%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFL-VIDQSIGWLMH 60 G + F ++V+ E KK+ WP++ E L+ V +I+ S+ + F + ID + L Sbjct: 10 GKSTPGTGGFLREVKTEMKKVTWPTKRE-LIGYTVTVILSSLFAAFLIWAIDAILSVLFR 68 Query: 61 FILGI 65 ++G+ Sbjct: 69 LVMGV 73 >gi|257452913|ref|ZP_05618212.1| protein translocase subunit SecE [Fusobacterium sp. 3_1_5R] gi|257466706|ref|ZP_05631017.1| protein translocase subunit SecE [Fusobacterium gonidiaformans ATCC 25563] Length = 60 Score = 34.7 bits (78), Expect = 4.9, Method: Compositional matrix adjust. Identities = 14/44 (31%), Positives = 27/44 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 ++ F+ VR E K+ WP + +++ S + V++M I S++ V D Sbjct: 1 MSLFQDVRKEYSKVQWPKKKDIISSTVWVVVMAVILSIYLGVFD 44 >gi|87300787|ref|ZP_01083629.1| putative preprotein translocase, SecE subunit [Synechococcus sp. WH 5701] gi|87284658|gb|EAQ76610.1| putative preprotein translocase, SecE subunit [Synechococcus sp. WH 5701] Length = 82 Score = 34.7 bits (78), Expect = 4.9, Method: Compositional matrix adjust. Identities = 15/50 (30%), Positives = 27/50 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 V F +E +K+ WPSR ++ + VI+M+S+S+ +D+ W Sbjct: 26 VGGFVSSTLEELRKVVWPSRQQLFSESVAVILMVSLSAATIAAVDRFYSW 75 >gi|269962514|ref|ZP_06176862.1| translocase [Vibrio harveyi 1DA3] gi|269832709|gb|EEZ86820.1| translocase [Vibrio harveyi 1DA3] Length = 126 Score = 34.7 bits (78), Expect = 5.0, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVI 51 A ++F K+ R E +K+ WP+R E + + ++V L++S V LV+ Sbjct: 68 AAISFAKESRMEVRKVVWPTRQETMQTTLIV---LAVSIVMALVL 109 >gi|257869762|ref|ZP_05649415.1| predicted protein [Enterococcus gallinarum EG2] gi|257803926|gb|EEV32748.1| predicted protein [Enterococcus gallinarum EG2] Length = 56 Score = 34.7 bits (78), Expect = 5.0, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +NF K V E K + WPSR ++ VVI I +V F V+D I + IL Sbjct: 1 MNFMKNVFAEMKNVSWPSRKQLRRDTFVVIQTTIIFAVMFFVMDTLIQTVFDLILK 56 >gi|262392941|ref|YP_003284795.1| preprotein translocase subunit SecE [Vibrio sp. Ex25] gi|7994688|sp|Q9ZNE7|SECE_VIBAL RecName: Full=Preprotein translocase subunit secE gi|3810893|dbj|BAA34065.1| preprotein translocase SecE subunit [Vibrio alginolyticus] gi|262336535|gb|ACY50330.1| preprotein translocase subunit SecE [Vibrio sp. Ex25] Length = 126 Score = 34.3 bits (77), Expect = 5.2, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVI 51 A ++F K+ R E +K+ WP+R E + + ++V L++S V LV+ Sbjct: 68 AAISFAKESRMEVRKVVWPTRQETMQTTLIV---LAVSIVMALVL 109 >gi|28899702|ref|NP_799307.1| preprotein translocase subunit SecE [Vibrio parahaemolyticus RIMD 2210633] gi|260878170|ref|ZP_05890525.1| preprotein translocase, SecE subunit [Vibrio parahaemolyticus AN-5034] gi|269965854|ref|ZP_06179948.1| translocase [Vibrio alginolyticus 40B] gi|28807954|dbj|BAC61191.1| preprotein translocase, SecE subunit [Vibrio parahaemolyticus RIMD 2210633] gi|269829518|gb|EEZ83758.1| translocase [Vibrio alginolyticus 40B] gi|308090233|gb|EFO39928.1| preprotein translocase, SecE subunit [Vibrio parahaemolyticus AN-5034] gi|328471077|gb|EGF41983.1| preprotein translocase subunit SecE [Vibrio parahaemolyticus 10329] Length = 126 Score = 34.3 bits (77), Expect = 5.2, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 3/45 (6%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVI 51 A ++F K+ R E +K+ WP+R E + + ++V L++S V LV+ Sbjct: 68 AAISFAKESRMEVRKVVWPTRQETMQTTLIV---LAVSIVMALVL 109 >gi|72383409|ref|YP_292764.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. NATL2A] gi|72003259|gb|AAZ59061.1| protein translocase subunit secE/sec61 gamma [Prochlorococcus marinus str. NATL2A] Length = 80 Score = 34.3 bits (77), Expect = 5.3, Method: Compositional matrix adjust. Identities = 15/48 (31%), Positives = 27/48 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 +F DE K + WPSR ++ + VI+M+++S+V + + GW Sbjct: 26 SFLSSTIDEMKLVVWPSRQQLFSESVAVILMVTLSAVSIAAVSRFYGW 73 >gi|296333097|ref|ZP_06875551.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305672799|ref|YP_003864470.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. spizizenii str. W23] gi|296149713|gb|EFG90608.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305411042|gb|ADM36160.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. spizizenii str. W23] Length = 59 Score = 34.3 bits (77), Expect = 5.3, Method: Compositional matrix adjust. Identities = 19/58 (32%), Positives = 30/58 (51%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ FFK V E KK+ WP E+ I VI + +FF ++D I L+ I+ Sbjct: 1 MRIMRFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFILFFALLDTGISQLIRLIV 58 >gi|168830298|gb|ACA34395.1| SecE [uncultured bacterium pTW2] Length = 127 Score = 34.3 bits (77), Expect = 5.3, Method: Compositional matrix adjust. Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 4/54 (7%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVS---VIVVIIMLSISSVFFLVIDQS-IGWLM 59 F + R E +K+ WP+R E S VI V+I++S+ FF VI Q+ + W + Sbjct: 72 EFLSEARFELRKVVWPTRQEATRSTWVVIAVVILISLVLAFFDVIVQTAVKWFL 125 >gi|254449087|ref|ZP_05062539.1| preprotein translocase, SecE subunit [gamma proteobacterium HTCC5015] gi|198261279|gb|EDY85572.1| preprotein translocase, SecE subunit [gamma proteobacterium HTCC5015] Length = 122 Score = 34.3 bits (77), Expect = 5.3, Method: Compositional matrix adjust. Identities = 16/55 (29%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + R E KK+ WP+R E ++++V + + S++ L+ D GW + +LG Sbjct: 68 GYLRASRAELKKVVWPTRQEAFQTLLLVAVFTGVLSLYLLLCDLLAGWGVETLLG 122 >gi|183597451|ref|ZP_02958944.1| hypothetical protein PROSTU_00724 [Providencia stuartii ATCC 25827] gi|188023200|gb|EDU61240.1| hypothetical protein PROSTU_00724 [Providencia stuartii ATCC 25827] Length = 128 Score = 34.3 bits (77), Expect = 5.3, Method: Compositional matrix adjust. Identities = 13/45 (28%), Positives = 27/45 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 L+F ++ R E +K+ WP+R E L + ++V + ++ S+ +D Sbjct: 68 ALSFAREARIEMRKVIWPTRQEALQTTLIVAAVTAVMSLILWGLD 112 >gi|269959045|ref|YP_003328834.1| preprotein translocase subunit SecE [Anaplasma centrale str. Israel] gi|269848876|gb|ACZ49520.1| preprotein translocase subunit SecE [Anaplasma centrale str. Israel] Length = 70 Score = 34.3 bits (77), Expect = 5.4, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 33/56 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F VR E ++ W S+ EVLV +++V++ + +SS+ F +D L+ +LG+ Sbjct: 11 RFLCDVRQEVLQVSWASKREVLVFLLIVLMTVVVSSILFSCVDFVFLRLVKIVLGV 66 >gi|78187810|ref|YP_375853.1| preprotein translocase subunit SecE [Chlorobium luteolum DSM 273] gi|78167712|gb|ABB24810.1| protein translocase subunit secE/sec61 gamma [Chlorobium luteolum DSM 273] Length = 63 Score = 34.3 bits (77), Expect = 5.4, Method: Compositional matrix adjust. Identities = 14/55 (25%), Positives = 34/55 (61%), Gaps = 4/55 (7%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +++ V E +K+ WPS+ E+ +VV+ + + ++F ++D W+++F++G Sbjct: 10 QYYRDVVAEMRKVVWPSKEELKDLTVVVLTVSGLLALFTFLVD----WVINFVMG 60 >gi|42527928|ref|NP_973026.1| preprotein translocase subunit SecE [Treponema denticola ATCC 35405] gi|41818973|gb|AAS12945.1| preprotein translocase, SecE subunit [Treponema denticola ATCC 35405] gi|325474847|gb|EGC78033.1| preprotein translocase [Treponema denticola F0402] Length = 59 Score = 34.3 bits (77), Expect = 5.5, Method: Compositional matrix adjust. Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 4/53 (7%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID----QSIGWL 58 F+K+ E +K+ WP+ SEV SV VV+I I +VF +D +GW+ Sbjct: 6 TFWKECIGELRKVVWPTASEVGSSVKVVLISTLIVAVFLGGLDAFFIACVGWI 58 >gi|239813601|ref|YP_002942511.1| preprotein translocase subunit SecE [Variovorax paradoxus S110] gi|239800178|gb|ACS17245.1| preprotein translocase, SecE subunit [Variovorax paradoxus S110] Length = 127 Score = 34.3 bits (77), Expect = 5.5, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Query: 18 ESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL-MHFILG 64 E KK+ WP+R E + V +++ SVF + D+++ W+ ILG Sbjct: 77 EVKKVVWPTRKEAMQMTAYVFAFVAVMSVFLWLTDKTLEWVFFDLILG 124 >gi|313892994|ref|ZP_07826571.1| preprotein translocase, SecE subunit [Veillonella sp. oral taxon 158 str. F0412] gi|313442347|gb|EFR60762.1| preprotein translocase, SecE subunit [Veillonella sp. oral taxon 158 str. F0412] Length = 73 Score = 34.3 bits (77), Expect = 5.7, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID----QSIGWLMHFI 62 FF+ V+ E KK+ WP++ E++ IVV ++ ++ V+D Q L+HF+ Sbjct: 16 KFFRGVKAELKKVVWPTKKELINYTIVVFLVTIFIALVIAVLDGLFAQLFNTLLHFV 72 >gi|119478594|ref|ZP_01618516.1| translocase [marine gamma proteobacterium HTCC2143] gi|119448429|gb|EAW29679.1| translocase [marine gamma proteobacterium HTCC2143] Length = 122 Score = 34.3 bits (77), Expect = 5.7, Method: Compositional matrix adjust. Identities = 16/52 (30%), Positives = 31/52 (59%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ R E +K+ WP+R E + +V++ + ++SV +D +GWL+ +G Sbjct: 71 KEARTEIRKVVWPTRQEATQTTFIVVVFVLVTSVILWGLDSLLGWLVSLAIG 122 >gi|221069404|ref|ZP_03545509.1| preprotein translocase, SecE subunit [Comamonas testosteroni KF-1] gi|220714427|gb|EED69795.1| preprotein translocase, SecE subunit [Comamonas testosteroni KF-1] Length = 127 Score = 34.3 bits (77), Expect = 5.7, Method: Compositional matrix adjust. Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH-FILG 64 + F + E KK+ WP+R E + + V + + ++F D+++ W+++ ILG Sbjct: 68 IGFARDAWREVKKVVWPTRKETMQMTLYVFAFVVVMALFLWFTDKTLEWVLYDLILG 124 >gi|293391592|ref|ZP_06635926.1| preprotein translocase subunit SecE [Aggregatibacter actinomycetemcomitans D7S-1] gi|290952126|gb|EFE02245.1| preprotein translocase subunit SecE [Aggregatibacter actinomycetemcomitans D7S-1] Length = 136 Score = 34.3 bits (77), Expect = 5.7, Method: Compositional matrix adjust. Identities = 13/30 (43%), Positives = 19/30 (63%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVI 38 L FFK R E +KI WP+R E + ++V+ Sbjct: 78 LGFFKDARTELRKIVWPTRPEATQTTLMVV 107 >gi|261866777|ref|YP_003254699.1| preprotein translocase subunit SecE [Aggregatibacter actinomycetemcomitans D11S-1] gi|261412109|gb|ACX81480.1| preprotein translocase subunit SecE [Aggregatibacter actinomycetemcomitans D11S-1] Length = 136 Score = 34.3 bits (77), Expect = 5.8, Method: Compositional matrix adjust. Identities = 13/30 (43%), Positives = 19/30 (63%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVI 38 L FFK R E +KI WP+R E + ++V+ Sbjct: 78 LGFFKDARTELRKIVWPTRPEATQTTLMVV 107 >gi|251799660|ref|YP_003014391.1| preprotein translocase, SecE subunit [Paenibacillus sp. JDR-2] gi|247547286|gb|ACT04305.1| preprotein translocase, SecE subunit [Paenibacillus sp. JDR-2] Length = 69 Score = 34.3 bits (77), Expect = 5.8, Method: Compositional matrix adjust. Identities = 17/56 (30%), Positives = 32/56 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +FF E KK+ WP+R E+ IVV++ ++ +++F ++D I L++ I Sbjct: 13 TTFSFFADSWAELKKVRWPNRKELTSYSIVVLLTIAFVTIYFWLLDIGISSLVNLI 68 >gi|256390117|ref|YP_003111681.1| preprotein translocase subunit SecE [Catenulispora acidiphila DSM 44928] gi|256356343|gb|ACU69840.1| preprotein translocase, SecE subunit [Catenulispora acidiphila DSM 44928] Length = 89 Score = 34.3 bits (77), Expect = 5.9, Method: Compositional matrix adjust. Identities = 15/54 (27%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+E+ VVI+ ++I +D L+ ++ G Sbjct: 36 FYRQIIAELRKVVWPTRNELTTYTTVVIVFVAIMVGIVATLDYGFSKLVEWVFG 89 >gi|222056718|ref|YP_002539080.1| preprotein translocase, SecE subunit [Geobacter sp. FRC-32] gi|221566007|gb|ACM21979.1| preprotein translocase, SecE subunit [Geobacter sp. FRC-32] Length = 61 Score = 34.3 bits (77), Expect = 5.9, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 33/54 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NF ++VR E K+ WP+R E + + VV++++ + S++ D + L+ FIL Sbjct: 7 NFLEEVRAELGKVTWPARKETISTAWVVVVIIVLISLYLGACDVVLAKLIRFIL 60 >gi|254253529|ref|ZP_04946847.1| SecE subunit of protein translocation complex [Burkholderia dolosa AUO158] gi|124896138|gb|EAY70018.1| SecE subunit of protein translocation complex [Burkholderia dolosa AUO158] Length = 126 Score = 34.3 bits (77), Expect = 5.9, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 31/53 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 +++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 66 SLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 118 >gi|121609217|ref|YP_997024.1| preprotein translocase subunit SecE [Verminephrobacter eiseniae EF01-2] gi|121553857|gb|ABM58006.1| protein translocase subunit secE/sec61 gamma [Verminephrobacter eiseniae EF01-2] Length = 144 Score = 34.3 bits (77), Expect = 6.0, Method: Compositional matrix adjust. Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH-FILGIGR 67 L F + E K+ WP+R E L V + + ++F + D+++ W+++ ILG R Sbjct: 84 LAFARDAWHEVGKVVWPTRKEALQMTAYVFAFVVVMALFLWLTDKTLEWVLYDLILGWKR 143 >gi|317485863|ref|ZP_07944725.1| preprotein translocase [Bilophila wadsworthia 3_1_6] gi|316922878|gb|EFV44102.1| preprotein translocase [Bilophila wadsworthia 3_1_6] Length = 80 Score = 34.3 bits (77), Expect = 6.0, Method: Compositional matrix adjust. Identities = 15/55 (27%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 N+ + + E +K+ WP+ E + +VV+ + + ++F V+D + L+ FIL Sbjct: 25 NYLELSKTELRKVTWPTVKETRTTSLVVLAFVVVMAIFLGVVDLGLSKLISFILA 79 >gi|310659521|ref|YP_003937242.1| preprotein translocase subunit [Clostridium sticklandii DSM 519] gi|308826299|emb|CBH22337.1| preprotein translocase subunit [Clostridium sticklandii] Length = 68 Score = 34.3 bits (77), Expect = 6.1, Method: Compositional matrix adjust. Identities = 16/54 (29%), Positives = 31/54 (57%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ R E KK+ WPSR E+ +VI + I S+ +ID +G+++ ++ + Sbjct: 15 LRETRTELKKVHWPSRKELTNYTWIVIFSVFIVSLIIYLIDSGLGFIIEKVISL 68 >gi|302390621|ref|YP_003826442.1| preprotein translocase, SecE subunit [Thermosediminibacter oceani DSM 16646] gi|302201249|gb|ADL08819.1| preprotein translocase, SecE subunit [Thermosediminibacter oceani DSM 16646] Length = 68 Score = 34.3 bits (77), Expect = 6.1, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 30/44 (68%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQ 53 FFK+VR E KK+ WP+R E++ IVV++ +++ S F ++D Sbjct: 14 RFFKEVRSELKKVTWPTRDELVSYTIVVLVSVALVSGFIWIVDS 57 >gi|261254084|ref|ZP_05946657.1| preprotein translocase subunit SecE [Vibrio orientalis CIP 102891] gi|260937475|gb|EEX93464.1| preprotein translocase subunit SecE [Vibrio orientalis CIP 102891] Length = 126 Score = 34.3 bits (77), Expect = 6.1, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 3/45 (6%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVI 51 A + F K+ R E +K+ WP+R E + + ++V L++S V LV+ Sbjct: 68 AAIEFAKESRMEVRKVVWPTRQETMQTTLIV---LAVSIVMALVL 109 >gi|148273973|ref|YP_001223534.1| preprotein translocase subunit SecE [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|170782937|ref|YP_001711271.1| preprotein translocase subunit SecE [Clavibacter michiganensis subsp. sepedonicus] gi|147831903|emb|CAN02874.1| putative preprotein translocase subunit [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|169157507|emb|CAQ02698.1| preprotein translocase SecE subunit [Clavibacter michiganensis subsp. sepedonicus] Length = 90 Score = 34.3 bits (77), Expect = 6.2, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 30/56 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F KQV E KK+ P+R E+L VV+ + + V ++DQ G+L + G G Sbjct: 34 FIKQVVQELKKVVTPTRKELLTFTGVVLAFVIVMMVIVSLLDQLFGYLAIVVFGNG 89 >gi|288926254|ref|ZP_06420179.1| preprotein translocase, SecE subunit [Prevotella buccae D17] gi|315606520|ref|ZP_07881535.1| preprotein translocase [Prevotella buccae ATCC 33574] gi|288336945|gb|EFC75306.1| preprotein translocase, SecE subunit [Prevotella buccae D17] gi|315251926|gb|EFU31900.1| preprotein translocase [Prevotella buccae ATCC 33574] Length = 62 Score = 34.3 bits (77), Expect = 6.3, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Query: 8 VLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 ++N+ K DE + K WP+ E+ S +VV+ I +V ++D GW+M Sbjct: 4 IVNYCKACYDELAHKTTWPTLPELTHSAVVVLSASLIIAVVVFLMDSVFGWIM 56 >gi|264676488|ref|YP_003276394.1| preprotein translocase, SecE subunit [Comamonas testosteroni CNB-2] gi|262207000|gb|ACY31098.1| preprotein translocase, SecE subunit [Comamonas testosteroni CNB-2] Length = 127 Score = 34.3 bits (77), Expect = 6.4, Method: Compositional matrix adjust. Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH-FILG 64 + F + E KK+ WP+R E + + V + + ++F D+++ W+++ ILG Sbjct: 68 IGFARDAWREVKKVVWPTRKETMQMTLYVFAFVVVMALFLWFTDKTLEWVLYDLILG 124 >gi|148657430|ref|YP_001277635.1| preprotein translocase subunit SecE [Roseiflexus sp. RS-1] gi|148569540|gb|ABQ91685.1| protein translocase subunit secE/sec61 gamma [Roseiflexus sp. RS-1] Length = 84 Score = 34.3 bits (77), Expect = 6.5, Method: Compositional matrix adjust. Identities = 14/50 (28%), Positives = 26/50 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 ++ ++ R E +K+ WP+R E + +VVI++ +I S D W Sbjct: 23 IVQPLRESRAEMRKVVWPTREETIRLTVVVILLSAIMSAILFAADALFSW 72 >gi|323492148|ref|ZP_08097309.1| preprotein translocase subunit SecE [Vibrio brasiliensis LMG 20546] gi|323313599|gb|EGA66702.1| preprotein translocase subunit SecE [Vibrio brasiliensis LMG 20546] Length = 126 Score = 34.3 bits (77), Expect = 6.6, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 3/45 (6%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVI 51 A + F K+ R E +K+ WP+R E + + ++V L++S V LV+ Sbjct: 68 AAIEFAKESRMEVRKVVWPTRQETMQTTLIV---LAVSIVMALVL 109 >gi|284106471|ref|ZP_06386257.1| Protein secE/sec61-gamma protein [Candidatus Poribacteria sp. WGA-A3] gi|283830067|gb|EFC34338.1| Protein secE/sec61-gamma protein [Candidatus Poribacteria sp. WGA-A3] Length = 63 Score = 33.9 bits (76), Expect = 6.6, Method: Compositional matrix adjust. Identities = 18/56 (32%), Positives = 32/56 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F +V+ E KK+ +P+R E + S VV++ I S++ + D + WL+ IL Sbjct: 8 IAEFLIEVKGELKKVSYPTRDETIGSTSVVVVFCFIMSLYLSMTDSILVWLVSRIL 63 >gi|241890073|ref|ZP_04777371.1| preprotein translocase, SecE subunit [Gemella haemolysans ATCC 10379] gi|241863695|gb|EER68079.1| preprotein translocase, SecE subunit [Gemella haemolysans ATCC 10379] Length = 57 Score = 33.9 bits (76), Expect = 6.6, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI-GWLMHF 61 + F K V E +K+ WP+ SE++ ++VI+++ I +F V+D I + HF Sbjct: 2 IRFLKNVATEMRKVSWPTFSELVRKTLIVIVVVGILMLFSYVVDLGITAGIRHF 55 >gi|226951780|ref|ZP_03822244.1| preprotein translocase subunit SecE [Acinetobacter sp. ATCC 27244] gi|294649028|ref|ZP_06726474.1| preprotein translocase subunit SecE [Acinetobacter haemolyticus ATCC 19194] gi|226837320|gb|EEH69703.1| preprotein translocase subunit SecE [Acinetobacter sp. ATCC 27244] gi|292825059|gb|EFF83816.1| preprotein translocase subunit SecE [Acinetobacter haemolyticus ATCC 19194] Length = 146 Score = 33.9 bits (76), Expect = 6.7, Method: Compositional matrix adjust. Identities = 11/51 (21%), Positives = 29/51 (56%) Query: 14 QVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R E +++ WP++ E + + V++++ ++++ D +GW + I+G Sbjct: 96 DARIELRRVAWPTKQETMTTSWQVLVVVIVTAIVLWCFDYGLGWFIKLIIG 146 >gi|78484627|ref|YP_390552.1| SecE subunit of protein translocation complex [Thiomicrospira crunogena XCL-2] gi|78362913|gb|ABB40878.1| protein translocase subunit secE/sec61 gamma [Thiomicrospira crunogena XCL-2] Length = 132 Score = 33.9 bits (76), Expect = 6.7, Method: Compositional matrix adjust. Identities = 13/57 (22%), Positives = 30/57 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 ++ + E K++ WP+R E + ++V ++ + S+F ++D W + + G G Sbjct: 75 SYLSHAQKEVKQVIWPTRQETVQMTLIVFAVVIVMSIFLWLVDMFFLWAVQMLTGQG 131 >gi|241765522|ref|ZP_04763484.1| preprotein translocase, SecE subunit [Acidovorax delafieldii 2AN] gi|241364679|gb|EER59704.1| preprotein translocase, SecE subunit [Acidovorax delafieldii 2AN] Length = 128 Score = 33.9 bits (76), Expect = 6.8, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH-FILG 64 F + E KK+ WP+R E L V + I ++F D+++ W+++ ILG Sbjct: 70 FARDAWREVKKVVWPTRKETLQMTAYVFAFVVIMALFLWFTDKTLEWVLYDLILG 124 >gi|291544033|emb|CBL17142.1| preprotein translocase, SecE subunit, bacterial [Ruminococcus sp. 18P13] Length = 80 Score = 33.9 bits (76), Expect = 6.9, Method: Compositional matrix adjust. Identities = 12/49 (24%), Positives = 30/49 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 + +F+ ++ E KK+ WP+R V + +VV++ + ++++F +D + Sbjct: 22 GIAKWFRDLKSEFKKVSWPTRKTVFDNTVVVLVTMLLTALFVGGLDAGL 70 >gi|307543812|ref|YP_003896291.1| preprotein translocase subunit SecE [Halomonas elongata DSM 2581] gi|307215836|emb|CBV41106.1| preprotein translocase subunit SecE [Halomonas elongata DSM 2581] Length = 122 Score = 33.9 bits (76), Expect = 7.0, Method: Compositional matrix adjust. Identities = 13/57 (22%), Positives = 32/57 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +L + + E +++ WP+R E + + +V++ + + + +ID +GW M ++G Sbjct: 66 LLELARNAKKEIQRVVWPTRPETIQTTAIVLVAVLVVGLVLWLIDTLLGWAMSGVIG 122 >gi|299531365|ref|ZP_07044775.1| preprotein translocase subunit SecE [Comamonas testosteroni S44] gi|298720772|gb|EFI61719.1| preprotein translocase subunit SecE [Comamonas testosteroni S44] Length = 93 Score = 33.9 bits (76), Expect = 7.3, Method: Compositional matrix adjust. Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH-FILG 64 F + E KK+ WP+R E + + V + + ++F D+++ W+++ ILG Sbjct: 35 GFARDAWREVKKVVWPTRKETMQMTLYVFAFVVVMALFLWFTDKTLEWVLYDLILG 90 >gi|308231605|ref|ZP_07413085.2| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu001] gi|308370465|ref|ZP_07421608.2| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu003] gi|308375216|ref|ZP_07443127.2| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu007] gi|308376462|ref|ZP_07438919.2| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu008] gi|308377482|ref|ZP_07479320.2| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu009] gi|308379831|ref|ZP_07487747.2| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu011] gi|308216641|gb|EFO76040.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu001] gi|308331947|gb|EFP20798.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu003] gi|308347107|gb|EFP35958.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu007] gi|308351050|gb|EFP39901.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu008] gi|308355682|gb|EFP44533.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu009] gi|308363493|gb|EFP52344.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu011] Length = 132 Score = 33.9 bits (76), Expect = 7.4, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query: 3 VNRLA-VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLS 42 VN +A V N+ KQV E +K+ WP+R ++L VV+ L+ Sbjct: 70 VNPIAFVYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLA 110 >gi|258512685|ref|YP_003186119.1| preprotein translocase, SecE subunit [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] gi|257479411|gb|ACV59730.1| preprotein translocase, SecE subunit [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] Length = 85 Score = 33.9 bits (76), Expect = 7.4, Method: Compositional matrix adjust. Identities = 17/60 (28%), Positives = 28/60 (46%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 R ++ FFK+ E K++ WP R EV+V +++ +I V D + M I Sbjct: 23 AKRTGIVAFFKESFRELKRVRWPKRREVIVYTAACLLVCAILGVLIWAFDIGVSAAMSAI 82 >gi|220927764|ref|YP_002504673.1| preprotein translocase, SecE subunit [Clostridium cellulolyticum H10] gi|219998092|gb|ACL74693.1| preprotein translocase, SecE subunit [Clostridium cellulolyticum H10] Length = 76 Score = 33.9 bits (76), Expect = 7.4, Method: Compositional matrix adjust. Identities = 13/46 (28%), Positives = 27/46 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 ++ +K++R E KK+ WP+R++++ + + V+I I V D Sbjct: 18 GIVRLYKEIRAELKKVIWPNRTQLINNTVTVLIFCLIVGTIIWVAD 63 >gi|118602794|ref|YP_904009.1| protein translocase subunit secE/sec61 gamma [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] gi|118567733|gb|ABL02538.1| protein translocase subunit secE/sec61 gamma [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] Length = 123 Score = 33.9 bits (76), Expect = 7.6, Method: Compositional matrix adjust. Identities = 11/53 (20%), Positives = 32/53 (60%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +F + + E +K+ WP+R E + + ++++ + I ++F ++D + W++ + Sbjct: 69 SFLIETKIELRKVVWPTRDETIKTTGMIMVAVVIVAIFLWIVDMLLSWMVQLL 121 >gi|318040712|ref|ZP_07972668.1| preprotein translocase subunit SecE [Synechococcus sp. CB0101] Length = 53 Score = 33.9 bits (76), Expect = 7.6, Method: Compositional matrix adjust. Identities = 13/41 (31%), Positives = 25/41 (60%) Query: 18 ESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 E +K+ WPSR ++ + VI+M+++S+ ID+ W+ Sbjct: 7 ELRKVVWPSRQQLFAESVAVILMVTLSAFAIAAIDRFYSWV 47 >gi|218290030|ref|ZP_03494197.1| preprotein translocase, SecE subunit [Alicyclobacillus acidocaldarius LAA1] gi|218239864|gb|EED07052.1| preprotein translocase, SecE subunit [Alicyclobacillus acidocaldarius LAA1] Length = 77 Score = 33.9 bits (76), Expect = 7.6, Method: Compositional matrix adjust. Identities = 17/60 (28%), Positives = 28/60 (46%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 R ++ FFK+ E K++ WP R EV+V +++ +I V D + M I Sbjct: 15 AKRTGIVAFFKESFRELKRVRWPKRREVIVYTAACLLVCAILGVLIWAFDIGVSAAMSAI 74 >gi|167768206|ref|ZP_02440259.1| hypothetical protein CLOSS21_02762 [Clostridium sp. SS2/1] gi|167709730|gb|EDS20309.1| hypothetical protein CLOSS21_02762 [Clostridium sp. SS2/1] gi|291560225|emb|CBL39025.1| preprotein translocase, SecE subunit, bacterial [butyrate-producing bacterium SSC/2] Length = 65 Score = 33.9 bits (76), Expect = 7.7, Method: Compositional matrix adjust. Identities = 16/62 (25%), Positives = 32/62 (51%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 N+ ++FK+++ E +I WP++ + VV+I I V V+D I + + + Sbjct: 4 TNKAKKTSWFKELKAEFNRIIWPTKERIAKETAVVVICAIIIGVIVAVLDVGIQYGIQAL 63 Query: 63 LG 64 +G Sbjct: 64 VG 65 >gi|258647514|ref|ZP_05734983.1| preprotein translocase, SecE subunit [Prevotella tannerae ATCC 51259] gi|260852287|gb|EEX72156.1| preprotein translocase, SecE subunit [Prevotella tannerae ATCC 51259] Length = 64 Score = 33.9 bits (76), Expect = 7.9, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 8 VLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + K+ +E + K WP+R E+ + IVV++ + ++ V+D + +LM FI Sbjct: 5 IITYCKESYEELAYKTTWPTRRELTHTAIVVLVASIVIALMVFVMDTAFDYLMKFI 60 >gi|238018606|ref|ZP_04599032.1| hypothetical protein VEIDISOL_00441 [Veillonella dispar ATCC 17748] gi|237865077|gb|EEP66367.1| hypothetical protein VEIDISOL_00441 [Veillonella dispar ATCC 17748] Length = 73 Score = 33.9 bits (76), Expect = 8.0, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 4/57 (7%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID----QSIGWLMHFI 62 FF+ V+ E KK+ WP++ E++ IVV ++ + V+D Q L+HF+ Sbjct: 16 KFFRGVKAELKKVVWPTKKELINYTIVVFLVTIFIAFIIYVLDAVFAQLFNTLLHFV 72 >gi|226939173|ref|YP_002794244.1| preprotein translocase subunit SecE [Laribacter hongkongensis HLHK9] gi|226714097|gb|ACO73235.1| SecE [Laribacter hongkongensis HLHK9] Length = 117 Score = 33.9 bits (76), Expect = 8.0, Method: Compositional matrix adjust. Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 4/61 (6%) Query: 10 NFFKQVRD---ESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH-FILGI 65 +F +D E+KK+ WP+R E +V + + + ++F ++D + WL + ILG Sbjct: 57 SFVTYAQDSVGEAKKVVWPTRKEATQLTGLVFLFVLVLALFMWLVDSGLSWLFYDLILGR 116 Query: 66 G 66 G Sbjct: 117 G 117 >gi|302671657|ref|YP_003831617.1| preprotein translocase subunit SecE [Butyrivibrio proteoclasticus B316] gi|302396130|gb|ADL35035.1| preprotein translocase subunit SecE [Butyrivibrio proteoclasticus B316] Length = 87 Score = 33.9 bits (76), Expect = 8.0, Method: Compositional matrix adjust. Identities = 15/58 (25%), Positives = 31/58 (53%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + +FF V+ E KI WP++ +++ V+++ +I V+D + ++FI I Sbjct: 29 IADFFSGVKAEFGKIIWPTKDDIIKQTTAVVVVSAICCALIAVLDIVFEYGVNFITSI 86 >gi|88861454|ref|ZP_01136081.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Pseudoalteromonas tunicata D2] gi|88816536|gb|EAR26364.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Pseudoalteromonas tunicata D2] Length = 125 Score = 33.9 bits (76), Expect = 8.1, Method: Compositional matrix adjust. Identities = 15/57 (26%), Positives = 33/57 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F K+ R E +K+ WP+R E L + +V+I + ++ +D ++ ++ F+ G+ Sbjct: 67 IAFAKEARIEVRKVVWPTRQETLHTTFIVMIATVVMALILWGLDGALFRIVGFLTGL 123 >gi|300871170|ref|YP_003786042.1| putative preprotein translocase subunit SecE [Brachyspira pilosicoli 95/1000] gi|300688870|gb|ADK31541.1| pututative preprotein translocase, subunit SecE [Brachyspira pilosicoli 95/1000] Length = 106 Score = 33.9 bits (76), Expect = 8.2, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 4/58 (6%) Query: 10 NFFKQVRDESKKIF----WPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F + + K++F WP+R EVL +VV+I+L +S+ F D + +L +L Sbjct: 8 KLFNSLEEIKKELFERSVWPTRQEVLNQTVVVVILLILSAAFLGAADYIVTFLTRALL 65 >gi|302337465|ref|YP_003802671.1| preprotein translocase, SecE subunit [Spirochaeta smaragdinae DSM 11293] gi|301634650|gb|ADK80077.1| preprotein translocase, SecE subunit [Spirochaeta smaragdinae DSM 11293] Length = 59 Score = 33.9 bits (76), Expect = 8.2, Method: Compositional matrix adjust. Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 4/44 (9%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVI 51 +L FFK E +++ WPSR EV+ S VVI +S+V F ++ Sbjct: 4 ILQFFKNSYAELRRVVWPSREEVISSTKVVI----VSTVLFALV 43 >gi|215425875|ref|ZP_03423794.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis T92] gi|215429473|ref|ZP_03427392.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis EAS054] gi|219556482|ref|ZP_03535558.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis T17] gi|260199645|ref|ZP_05767136.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis T46] gi|289442032|ref|ZP_06431776.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis T46] gi|289568577|ref|ZP_06448804.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis T17] gi|289749141|ref|ZP_06508519.1| preprotein translocase secE1 [Mycobacterium tuberculosis T92] gi|289752682|ref|ZP_06512060.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis EAS054] gi|289414951|gb|EFD12191.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis T46] gi|289542331|gb|EFD45979.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis T17] gi|289689728|gb|EFD57157.1| preprotein translocase secE1 [Mycobacterium tuberculosis T92] gi|289693269|gb|EFD60698.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis EAS054] Length = 161 Score = 33.9 bits (76), Expect = 8.3, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Query: 3 VNRLA-VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLS 42 VN +A V N+ KQV E +K+ WP+R + L VV+ L+ Sbjct: 99 VNPIAFVYNYLKQVVAEMRKVIWPNRKQTLTYTSVVLAFLA 139 >gi|269469124|gb|EEZ80672.1| hypothetical protein Sup05_0529 [uncultured SUP05 cluster bacterium] Length = 129 Score = 33.9 bits (76), Expect = 8.5, Method: Compositional matrix adjust. Identities = 12/42 (28%), Positives = 28/42 (66%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 FFK+ + E +K+ WP+R E + + ++++ + I ++F ++D Sbjct: 70 FFKETKIELRKVVWPNREETVKTTGMIMVAVVIVAIFLWIVD 111 >gi|291613223|ref|YP_003523380.1| preprotein translocase, SecE subunit [Sideroxydans lithotrophicus ES-1] gi|291583335|gb|ADE10993.1| preprotein translocase, SecE subunit [Sideroxydans lithotrophicus ES-1] Length = 115 Score = 33.9 bits (76), Expect = 8.5, Method: Compositional matrix adjust. Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 3/57 (5%) Query: 11 FFKQVRD---ESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF D E+K++ WPSR E + + VV++ + ++F +D S+ +++ ++G Sbjct: 56 FFSFASDSVAEAKRVVWPSRKETIQTTAVVVLFAVVMALFLWAVDASLMVIVNKLMG 112 >gi|269798567|ref|YP_003312467.1| preprotein translocase subunit SecE [Veillonella parvula DSM 2008] gi|282849077|ref|ZP_06258465.1| preprotein translocase, SecE subunit [Veillonella parvula ATCC 17745] gi|269095196|gb|ACZ25187.1| preprotein translocase, SecE subunit [Veillonella parvula DSM 2008] gi|282581195|gb|EFB86590.1| preprotein translocase, SecE subunit [Veillonella parvula ATCC 17745] Length = 73 Score = 33.9 bits (76), Expect = 8.5, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID----QSIGWLMHFI 62 FF+ V+ E KK+ WP++ E++ IVV ++ ++ V+D Q L+HF+ Sbjct: 16 KFFRGVKAELKKVVWPTKKELINYTIVVFLVTIFIALIISVLDGLFAQLFNTLLHFV 72 >gi|150015030|ref|YP_001307284.1| preprotein translocase subunit SecE [Clostridium beijerinckii NCIMB 8052] gi|149901495|gb|ABR32328.1| preprotein translocase, SecE subunit [Clostridium beijerinckii NCIMB 8052] Length = 76 Score = 33.9 bits (76), Expect = 8.5, Method: Compositional matrix adjust. Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 3/40 (7%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEV---LVSVIVVIIMLSI 43 + FF++V+ E KKI WPS+ E V+VIV +M +I Sbjct: 17 GLFGFFREVKVEVKKITWPSKDETKKAFVAVIVFTLMYTI 56 >gi|53723868|ref|YP_104180.1| preprotein translocase subunit SecE [Burkholderia mallei ATCC 23344] gi|121598229|ref|YP_994471.1| preprotein translocase subunit SecE [Burkholderia mallei SAVP1] gi|124384308|ref|YP_001027879.1| preprotein translocase subunit SecE [Burkholderia mallei NCTC 10229] gi|126440191|ref|YP_001060764.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 668] gi|126448578|ref|YP_001082975.1| preprotein translocase subunit SecE [Burkholderia mallei NCTC 10247] gi|126455126|ref|YP_001068052.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 1106a] gi|167721590|ref|ZP_02404826.1| preprotein translocase subunit SecE [Burkholderia pseudomallei DM98] gi|167740564|ref|ZP_02413338.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 14] gi|167847678|ref|ZP_02473186.1| preprotein translocase subunit SecE [Burkholderia pseudomallei B7210] gi|167896250|ref|ZP_02483652.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 7894] gi|167904632|ref|ZP_02491837.1| preprotein translocase subunit SecE [Burkholderia pseudomallei NCTC 13177] gi|217424832|ref|ZP_03456329.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 576] gi|237814162|ref|YP_002898613.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei MSHR346] gi|238563290|ref|ZP_00439116.2| preprotein translocase, SecE subunit [Burkholderia mallei GB8 horse 4] gi|242317494|ref|ZP_04816510.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1106b] gi|254174667|ref|ZP_04881328.1| preprotein translocase, SecE subunit [Burkholderia mallei ATCC 10399] gi|254180329|ref|ZP_04886927.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1655] gi|254198546|ref|ZP_04904967.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei S13] gi|254201251|ref|ZP_04907615.1| preprotein translocase, SecE subunit [Burkholderia mallei FMH] gi|254206592|ref|ZP_04912943.1| preprotein translocase, SecE subunit [Burkholderia mallei JHU] gi|254357133|ref|ZP_04973407.1| preprotein translocase, SecE subunit [Burkholderia mallei 2002721280] gi|52427291|gb|AAU47884.1| preprotein translocase, SecE subunit [Burkholderia mallei ATCC 23344] gi|121227039|gb|ABM49557.1| preprotein translocase, SecE subunit [Burkholderia mallei SAVP1] gi|124292328|gb|ABN01597.1| preprotein translocase, SecE subunit [Burkholderia mallei NCTC 10229] gi|126219684|gb|ABN83190.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 668] gi|126228768|gb|ABN92308.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1106a] gi|126241448|gb|ABO04541.1| preprotein translocase, SecE subunit [Burkholderia mallei NCTC 10247] gi|147747145|gb|EDK54221.1| preprotein translocase, SecE subunit [Burkholderia mallei FMH] gi|147752134|gb|EDK59200.1| preprotein translocase, SecE subunit [Burkholderia mallei JHU] gi|148026197|gb|EDK84282.1| preprotein translocase, SecE subunit [Burkholderia mallei 2002721280] gi|160695712|gb|EDP85682.1| preprotein translocase, SecE subunit [Burkholderia mallei ATCC 10399] gi|169655286|gb|EDS87979.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei S13] gi|184210868|gb|EDU07911.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1655] gi|217392288|gb|EEC32313.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 576] gi|237503833|gb|ACQ96151.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei MSHR346] gi|238520998|gb|EEP84453.1| preprotein translocase, SecE subunit [Burkholderia mallei GB8 horse 4] gi|242140733|gb|EES27135.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1106b] Length = 126 Score = 33.5 bits (75), Expect = 8.6, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW-LMHFILG 64 + F K E +K+ WP+R E + +VV + + ++F + D+SI W + ILG Sbjct: 68 IAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEWAIFSVILG 124 >gi|294056231|ref|YP_003549889.1| preprotein translocase, SecE subunit [Coraliomargarita akajimensis DSM 45221] gi|293615564|gb|ADE55719.1| preprotein translocase, SecE subunit [Coraliomargarita akajimensis DSM 45221] Length = 67 Score = 33.5 bits (75), Expect = 8.7, Method: Compositional matrix adjust. Identities = 15/45 (33%), Positives = 27/45 (60%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 F+K+ E KK WP+++E+ S +VV++ +I F + D S+ Sbjct: 11 FYKETLTELKKASWPTKTELRDSTVVVLLATAILGSFIALTDFSL 55 >gi|33239684|ref|NP_874626.1| preprotein translocase subunit SecE [Prochlorococcus marinus subsp. marinus str. CCMP1375] gi|33237209|gb|AAP99278.1| Preprotein translocase subunit SecE [Prochlorococcus marinus subsp. marinus str. CCMP1375] Length = 80 Score = 33.5 bits (75), Expect = 8.7, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 25/47 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 F DE K + WPSR ++ I VI+M+++S+ + + GW Sbjct: 27 FLPSTVDELKLVVWPSRQQLFSESIAVILMVTLSAASIAAVSRFYGW 73 >gi|297159566|gb|ADI09278.1| preprotein translocase subunit SecE [Streptomyces bingchenggensis BCW-1] Length = 77 Score = 33.5 bits (75), Expect = 8.8, Method: Compositional matrix adjust. Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 RLA+ F++Q+ E +K+ WP+R ++ VVI+ + I VID + ++ Sbjct: 19 GRLAL--FYRQIVAELRKVVWPTRGQLSTYTTVVIVFVLIMIGIVTVIDYGFNQAIKYVF 76 Query: 64 G 64 G Sbjct: 77 G 77 >gi|269123299|ref|YP_003305876.1| preprotein translocase, SecE subunit [Streptobacillus moniliformis DSM 12112] gi|268314625|gb|ACZ00999.1| preprotein translocase, SecE subunit [Streptobacillus moniliformis DSM 12112] Length = 68 Score = 33.5 bits (75), Expect = 8.8, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 27/44 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +N F Q+ E K++ WPS++EV IVV+++ S+ L+ D Sbjct: 6 MNLFNQIIAEYKQVQWPSKAEVFQVTIVVLLITLFVSLMILIFD 49 >gi|218752286|ref|ZP_03531082.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis GM 1503] gi|254549598|ref|ZP_05140045.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] gi|289760763|ref|ZP_06520141.1| preprotein translocase secE1 [Mycobacterium tuberculosis GM 1503] gi|289708269|gb|EFD72285.1| preprotein translocase secE1 [Mycobacterium tuberculosis GM 1503] Length = 161 Score = 33.5 bits (75), Expect = 8.9, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query: 3 VNRLA-VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLS 42 VN +A V N+ KQV E +K+ WP+R ++L VV+ L+ Sbjct: 99 VNPIAFVYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLA 139 >gi|167838225|ref|ZP_02465084.1| preprotein translocase subunit SecE [Burkholderia thailandensis MSMB43] Length = 110 Score = 33.5 bits (75), Expect = 8.9, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 27/49 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 + F K E +K+ WP+R E + +VV + + ++F + D+SI W Sbjct: 52 IAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEW 100 >gi|23097560|ref|NP_691026.1| preprotein translocase subunit [Oceanobacillus iheyensis HTE831] gi|22775783|dbj|BAC12061.1| preprotein translocase subunit [Oceanobacillus iheyensis HTE831] Length = 57 Score = 33.5 bits (75), Expect = 8.9, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 28/53 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + F + V E KK+ WP E+ +VVI + +VFF V+D I L++ Sbjct: 1 MFKFLRNVSREMKKVSWPKGKELRNYTVVVISTVIFMAVFFFVVDLGISQLLN 53 >gi|330814212|ref|YP_004358451.1| protein secE/sec61-gamma protein [Candidatus Pelagibacter sp. IMCC9063] gi|327487307|gb|AEA81712.1| protein secE/sec61-gamma protein [Candidatus Pelagibacter sp. IMCC9063] Length = 61 Score = 33.5 bits (75), Expect = 8.9, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 37/56 (66%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 LNF + V+ E KI WP+ E L+ ++VI M ++S+FFL++DQ +++++G Sbjct: 5 LNFLRSVKQEIFKITWPTSKEALMGTVMVIAMAVVASLFFLLLDQFFKVGLNYLIG 60 >gi|76811237|ref|YP_335156.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 1710b] gi|254190290|ref|ZP_04896798.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei Pasteur 52237] gi|254261793|ref|ZP_04952847.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1710a] gi|76580690|gb|ABA50165.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1710b] gi|157937966|gb|EDO93636.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei Pasteur 52237] gi|254220482|gb|EET09866.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1710a] Length = 126 Score = 33.5 bits (75), Expect = 8.9, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 27/49 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 + F K E +K+ WP+R E + +VV + + ++F + D+SI W Sbjct: 68 IAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEW 116 >gi|56961917|ref|YP_173639.1| preprotein translocase subunit E [Bacillus clausii KSM-K16] gi|56908151|dbj|BAD62678.1| preprotein translocase subunit E [Bacillus clausii KSM-K16] Length = 62 Score = 33.5 bits (75), Expect = 9.0, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 27/53 (50%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F + V E K++ WP++ E+ +VV+ L FF ++D I L+ + Sbjct: 10 TFLRNVGREMKRVTWPTKKELTRYTLVVLTTLIFMVAFFYLVDLGISTLLRML 62 >gi|167912897|ref|ZP_02499988.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 112] gi|167920857|ref|ZP_02507948.1| preprotein translocase subunit SecE [Burkholderia pseudomallei BCC215] Length = 110 Score = 33.5 bits (75), Expect = 9.1, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 27/49 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 + F K E +K+ WP+R E + +VV + + ++F + D+SI W Sbjct: 52 IAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEW 100 >gi|152980358|ref|YP_001355116.1| preprotein translocase SecE subunit [Janthinobacterium sp. Marseille] gi|151280435|gb|ABR88845.1| preprotein translocase SecE subunit [Janthinobacterium sp. Marseille] Length = 127 Score = 33.5 bits (75), Expect = 9.1, Method: Compositional matrix adjust. Identities = 15/45 (33%), Positives = 25/45 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQ 53 LNF K+ E+KK+ WP+R E L +V + + ++F D+ Sbjct: 68 LNFSKEAVRETKKVVWPTRKEALQMTAIVFGFVLVMALFLWGTDK 112 >gi|325267344|ref|ZP_08134005.1| preprotein translocase [Kingella denitrificans ATCC 33394] gi|324981139|gb|EGC16790.1| preprotein translocase [Kingella denitrificans ATCC 33394] Length = 72 Score = 33.5 bits (75), Expect = 9.2, Method: Compositional matrix adjust. Identities = 17/58 (29%), Positives = 33/58 (56%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L + +FK+ E KK+ WP RS+ + V++ ++I ++F +D + L++ IL Sbjct: 13 LRLFRYFKESIAEFKKVVWPKRSDAVRMTGFVLVFVTIFAIFIYGVDSIMSLLINLIL 70 >gi|253581635|ref|ZP_04858859.1| protein translocase subunit sece [Fusobacterium varium ATCC 27725] gi|257470017|ref|ZP_05634109.1| protein translocase subunit SecE [Fusobacterium ulcerans ATCC 49185] gi|317064242|ref|ZP_07928727.1| protein translocase subunit sece [Fusobacterium ulcerans ATCC 49185] gi|251835984|gb|EES64521.1| protein translocase subunit sece [Fusobacterium varium ATCC 27725] gi|313689918|gb|EFS26753.1| protein translocase subunit sece [Fusobacterium ulcerans ATCC 49185] Length = 60 Score = 33.5 bits (75), Expect = 9.2, Method: Compositional matrix adjust. Identities = 15/44 (34%), Positives = 27/44 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +N F+ ++ E K+ WP + E++ S + VI+M + SV+ V D Sbjct: 1 MNLFQGIKMEYSKVQWPKKEEIVNSTLWVIVMSLVLSVYLGVFD 44 >gi|237736025|ref|ZP_04566506.1| predicted protein [Fusobacterium mortiferum ATCC 9817] gi|229421839|gb|EEO36886.1| predicted protein [Fusobacterium mortiferum ATCC 9817] Length = 81 Score = 33.5 bits (75), Expect = 9.2, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 26/44 (59%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +N F+ ++ E K+ WP++ EV S + VI M I S++ V D Sbjct: 22 MNLFQGIKTEYSKVQWPNKEEVKNSTLWVIAMSLILSIYLGVFD 65 >gi|46581326|ref|YP_012134.1| preprotein translocase subunit SecE [Desulfovibrio vulgaris str. Hildenborough] gi|120601495|ref|YP_965895.1| preprotein translocase subunit SecE [Desulfovibrio vulgaris DP4] gi|46450748|gb|AAS97394.1| preprotein translocase, SecE subunit [Desulfovibrio vulgaris str. Hildenborough] gi|120561724|gb|ABM27468.1| protein translocase subunit secE/sec61 gamma [Desulfovibrio vulgaris DP4] gi|311234986|gb|ADP87840.1| preprotein translocase, SecE subunit [Desulfovibrio vulgaris RCH1] Length = 83 Score = 33.5 bits (75), Expect = 9.2, Method: Compositional matrix adjust. Identities = 14/54 (25%), Positives = 32/54 (59%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ ++ + E +K+ WP+R E + + V++ + + S+F +D + L+ FIL Sbjct: 29 DYVEEAKVELRKVSWPTRKEAWATSMTVLVFVFVMSLFLGFVDLGLTHLIEFIL 82 >gi|31791822|ref|NP_854315.1| preprotein translocase subunit SecE [Mycobacterium bovis AF2122/97] gi|57116765|ref|YP_177743.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis H37Rv] gi|121636559|ref|YP_976782.1| preprotein translocase subunit SecE [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|148660412|ref|YP_001281935.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis H37Ra] gi|148821842|ref|YP_001286596.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis F11] gi|161350077|ref|NP_335078.2| preprotein translocase subunit SecE [Mycobacterium tuberculosis CDC1551] gi|167969068|ref|ZP_02551345.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis H37Ra] gi|215402413|ref|ZP_03414594.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis 02_1987] gi|215410185|ref|ZP_03418993.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis 94_M4241A] gi|215444757|ref|ZP_03431509.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis T85] gi|224989031|ref|YP_002643718.1| preprotein translocase subunit SecE [Mycobacterium bovis BCG str. Tokyo 172] gi|253797578|ref|YP_003030579.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis KZN 1435] gi|254230969|ref|ZP_04924296.1| preprotein translocase secE1 [Mycobacterium tuberculosis C] gi|254363592|ref|ZP_04979638.1| preprotein translocase secE1 [Mycobacterium tuberculosis str. Haarlem] gi|260185519|ref|ZP_05762993.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis CPHL_A] gi|289446195|ref|ZP_06435939.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis CPHL_A] gi|289552892|ref|ZP_06442102.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis KZN 605] gi|289744356|ref|ZP_06503734.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis 02_1987] gi|289756722|ref|ZP_06516100.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis T85] gi|294996156|ref|ZP_06801847.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis 210] gi|297633136|ref|ZP_06950916.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis KZN 4207] gi|297730116|ref|ZP_06959234.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis KZN R506] gi|298524130|ref|ZP_07011539.1| translocase [Mycobacterium tuberculosis 94_M4241A] gi|306787655|ref|ZP_07425977.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu004] gi|306796391|ref|ZP_07434693.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu006] gi|306970852|ref|ZP_07483513.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu010] gi|307083141|ref|ZP_07492254.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu012] gi|313657443|ref|ZP_07814323.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis KZN V2475] gi|61242582|sp|P0A5Z0|SECE_MYCTU RecName: Full=Probable preprotein translocase subunit secE gi|61242587|sp|P0A5Z1|SECE_MYCBO RecName: Full=Probable preprotein translocase subunit secE gi|31617409|emb|CAD93519.1| PROBABLE PREPROTEIN TRANSLOCASE SECE1 [Mycobacterium bovis AF2122/97] gi|38490217|emb|CAE55308.1| PROBABLE PREPROTEIN TRANSLOCASE SECE1 [Mycobacterium tuberculosis H37Rv] gi|121492206|emb|CAL70673.1| Probable preprotein translocase secE1 [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|124600028|gb|EAY59038.1| preprotein translocase secE1 [Mycobacterium tuberculosis C] gi|134149106|gb|EBA41151.1| preprotein translocase secE1 [Mycobacterium tuberculosis str. Haarlem] gi|148504564|gb|ABQ72373.1| translocase [Mycobacterium tuberculosis H37Ra] gi|148720369|gb|ABR04994.1| preprotein translocase secE1 subunit [Mycobacterium tuberculosis F11] gi|224772144|dbj|BAH24950.1| preprotein translocase subunit SecE [Mycobacterium bovis BCG str. Tokyo 172] gi|253319081|gb|ACT23684.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis KZN 1435] gi|289419153|gb|EFD16354.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis CPHL_A] gi|289437524|gb|EFD20017.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis KZN 605] gi|289684884|gb|EFD52372.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis 02_1987] gi|289712286|gb|EFD76298.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis T85] gi|298493924|gb|EFI29218.1| translocase [Mycobacterium tuberculosis 94_M4241A] gi|308335732|gb|EFP24583.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu004] gi|308343168|gb|EFP32019.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu006] gi|308359637|gb|EFP48488.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu010] gi|308367147|gb|EFP55998.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu012] gi|323720995|gb|EGB30060.1| preprotein translocase secE1 [Mycobacterium tuberculosis CDC1551A] gi|326905139|gb|EGE52072.1| preprotein translocase secE1 [Mycobacterium tuberculosis W-148] gi|328457359|gb|AEB02782.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis KZN 4207] Length = 161 Score = 33.5 bits (75), Expect = 9.4, Method: Compositional matrix adjust. Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query: 3 VNRLA-VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLS 42 VN +A V N+ KQV E +K+ WP+R ++L VV+ L+ Sbjct: 99 VNPIAFVYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLA 139 >gi|53720835|ref|YP_109821.1| preprotein translocase subunit SecE [Burkholderia pseudomallei K96243] gi|52211249|emb|CAH37238.1| preprotein translocase SecE subunit [Burkholderia pseudomallei K96243] Length = 126 Score = 33.5 bits (75), Expect = 9.6, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 27/49 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 + F K E +K+ WP+R E + +VV + + ++F + D+SI W Sbjct: 68 IAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEW 116 >gi|167826166|ref|ZP_02457637.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 9] Length = 110 Score = 33.5 bits (75), Expect = 9.6, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 27/49 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 + F K E +K+ WP+R E + +VV + + ++F + D+SI W Sbjct: 52 IAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEW 100 >gi|299143701|ref|ZP_07036781.1| preprotein translocase, SecE subunit [Peptoniphilus sp. oral taxon 386 str. F0131] gi|298518186|gb|EFI41925.1| preprotein translocase, SecE subunit [Peptoniphilus sp. oral taxon 386 str. F0131] Length = 70 Score = 33.5 bits (75), Expect = 9.7, Method: Compositional matrix adjust. Identities = 17/54 (31%), Positives = 32/54 (59%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +F+ V+ E KK+ WP++ EVL +VI++ + S+ + D+ + L FI+ Sbjct: 17 KYFRGVKSEFKKVVWPTKQEVLNYSAIVIVVSILFSLLLALYDKIVLTLFKFII 70 >gi|167817769|ref|ZP_02449449.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 91] Length = 110 Score = 33.5 bits (75), Expect = 9.8, Method: Compositional matrix adjust. Identities = 15/49 (30%), Positives = 27/49 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 + F K E +K+ WP+R E + +VV + + ++F + D+SI W Sbjct: 52 IAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEW 100 >gi|254516892|ref|ZP_05128950.1| preprotein translocase, SecE subunit [gamma proteobacterium NOR5-3] gi|219674397|gb|EED30765.1| preprotein translocase, SecE subunit [gamma proteobacterium NOR5-3] Length = 120 Score = 33.5 bits (75), Expect = 9.9, Method: Compositional matrix adjust. Identities = 14/52 (26%), Positives = 31/52 (59%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K R E +K+ WP+R E + + ++V+ + + ++ +D +GWL+ ++G Sbjct: 69 KGSRTEIRKVVWPTRQETVQTTMIVVAFVLVVALILWGLDSFLGWLVSLVIG 120 Searching..................................................done Results from round 2 >gi|158422505|ref|YP_001523797.1| putative translocation complex protein [Azorhizobium caulinodans ORS 571] gi|158329394|dbj|BAF86879.1| putative translocation complex protein [Azorhizobium caulinodans ORS 571] Length = 139 Score = 93.3 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 26/63 (41%), Positives = 44/63 (69%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + + FF+QVR E+ K+ WPSR E L++ +V +M+ ++S+FFLV+DQ + + + IL Sbjct: 77 KNSPVEFFQQVRTETAKVTWPSRRETLITTAMVFVMVLLASIFFLVVDQILRFGVSQILS 136 Query: 65 IGR 67 IG Sbjct: 137 IGH 139 >gi|220921884|ref|YP_002497185.1| preprotein translocase subunit SecE [Methylobacterium nodulans ORS 2060] gi|219946490|gb|ACL56882.1| preprotein translocase, SecE subunit [Methylobacterium nodulans ORS 2060] Length = 103 Score = 90.3 bits (223), Expect = 8e-17, Method: Composition-based stats. Identities = 26/63 (41%), Positives = 46/63 (73%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R+ F +QVRDE +K+ WP+R E L++ ++V +M+ ++S+FF+V+DQ + +L+ +L Sbjct: 40 KRVGPFEFLQQVRDEGRKVTWPTRKETLITTLMVFVMVVLASLFFVVVDQVLRYLVTLVL 99 Query: 64 GIG 66 GIG Sbjct: 100 GIG 102 >gi|188583666|ref|YP_001927111.1| preprotein translocase, SecE subunit [Methylobacterium populi BJ001] gi|179347164|gb|ACB82576.1| preprotein translocase, SecE subunit [Methylobacterium populi BJ001] Length = 126 Score = 86.8 bits (214), Expect = 8e-16, Method: Composition-based stats. Identities = 24/63 (38%), Positives = 44/63 (69%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R+ + F +VRDE++K+ WP+R E ++ ++V IM+ ++S+FF+ +DQ + + + IL Sbjct: 63 KRVGPVEFLGEVRDEARKVTWPTRKETTITTVMVFIMVVVASLFFVAVDQVMRFGVGLIL 122 Query: 64 GIG 66 GIG Sbjct: 123 GIG 125 >gi|302382911|ref|YP_003818734.1| preprotein translocase subunit SecE [Brevundimonas subvibrioides ATCC 15264] gi|302193539|gb|ADL01111.1| preprotein translocase, SecE subunit [Brevundimonas subvibrioides ATCC 15264] Length = 103 Score = 85.6 bits (211), Expect = 2e-15, Method: Composition-based stats. Identities = 27/64 (42%), Positives = 42/64 (65%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R + F QV+ E++KI WPSR E ++ ++V IM++I+ VFF +D ++GWL IL Sbjct: 40 KRTSPGQFISQVQAEARKIVWPSRKETWITSVMVFIMVAIAVVFFWAVDTALGWLSTIIL 99 Query: 64 GIGR 67 IG+ Sbjct: 100 AIGQ 103 >gi|304321356|ref|YP_003854999.1| hypothetical protein PB2503_09019 [Parvularcula bermudensis HTCC2503] gi|303300258|gb|ADM09857.1| hypothetical protein PB2503_09019 [Parvularcula bermudensis HTCC2503] Length = 112 Score = 85.2 bits (210), Expect = 3e-15, Method: Composition-based stats. Identities = 27/64 (42%), Positives = 47/64 (73%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 ++ + FF+QVRDE+ K+ W SR+E LVS I+V+IM++++S+FFL++D + W++ Sbjct: 47 AAKKVGPIQFFRQVRDEALKVTWTSRNETLVSTIMVLIMVALASMFFLLVDTVLRWIVPI 106 Query: 62 ILGI 65 IL + Sbjct: 107 ILSV 110 >gi|170738718|ref|YP_001767373.1| preprotein translocase, SecE subunit [Methylobacterium sp. 4-46] gi|168192992|gb|ACA14939.1| preprotein translocase, SecE subunit [Methylobacterium sp. 4-46] Length = 101 Score = 84.1 bits (207), Expect = 6e-15, Method: Composition-based stats. Identities = 26/63 (41%), Positives = 46/63 (73%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R+ F +QVRDE +K+ WP+R E L++ ++V +M+ ++S+FF+V+DQ + +L+ +L Sbjct: 38 KRVGPFEFLQQVRDEGRKVTWPTRKETLITTLMVFVMVVLASLFFVVVDQVLRYLVTLVL 97 Query: 64 GIG 66 GIG Sbjct: 98 GIG 100 >gi|315499730|ref|YP_004088533.1| preprotein translocase, sece subunit [Asticcacaulis excentricus CB 48] gi|315417742|gb|ADU14382.1| preprotein translocase, SecE subunit [Asticcacaulis excentricus CB 48] Length = 100 Score = 83.7 bits (206), Expect = 7e-15, Method: Composition-based stats. Identities = 22/64 (34%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R + FF +VR E++KI W SR E ++ ++V IM+ ++ FF ++D +G+ ++ ++ Sbjct: 37 KRTSPAKFFSEVRQEARKITWTSRKETWITTVMVFIMVVVACAFFYIVDGGLGFAVNSLI 96 Query: 64 GIGR 67 IGR Sbjct: 97 NIGR 100 >gi|163853395|ref|YP_001641438.1| preprotein translocase, SecE subunit [Methylobacterium extorquens PA1] gi|218532253|ref|YP_002423069.1| preprotein translocase, SecE subunit [Methylobacterium chloromethanicum CM4] gi|163665000|gb|ABY32367.1| preprotein translocase, SecE subunit [Methylobacterium extorquens PA1] gi|218524556|gb|ACK85141.1| preprotein translocase, SecE subunit [Methylobacterium chloromethanicum CM4] Length = 126 Score = 83.7 bits (206), Expect = 8e-15, Method: Composition-based stats. Identities = 25/63 (39%), Positives = 43/63 (68%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R+ + F +VRDE +K+ WP+R E V+ I+V IM+ ++S+FF+ +DQ + + + +L Sbjct: 63 KRVGPVEFLGEVRDEGRKVTWPTRKETTVTTIMVFIMVVVASLFFVAVDQVMRFAVSLVL 122 Query: 64 GIG 66 GIG Sbjct: 123 GIG 125 >gi|254459652|ref|ZP_05073068.1| preprotein translocase, SecE subunit, putative [Rhodobacterales bacterium HTCC2083] gi|206676241|gb|EDZ40728.1| preprotein translocase, SecE subunit, putative [Rhodobacteraceae bacterium HTCC2083] Length = 113 Score = 81.4 bits (200), Expect = 4e-14, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 38/59 (64%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 L + +QVR E K+ WP+R EV ++ ++V IM ++++VFF VID I + + +LG Sbjct: 51 TNPLQYVQQVRSEVAKVVWPTRREVALTTVMVFIMAALTAVFFAVIDIIIRFGLTSVLG 109 >gi|222085662|ref|YP_002544192.1| protein-export translocase protein [Agrobacterium radiobacter K84] gi|221723110|gb|ACM26266.1| protein-export translocase protein [Agrobacterium radiobacter K84] Length = 66 Score = 81.4 bits (200), Expect = 4e-14, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 43/65 (66%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ L F +QVR E+ KI WPSR E ++S ++V++M+ +S+FF DQ IGW++ ++ Sbjct: 2 ASKSNPLAFLQQVRSETSKITWPSRRETMISTVMVLVMVVFASLFFFAADQLIGWILGYV 61 Query: 63 LGIGR 67 L G Sbjct: 62 LNTGN 66 >gi|240140813|ref|YP_002965293.1| Preprotein translocase subunit SecE-like protein [Methylobacterium extorquens AM1] gi|254563323|ref|YP_003070418.1| SecE subunit of protein translocation complex preprotein [Methylobacterium extorquens DM4] gi|240010790|gb|ACS42016.1| Preprotein translocase subunit SecE-like protein [Methylobacterium extorquens AM1] gi|254270601|emb|CAX26604.1| Putative SecE subunit of protein translocation complex preprotein, (across inner membrane), (General Secretory Pathway) [Methylobacterium extorquens DM4] Length = 100 Score = 81.4 bits (200), Expect = 4e-14, Method: Composition-based stats. Identities = 25/63 (39%), Positives = 43/63 (68%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R+ + F +VRDE +K+ WP+R E V+ I+V IM+ ++S+FF+ +DQ + + + +L Sbjct: 37 KRVGPVEFLGEVRDEGRKVTWPTRKETTVTTIMVFIMVVVASLFFVAVDQVMRFAVSLVL 96 Query: 64 GIG 66 GIG Sbjct: 97 GIG 99 >gi|329890178|ref|ZP_08268521.1| preprotein translocase, SecE subunit [Brevundimonas diminuta ATCC 11568] gi|328845479|gb|EGF95043.1| preprotein translocase, SecE subunit [Brevundimonas diminuta ATCC 11568] Length = 99 Score = 81.0 bits (199), Expect = 5e-14, Method: Composition-based stats. Identities = 22/64 (34%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ F +VR E++KI WPSR E ++ ++V IM+ I++ FF ++D +G+ IL Sbjct: 36 KKTSIPQFISEVRAEARKIVWPSRKETWITSVMVFIMVLIAAAFFWIVDTGLGFASRIIL 95 Query: 64 GIGR 67 +G+ Sbjct: 96 SLGQ 99 >gi|221236246|ref|YP_002518683.1| protein translocase subunit SecE [Caulobacter crescentus NA1000] gi|220965419|gb|ACL96775.1| protein translocase subunit secE [Caulobacter crescentus NA1000] Length = 105 Score = 80.6 bits (198), Expect = 6e-14, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 41/63 (65%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R L FF++VR E++KI W +R E ++ ++V IM+ ++S+FF +D IG+ ++ +L Sbjct: 40 KRTNPLQFFREVRAEARKITWTTRKETWITSVMVFIMVVLASLFFTAVDGGIGFAINQLL 99 Query: 64 GIG 66 + Sbjct: 100 KLA 102 >gi|239832137|ref|ZP_04680466.1| preprotein translocase, SecE subunit [Ochrobactrum intermedium LMG 3301] gi|239824404|gb|EEQ95972.1| preprotein translocase, SecE subunit [Ochrobactrum intermedium LMG 3301] Length = 183 Score = 80.2 bits (197), Expect = 7e-14, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 45/65 (69%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + FF+QVR E+ K+ WP+R E ++S I+V+IM +++ FF + DQ + + + FI Sbjct: 119 ASKTNPITFFQQVRAETAKVTWPTRRETVISTIMVVIMAFLAAAFFFLADQLMAYGVEFI 178 Query: 63 LGIGR 67 LG+GR Sbjct: 179 LGLGR 183 >gi|296117261|ref|ZP_06835853.1| preprotein translocase, SecE subunit [Gluconacetobacter hansenii ATCC 23769] gi|295976214|gb|EFG83000.1| preprotein translocase, SecE subunit [Gluconacetobacter hansenii ATCC 23769] Length = 99 Score = 80.2 bits (197), Expect = 8e-14, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 39/61 (63%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ F ++VR E+KK+ WP+R L++ V+ M ++SVFF ++D+ IG + + G+ Sbjct: 38 VSPAKFVEEVRAEAKKVTWPTRRATLMTTGAVLAMAGLASVFFFLVDEVIGLGVRKLFGL 97 Query: 66 G 66 G Sbjct: 98 G 98 >gi|222148351|ref|YP_002549308.1| preprotein translocase subunit SecE [Agrobacterium vitis S4] gi|221735339|gb|ACM36302.1| secretion protein [Agrobacterium vitis S4] Length = 66 Score = 79.9 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 41/65 (63%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ K+ WPSR E ++S ++V+ M+ +S+FF DQ IGW++ + Sbjct: 2 ASKTNPFAFLQQVRSETSKVTWPSRRETVISTLMVLAMVIFASLFFFAADQVIGWVLSLV 61 Query: 63 LGIGR 67 L +G Sbjct: 62 LNLGN 66 >gi|83858579|ref|ZP_00952101.1| putative preprotein translocase sece subunit transmembrane [Oceanicaulis alexandrii HTCC2633] gi|83853402|gb|EAP91254.1| putative preprotein translocase sece subunit transmembrane [Oceanicaulis alexandrii HTCC2633] Length = 94 Score = 79.9 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 44/65 (67%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + L FF +VR E +K+ W SR+E LVS I+V++M S +++FF +D IG++++ Sbjct: 29 RKRTTSPLKFFSEVRQEGRKVTWTSRNETLVSTIMVVVMASFAALFFFGVDSIIGFVVNL 88 Query: 62 ILGIG 66 +LG+G Sbjct: 89 LLGLG 93 >gi|254420849|ref|ZP_05034573.1| preprotein translocase, SecE subunit, putative [Brevundimonas sp. BAL3] gi|196187026|gb|EDX82002.1| preprotein translocase, SecE subunit, putative [Brevundimonas sp. BAL3] Length = 99 Score = 79.5 bits (195), Expect = 1e-13, Method: Composition-based stats. Identities = 24/62 (38%), Positives = 42/62 (67%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R + +F+KQV E +KI WPSR E ++ ++V IM+ I+++FF V+D +G+ +I+ Sbjct: 37 RTSPSDFYKQVMAEGRKIVWPSRKETWITSVMVFIMVVIAAIFFWVVDTGLGFAFRYIIA 96 Query: 65 IG 66 +G Sbjct: 97 LG 98 >gi|312115371|ref|YP_004012967.1| preprotein translocase, SecE subunit [Rhodomicrobium vannielii ATCC 17100] gi|311220500|gb|ADP71868.1| preprotein translocase, SecE subunit [Rhodomicrobium vannielii ATCC 17100] Length = 65 Score = 79.5 bits (195), Expect = 1e-13, Method: Composition-based stats. Identities = 26/63 (41%), Positives = 40/63 (63%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R + +QVR E+ K+ WPSR E +V+ I+V+IM ++SVFFL+ DQ W + +L Sbjct: 3 RTGPFEYLQQVRAETAKVVWPSRRETIVTTIMVVIMAVLASVFFLLADQIFSWGIAHLLR 62 Query: 65 IGR 67 +G Sbjct: 63 LGH 65 >gi|163759400|ref|ZP_02166486.1| translocase [Hoeflea phototrophica DFL-43] gi|162283804|gb|EDQ34089.1| translocase [Hoeflea phototrophica DFL-43] Length = 66 Score = 79.1 bits (194), Expect = 2e-13, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 43/64 (67%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ K+ WPSR E +S ++V++M+ ++S+FF DQ++GW++ I Sbjct: 2 ASKTNPFTFIQQVRSETAKVKWPSRRETSISTVMVLVMVLLASIFFFAADQALGWVISLI 61 Query: 63 LGIG 66 L IG Sbjct: 62 LNIG 65 >gi|39936338|ref|NP_948614.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris CGA009] gi|39650193|emb|CAE28716.1| preprotein translocase, SecE subunit [Rhodopseudomonas palustris CGA009] Length = 83 Score = 78.7 bits (193), Expect = 2e-13, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 39/59 (66%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E+ K+ WP+R E ++ I+V +M++++S+FF DQ I L+ +LG+ Sbjct: 25 SPFKFLQEVRSETAKVTWPTRRETSITTIMVFVMVALTSIFFFAADQVISVLIRLLLGV 83 >gi|118591200|ref|ZP_01548599.1| hypothetical protein SIAM614_16277 [Stappia aggregata IAM 12614] gi|118436276|gb|EAV42918.1| hypothetical protein SIAM614_16277 [Stappia aggregata IAM 12614] Length = 65 Score = 78.3 bits (192), Expect = 3e-13, Method: Composition-based stats. Identities = 24/62 (38%), Positives = 43/62 (69%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++VR E+ K+ WP+R E V+ ++V IM+ I+++FFLV DQ +G+ + ++LG Sbjct: 3 KTNPFKFIQEVRAETSKVTWPTRKETAVTTVMVFIMVVIAAIFFLVADQLMGFGIGYLLG 62 Query: 65 IG 66 +G Sbjct: 63 VG 64 >gi|83594033|ref|YP_427785.1| preprotein translocase subunit SecE [Rhodospirillum rubrum ATCC 11170] gi|83576947|gb|ABC23498.1| protein translocase subunit secE/sec61 gamma [Rhodospirillum rubrum ATCC 11170] Length = 65 Score = 77.5 bits (190), Expect = 6e-13, Method: Composition-based stats. Identities = 26/62 (41%), Positives = 40/62 (64%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R F +QVR E K+ WPSR E ++S ++V IM S+++VFFL++D + + FI G Sbjct: 3 RTNPGQFVRQVRQEIGKVTWPSRKETVISTVMVFIMASLAAVFFLLVDWILAEGVQFIFG 62 Query: 65 IG 66 +G Sbjct: 63 LG 64 >gi|114704470|ref|ZP_01437378.1| translocase [Fulvimarina pelagi HTCC2506] gi|114539255|gb|EAU42375.1| translocase [Fulvimarina pelagi HTCC2506] Length = 65 Score = 77.2 bits (189), Expect = 7e-13, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 39/62 (62%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QVR E+ K+ WPSR E +S I+V IM++++S+F DQ +G+++ I+ Sbjct: 3 KTNPFTFLQQVRSETSKVTWPSRRETTISTIMVFIMVALASIFLFAADQVLGYVVGLIMN 62 Query: 65 IG 66 G Sbjct: 63 AG 64 >gi|162146513|ref|YP_001600972.1| putative preprotein translocase secE subunit [Gluconacetobacter diazotrophicus PAl 5] gi|161785088|emb|CAP54632.1| putative preprotein translocase secE subunit [Gluconacetobacter diazotrophicus PAl 5] Length = 94 Score = 76.0 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 38/61 (62%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ F + VR E+ K+ WP+R LV+ V+ M +++SVFF V+DQ IG + + G+ Sbjct: 33 VSPAKFVQDVRAEAGKVTWPTRRATLVTTGAVLAMAAMTSVFFFVVDQIIGLGVRELFGL 92 Query: 66 G 66 G Sbjct: 93 G 93 >gi|114771285|ref|ZP_01448705.1| translocase [alpha proteobacterium HTCC2255] gi|114548210|gb|EAU51097.1| translocase [alpha proteobacterium HTCC2255] Length = 65 Score = 75.6 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 38/62 (61%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R L F +QVR E K+ WP+R E ++ ++V IM ++ ++FF DQ I ++ ILG Sbjct: 3 RTNPLQFMQQVRAEVSKVVWPNRRETTITTVMVFIMATLVAIFFFGADQIIKLGLNIILG 62 Query: 65 IG 66 IG Sbjct: 63 IG 64 >gi|254780149|ref|YP_003064562.1| hypothetical protein CLIBASIA_00140 [Candidatus Liberibacter asiaticus str. psy62] gi|38195602|gb|AAR13465.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|140063956|gb|ABO82468.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|254039826|gb|ACT56622.1| hypothetical protein CLIBASIA_00140 [Candidatus Liberibacter asiaticus str. psy62] gi|255957546|dbj|BAH96609.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957842|dbj|BAH96816.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957852|dbj|BAH96825.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957862|dbj|BAH96834.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957872|dbj|BAH96843.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957882|dbj|BAH96852.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957892|dbj|BAH96861.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957902|dbj|BAH96870.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957912|dbj|BAH96879.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957922|dbj|BAH96888.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957932|dbj|BAH96897.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957942|dbj|BAH96906.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957952|dbj|BAH96915.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957962|dbj|BAH96924.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957972|dbj|BAH96933.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957982|dbj|BAH96942.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255957992|dbj|BAH96951.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958002|dbj|BAH96960.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958012|dbj|BAH96969.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958022|dbj|BAH96978.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958032|dbj|BAH96987.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958042|dbj|BAH96996.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958052|dbj|BAH97005.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958062|dbj|BAH97014.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958072|dbj|BAH97023.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958082|dbj|BAH97032.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958092|dbj|BAH97041.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958102|dbj|BAH97050.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958112|dbj|BAH97059.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|255958122|dbj|BAH97068.1| preprotein translocase [Candidatus Liberibacter asiaticus] gi|283362132|dbj|BAI65919.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362142|dbj|BAI65928.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362152|dbj|BAI65937.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362162|dbj|BAI65946.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362172|dbj|BAI65955.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362182|dbj|BAI65964.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362192|dbj|BAI65973.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362202|dbj|BAI65982.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362212|dbj|BAI65991.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362222|dbj|BAI66000.1| hypothetical protein [Candidatus Liberibacter asiaticus] gi|283362232|dbj|BAI66009.1| hypothetical protein [Candidatus Liberibacter asiaticus] Length = 67 Score = 75.2 bits (184), Expect = 2e-12, Method: Composition-based stats. Identities = 67/67 (100%), Positives = 67/67 (100%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH Sbjct: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 Query: 61 FILGIGR 67 FILGIGR Sbjct: 61 FILGIGR 67 >gi|295688155|ref|YP_003591848.1| preprotein translocase subunit SecE [Caulobacter segnis ATCC 21756] gi|295430058|gb|ADG09230.1| preprotein translocase, SecE subunit [Caulobacter segnis ATCC 21756] Length = 94 Score = 74.8 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 21/63 (33%), Positives = 43/63 (68%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R + + FF++VR E++KI W +R E ++ ++V IM+ ++S+FFL +D +G+ ++ +L Sbjct: 29 KRTSPVQFFREVRAEARKITWTTRKETWITSVMVFIMVVMASLFFLAVDGGLGFAVNQLL 88 Query: 64 GIG 66 + Sbjct: 89 KLA 91 >gi|209543488|ref|YP_002275717.1| preprotein translocase subunit SecE [Gluconacetobacter diazotrophicus PAl 5] gi|209531165|gb|ACI51102.1| preprotein translocase, SecE subunit [Gluconacetobacter diazotrophicus PAl 5] Length = 76 Score = 74.8 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 38/61 (62%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ F + VR E+ K+ WP+R LV+ V+ M +++SVFF V+DQ IG + + G+ Sbjct: 15 VSPAKFVQDVRAEAGKVTWPTRRATLVTTGAVLAMAAMTSVFFFVVDQIIGLGVRELFGL 74 Query: 66 G 66 G Sbjct: 75 G 75 >gi|307946269|ref|ZP_07661604.1| preprotein translocase, SecE subunit [Roseibium sp. TrichSKD4] gi|307769933|gb|EFO29159.1| preprotein translocase, SecE subunit [Roseibium sp. TrichSKD4] Length = 63 Score = 74.8 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 26/61 (42%), Positives = 42/61 (68%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + L F +QVR E K+ WP+R E V+ ++V IM+ I+S+FFL+ DQ +GW + ++LG Sbjct: 3 KTNPLTFIQQVRSEVAKVTWPTRRETAVTTVMVFIMVVIASIFFLLADQLMGWGIGWMLG 62 Query: 65 I 65 + Sbjct: 63 V 63 >gi|157964200|ref|YP_001499024.1| preprotein translocase subunit SecE [Rickettsia massiliae MTU5] gi|157843976|gb|ABV84477.1| Preprotein translocase SecE subunit [Rickettsia massiliae MTU5] Length = 102 Score = 74.5 bits (182), Expect = 4e-12, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L Sbjct: 39 KEYKIYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMQLLL 98 Query: 64 GIGR 67 IG+ Sbjct: 99 NIGK 102 >gi|154253164|ref|YP_001413988.1| preprotein translocase subunit SecE [Parvibaculum lavamentivorans DS-1] gi|154157114|gb|ABS64331.1| preprotein translocase, SecE subunit [Parvibaculum lavamentivorans DS-1] Length = 66 Score = 74.5 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 41/62 (66%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + L F +QVR E+ K+ WP+R E +++ ++V IM++ + VFF + D ++ +++ +LG Sbjct: 3 KTNPLEFIQQVRSETAKVTWPTRRETIITTVMVFIMVAFAMVFFFLADTALSYIVSLVLG 62 Query: 65 IG 66 G Sbjct: 63 FG 64 >gi|16127436|ref|NP_422000.1| preprotein translocase, SecE subunit [Caulobacter crescentus CB15] gi|13424884|gb|AAK25168.1| preprotein translocase, SecE subunit [Caulobacter crescentus CB15] Length = 83 Score = 74.5 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 41/63 (65%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R L FF++VR E++KI W +R E ++ ++V IM+ ++S+FF +D IG+ ++ +L Sbjct: 18 KRTNPLQFFREVRAEARKITWTTRKETWITSVMVFIMVVLASLFFTAVDGGIGFAINQLL 77 Query: 64 GIG 66 + Sbjct: 78 KLA 80 >gi|67459544|ref|YP_247168.1| preprotein translocase subunit SecE [Rickettsia felis URRWXCal2] gi|67005077|gb|AAY62003.1| Preprotein translocase SecE subunit [Rickettsia felis URRWXCal2] Length = 98 Score = 74.5 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L Sbjct: 35 KEYKIYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMQLLL 94 Query: 64 GIGR 67 IG+ Sbjct: 95 NIGK 98 >gi|154247286|ref|YP_001418244.1| preprotein translocase, SecE subunit [Xanthobacter autotrophicus Py2] gi|154161371|gb|ABS68587.1| preprotein translocase, SecE subunit [Xanthobacter autotrophicus Py2] Length = 65 Score = 74.1 bits (181), Expect = 6e-12, Method: Composition-based stats. Identities = 23/63 (36%), Positives = 44/63 (69%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + + FF+QVR E+ K+ WP+R E L++ +V +M+ ++S+FFLV+DQ + + + +L Sbjct: 3 KNSPVEFFQQVRAETAKVTWPTRRETLITTAMVFVMVFLASIFFLVVDQVLRFGVSTLLT 62 Query: 65 IGR 67 +G Sbjct: 63 LGH 65 >gi|329850797|ref|ZP_08265642.1| preprotein translocase, SecE subunit [Asticcacaulis biprosthecum C19] gi|328841112|gb|EGF90683.1| preprotein translocase, SecE subunit [Asticcacaulis biprosthecum C19] Length = 105 Score = 74.1 bits (181), Expect = 6e-12, Method: Composition-based stats. Identities = 21/63 (33%), Positives = 38/63 (60%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF +VR E++KI W SR E V+ + V+IM+ ++ FF ++D ++GW ++ Sbjct: 42 KPFNPMKFFSEVRQEARKITWTSRKETWVTTVFVMIMVVLAGFFFFIVDAALGWGSSWLT 101 Query: 64 GIG 66 +G Sbjct: 102 KLG 104 >gi|261214244|ref|ZP_05928525.1| preprotein translocase subunit SecE [Brucella abortus bv. 3 str. Tulya] gi|261219595|ref|ZP_05933876.1| preprotein translocase subunit SecE [Brucella ceti M13/05/1] gi|261222408|ref|ZP_05936689.1| preprotein translocase subunit SecE [Brucella ceti B1/94] gi|261322090|ref|ZP_05961287.1| preprotein translocase subunit SecE [Brucella ceti M644/93/1] gi|260915851|gb|EEX82712.1| preprotein translocase subunit SecE [Brucella abortus bv. 3 str. Tulya] gi|260920992|gb|EEX87645.1| preprotein translocase subunit SecE [Brucella ceti B1/94] gi|260924684|gb|EEX91252.1| preprotein translocase subunit SecE [Brucella ceti M13/05/1] gi|261294780|gb|EEX98276.1| preprotein translocase subunit SecE [Brucella ceti M644/93/1] gi|326538980|gb|ADZ87195.1| preprotein translocase, SecE subunit [Brucella melitensis M5-90] Length = 74 Score = 74.1 bits (181), Expect = 6e-12, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 45/65 (69%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + FF+QVR E+ K+ WP+R E ++S I+V+IM +++ FF + DQ + + + FI Sbjct: 10 ASKTNPITFFQQVRAETAKVTWPTRRETVISTIMVVIMAFLAAAFFFLADQLMAYGVEFI 69 Query: 63 LGIGR 67 LG+GR Sbjct: 70 LGLGR 74 >gi|13470536|ref|NP_102104.1| preprotein translocase subunit SecE [Mesorhizobium loti MAFF303099] gi|14021277|dbj|BAB47890.1| secretion protein; SecE [Mesorhizobium loti MAFF303099] Length = 67 Score = 73.7 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 26/67 (38%), Positives = 38/67 (56%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M F +QVR E+ K+ WPSR E ++S ++V+ I+ +FF DQ +G + Sbjct: 1 MASKTTNPFVFLQQVRSETAKVTWPSRRETMISTVMVLAFAVIAMIFFFSADQLMGLAIE 60 Query: 61 FILGIGR 67 ILGIGR Sbjct: 61 QILGIGR 67 >gi|157803321|ref|YP_001491870.1| preprotein translocase subunit SecE [Rickettsia canadensis str. McKiel] gi|157784584|gb|ABV73085.1| preprotein translocase subunit SecE [Rickettsia canadensis str. McKiel] Length = 87 Score = 73.7 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L Sbjct: 24 KEYKIYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMKLLL 83 Query: 64 GIGR 67 IG+ Sbjct: 84 NIGK 87 >gi|103486930|ref|YP_616491.1| SecE subunit of protein translocation complex [Sphingopyxis alaskensis RB2256] gi|98977007|gb|ABF53158.1| protein translocase subunit secE/sec61 gamma [Sphingopyxis alaskensis RB2256] Length = 126 Score = 73.7 bits (180), Expect = 9e-12, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 38/63 (60%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ + F QV+ E+ KI WP+ E + + I+V+IM +I S FFL +D +++ ++ Sbjct: 64 KVKIGEFVNQVKTEAGKIVWPTGRETVQTTILVLIMATILSFFFLGVDTVFSYIVSWLTS 123 Query: 65 IGR 67 + R Sbjct: 124 LAR 126 >gi|298291419|ref|YP_003693358.1| preprotein translocase, SecE subunit [Starkeya novella DSM 506] gi|296927930|gb|ADH88739.1| preprotein translocase, SecE subunit [Starkeya novella DSM 506] Length = 65 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 25/63 (39%), Positives = 45/63 (71%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + FF+QVR E++K+ WP+R E L++ +V +M+ ++S+FFLV DQ + +++ +L Sbjct: 3 KTNPVEFFQQVRAEARKVTWPTRRETLITTAMVFVMVVLASLFFLVADQILSFVIAQVLQ 62 Query: 65 IGR 67 IGR Sbjct: 63 IGR 65 >gi|197104677|ref|YP_002130054.1| preprotein translocase, SecE subunit [Phenylobacterium zucineum HLK1] gi|196478097|gb|ACG77625.1| preprotein translocase, SecE subunit [Phenylobacterium zucineum HLK1] Length = 78 Score = 73.3 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 40/64 (62%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +++ F ++VR E++KI W SR E ++ ++V IM+ +++VFF V+D + + + +L Sbjct: 13 KKVSPAQFAREVRAEARKITWTSRKETWITSVMVAIMVLLAAVFFWVVDLGLSFGVGQVL 72 Query: 64 GIGR 67 + Sbjct: 73 RLAN 76 >gi|148559680|ref|YP_001259168.1| preprotein translocase subunit SecE [Brucella ovis ATCC 25840] gi|148370937|gb|ABQ60916.1| preprotein translocase, SecE subunit [Brucella ovis ATCC 25840] Length = 79 Score = 72.9 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 45/65 (69%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + FF+QVR E+ K+ WP+R E ++S I+V+IM +++ FF + DQ + + + FI Sbjct: 15 ASKTNPIPFFQQVRAETAKVTWPTRRETVISTIMVVIMAFLAAAFFFLADQLMAYGVEFI 74 Query: 63 LGIGR 67 LG+GR Sbjct: 75 LGLGR 79 >gi|260469688|ref|ZP_05813850.1| preprotein translocase, SecE subunit [Mesorhizobium opportunistum WSM2075] gi|259028547|gb|EEW29861.1| preprotein translocase, SecE subunit [Mesorhizobium opportunistum WSM2075] Length = 67 Score = 72.9 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 27/67 (40%), Positives = 39/67 (58%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M F +QVR E+ K+ WPSR E ++S ++V+ I+ VFF DQ +G+ + Sbjct: 1 MASKTTNPFVFLQQVRSETAKVTWPSRRETMISTVMVLAFAVIAMVFFFTADQLMGFAVE 60 Query: 61 FILGIGR 67 ILGIGR Sbjct: 61 QILGIGR 67 >gi|167648398|ref|YP_001686061.1| preprotein translocase subunit SecE [Caulobacter sp. K31] gi|167350828|gb|ABZ73563.1| preprotein translocase, SecE subunit [Caulobacter sp. K31] Length = 104 Score = 72.5 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 38/61 (62%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + + F ++VR E++KI W +R E ++ ++V IM+ ++S+FF + D +G H +L I Sbjct: 42 INPVRFAQEVRAEARKITWTTRKETWITSVMVFIMVVLASLFFTLADWILGLGSHLLLKI 101 Query: 66 G 66 Sbjct: 102 A 102 >gi|319783302|ref|YP_004142778.1| preprotein translocase, SecE subunit [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317169190|gb|ADV12728.1| preprotein translocase, SecE subunit [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 67 Score = 72.5 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 26/67 (38%), Positives = 38/67 (56%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M F +QVR E+ K+ WPSR E ++S ++V+ I+ +FF DQ +G + Sbjct: 1 MASKTTNPFVFLQQVRAETAKVTWPSRRETMISTVMVLAFAVIAMIFFFTADQLMGLAVE 60 Query: 61 FILGIGR 67 ILGIGR Sbjct: 61 QILGIGR 67 >gi|209964024|ref|YP_002296939.1| preprotein translocase subunit SecE [Rhodospirillum centenum SW] gi|209957490|gb|ACI98126.1| Preprotein translocase SecE subunit, putative [Rhodospirillum centenum SW] Length = 71 Score = 72.5 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 41/62 (66%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + F ++VR E K+ WP+R E VS ++V +M+ +++VFFL+ DQ I + + ILG Sbjct: 9 KTSPAEFMREVRREVAKVTWPTRKETTVSTVMVFVMVILAAVFFLLADQFISFAIRLILG 68 Query: 65 IG 66 IG Sbjct: 69 IG 70 >gi|254470305|ref|ZP_05083709.1| preprotein translocase, SecE subunit [Pseudovibrio sp. JE062] gi|211960616|gb|EEA95812.1| preprotein translocase, SecE subunit [Pseudovibrio sp. JE062] Length = 63 Score = 72.5 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 38/60 (63%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QVR E+ K+ WP+R E V+ ++V IM+ ++++FFL DQ + W + +LG Sbjct: 3 KTNPFTFIQQVRSETAKVTWPTRKETGVTTLMVFIMVFLAAMFFLAADQLMSWGISLVLG 62 >gi|17987026|ref|NP_539660.1| preprotein translocase subunit SecE [Brucella melitensis bv. 1 str. 16M] gi|23502127|ref|NP_698254.1| preprotein translocase subunit SecE [Brucella suis 1330] gi|62290160|ref|YP_221953.1| preprotein translocase subunit SecE [Brucella abortus bv. 1 str. 9-941] gi|82700082|ref|YP_414656.1| preprotein translocase subunit SecE [Brucella melitensis biovar Abortus 2308] gi|225627718|ref|ZP_03785755.1| preprotein translocase, SecE subunit [Brucella ceti str. Cudo] gi|237815668|ref|ZP_04594665.1| preprotein translocase, SecE subunit [Brucella abortus str. 2308 A] gi|256369672|ref|YP_003107182.1| translocase [Brucella microti CCM 4915] gi|297248554|ref|ZP_06932272.1| preprotein translocase SecE subunit [Brucella abortus bv. 5 str. B3196] gi|306840284|ref|ZP_07473057.1| preprotein translocase, SecE subunit [Brucella sp. BO2] gi|17982680|gb|AAL51924.1| protein translocase subunit sece [Brucella melitensis bv. 1 str. 16M] gi|23348089|gb|AAN30169.1| preprotein translocase, SecE subunit [Brucella suis 1330] gi|62196292|gb|AAX74592.1| SecE, preprotein translocase, SecE subunit [Brucella abortus bv. 1 str. 9-941] gi|82616183|emb|CAJ11226.1| Protein secE/sec61-gamma protein:SecE subunit of protein translocation complex [Brucella melitensis biovar Abortus 2308] gi|225617723|gb|EEH14768.1| preprotein translocase, SecE subunit [Brucella ceti str. Cudo] gi|237788966|gb|EEP63177.1| preprotein translocase, SecE subunit [Brucella abortus str. 2308 A] gi|255999834|gb|ACU48233.1| translocase [Brucella microti CCM 4915] gi|297175723|gb|EFH35070.1| preprotein translocase SecE subunit [Brucella abortus bv. 5 str. B3196] gi|306289739|gb|EFM60925.1| preprotein translocase, SecE subunit [Brucella sp. BO2] Length = 79 Score = 72.5 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 45/65 (69%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + FF+QVR E+ K+ WP+R E ++S I+V+IM +++ FF + DQ + + + FI Sbjct: 15 ASKTNPITFFQQVRAETAKVTWPTRRETVISTIMVVIMAFLAAAFFFLADQLMAYGVEFI 74 Query: 63 LGIGR 67 LG+GR Sbjct: 75 LGLGR 79 >gi|258541217|ref|YP_003186650.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-01] gi|329114825|ref|ZP_08243582.1| Preprotein Translocase Subunit SecE [Acetobacter pomorum DM001] gi|256632295|dbj|BAH98270.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-01] gi|256635352|dbj|BAI01321.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-03] gi|256638407|dbj|BAI04369.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-07] gi|256641461|dbj|BAI07416.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-22] gi|256644516|dbj|BAI10464.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-26] gi|256647571|dbj|BAI13512.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-32] gi|256650624|dbj|BAI16558.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-01-42C] gi|256653615|dbj|BAI19542.1| protein translocase subunit SecE [Acetobacter pasteurianus IFO 3283-12] gi|326695956|gb|EGE47640.1| Preprotein Translocase Subunit SecE [Acetobacter pomorum DM001] Length = 64 Score = 72.2 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 35/60 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + F VR E++++ WP+R LV+ V+ M ++S+FF +DQ IG + + G+G Sbjct: 4 SPGKFLHDVRAEAERVTWPTRRATLVTTGAVLAMAGMASIFFFFVDQLIGLGVRQLFGLG 63 >gi|119383493|ref|YP_914549.1| preprotein translocase, SecE subunit [Paracoccus denitrificans PD1222] gi|119373260|gb|ABL68853.1| protein translocase subunit secE/sec61 gamma [Paracoccus denitrificans PD1222] Length = 81 Score = 72.2 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 22/64 (34%), Positives = 38/64 (59%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G + + F QVR E KI WP+R EV+ + I+V IM +++S+FF ++D I + Sbjct: 15 GKSMANPVQFISQVRAELGKITWPTRREVVTTTIMVFIMATLASIFFFLVDLLIKTGLSA 74 Query: 62 ILGI 65 ++ + Sbjct: 75 VIHL 78 >gi|58039758|ref|YP_191722.1| protein translocase subunit SecE [Gluconobacter oxydans 621H] gi|58002172|gb|AAW61066.1| Protein translocase subunit SecE [Gluconobacter oxydans 621H] Length = 83 Score = 72.2 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 41/63 (65%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ + + VR E+K++ WP+R L++ V++M++++ +FF ++DQ IG + + Sbjct: 20 SGFNLVAYVRDVRAEAKRVTWPTRRNTLITSGAVLVMVTVTCIFFFIVDQVIGLGVRELF 79 Query: 64 GIG 66 G+G Sbjct: 80 GVG 82 >gi|56698339|ref|YP_168712.1| preprotein translocase subunit SecE [Ruegeria pomeroyi DSS-3] gi|56680076|gb|AAV96742.1| preprotein translocase, SecE subunit [Ruegeria pomeroyi DSS-3] Length = 77 Score = 71.8 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 40/60 (66%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + + F +QVR E K+ WP+R EVL++ ++V IM +++++FF ++D SI + + G+ Sbjct: 16 INPIQFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALTAIFFALVDLSIRGGLQLLFGM 75 >gi|114328706|ref|YP_745863.1| protein translocase subunit secE [Granulibacter bethesdensis CGDNIH1] gi|114316880|gb|ABI62940.1| protein translocase subunit secE [Granulibacter bethesdensis CGDNIH1] Length = 80 Score = 71.8 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 32/61 (52%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F + VR E K+ WPSR E LV+ +V M ++++ FF VIDQ G + Sbjct: 19 TSPAKFLRDVRSEVSKVTWPSRKETLVTTGLVFAMATLAAAFFFVIDQLAGLGISLTFAS 78 Query: 66 G 66 G Sbjct: 79 G 79 >gi|15892098|ref|NP_359812.1| preprotein translocase subunit SecE [Rickettsia conorii str. Malish 7] gi|15619222|gb|AAL02713.1| preprotein translocase SecE subunit [Rickettsia conorii str. Malish 7] Length = 84 Score = 71.8 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L Sbjct: 21 KEYKIYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMQLLL 80 Query: 64 GIGR 67 IG+ Sbjct: 81 NIGK 84 >gi|114570358|ref|YP_757038.1| protein translocase subunit SecE/sec61 gamma [Maricaulis maris MCS10] gi|114340820|gb|ABI66100.1| protein translocase subunit secE/sec61 gamma [Maricaulis maris MCS10] Length = 85 Score = 71.8 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 22/65 (33%), Positives = 37/65 (56%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + + QVR E++K+ W +R E LVS ++V+I+ I+ +FF +D I W + Sbjct: 21 KKKGVGPFKYLSQVRQEARKVTWTTRQETLVSTVLVLILSVIAMLFFWGVDSLISWTIQT 80 Query: 62 ILGIG 66 IL +G Sbjct: 81 ILSLG 85 >gi|126732294|ref|ZP_01748094.1| preprotein translocase, SecE subunit [Sagittula stellata E-37] gi|126707163|gb|EBA06229.1| preprotein translocase, SecE subunit [Sagittula stellata E-37] Length = 79 Score = 71.4 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 37/58 (63%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L F +QVR E KI WP+R EV ++ I+V IM S+++VFF ++D +I + IL Sbjct: 16 TNPLTFIQQVRAEVAKIVWPTRREVTLTSIMVFIMASLTAVFFALVDLAIRSGLTGIL 73 >gi|300022528|ref|YP_003755139.1| preprotein translocase subunit SecE [Hyphomicrobium denitrificans ATCC 51888] gi|299524349|gb|ADJ22818.1| preprotein translocase, SecE subunit [Hyphomicrobium denitrificans ATCC 51888] Length = 76 Score = 71.4 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 43/62 (69%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + F ++VR E K+ WP EV ++ ++V+IM++ +SVFFL++DQ + ++ F+LG Sbjct: 14 KFNPITFIQEVRQEVSKVTWPKWKEVWITTLMVLIMVAFASVFFLLVDQVLSHIVRFVLG 73 Query: 65 IG 66 +G Sbjct: 74 VG 75 >gi|238650691|ref|YP_002916544.1| preprotein translocase subunit SecE [Rickettsia peacockii str. Rustic] gi|238624789|gb|ACR47495.1| preprotein translocase subunit SecE [Rickettsia peacockii str. Rustic] Length = 84 Score = 71.4 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L Sbjct: 21 KEYKIYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMQLLL 80 Query: 64 GIGR 67 IG+ Sbjct: 81 NIGK 84 >gi|149913527|ref|ZP_01902060.1| preprotein translocase, SecE subunit, putative [Roseobacter sp. AzwK-3b] gi|149812647|gb|EDM72476.1| preprotein translocase, SecE subunit, putative [Roseobacter sp. AzwK-3b] Length = 65 Score = 71.4 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 24/61 (39%), Positives = 39/61 (63%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R L F +QVR E K+ WP+R EVL++ ++V IM ++++VFF ++D I + +L Sbjct: 3 RTNPLQFIQQVRAEVAKVVWPTRREVLLTTVMVFIMAALTAVFFALVDLGIRSGLQGLLS 62 Query: 65 I 65 I Sbjct: 63 I 63 >gi|159184992|ref|NP_354937.2| preprotein translocase subunit SecE [Agrobacterium tumefaciens str. C58] gi|159140266|gb|AAK87722.2| secretion protein [Agrobacterium tumefaciens str. C58] Length = 66 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 42/65 (64%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ KI WPSR E ++S +V++M+ +++FF DQ IGWL+ + Sbjct: 2 ASKTNPFTFLQQVRAEASKITWPSRRETMISTAMVLVMVIFAALFFFAADQLIGWLLSLV 61 Query: 63 LGIGR 67 L +GR Sbjct: 62 LNVGR 66 >gi|323136002|ref|ZP_08071085.1| preprotein translocase, SecE subunit [Methylocystis sp. ATCC 49242] gi|322399093|gb|EFY01612.1| preprotein translocase, SecE subunit [Methylocystis sp. ATCC 49242] Length = 62 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 19/62 (30%), Positives = 43/62 (69%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E++K+ WPSR E +++ +VI+M+ +S+FF+++D ++ + + +L + Sbjct: 1 MNPFQFMQEVRAEARKVTWPSRRETMITTGLVILMVLFASLFFVIVDSALRFGVGLMLRV 60 Query: 66 GR 67 G+ Sbjct: 61 GQ 62 >gi|116251525|ref|YP_767363.1| preprotein translocase subunit SecE [Rhizobium leguminosarum bv. viciae 3841] gi|115256173|emb|CAK07254.1| putative transmembrane translocase SecE subunit [Rhizobium leguminosarum bv. viciae 3841] Length = 71 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 41/65 (63%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW + F+ Sbjct: 7 ASKSNPFAFLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWALSFV 66 Query: 63 LGIGR 67 L G Sbjct: 67 LNTGN 71 >gi|227821741|ref|YP_002825711.1| preprotein translocase subunit SecE [Sinorhizobium fredii NGR234] gi|227340740|gb|ACP24958.1| putative preprotein translocase, SecE subunit [Sinorhizobium fredii NGR234] Length = 66 Score = 71.0 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 26/64 (40%), Positives = 40/64 (62%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ K+ WPSR E +S ++V +M+S ++ FF DQ +GWLM I Sbjct: 2 ASKTNPFTFLQQVRSETSKVTWPSRRETTISTLMVFVMVSFAAAFFFGADQLMGWLMSLI 61 Query: 63 LGIG 66 L +G Sbjct: 62 LNVG 65 >gi|260432411|ref|ZP_05786382.1| preprotein translocase, SecE subunit [Silicibacter lacuscaerulensis ITI-1157] gi|260416239|gb|EEX09498.1| preprotein translocase, SecE subunit [Silicibacter lacuscaerulensis ITI-1157] Length = 65 Score = 71.0 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 38/59 (64%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QVR E K+ WP+R EVL++ ++V IM ++++VFF ++D I + ILG Sbjct: 4 TNPIQFIQQVRAEVAKVVWPTRREVLLTTVMVFIMAALTAVFFALVDLGIRGGLQLILG 62 >gi|330991781|ref|ZP_08315731.1| putative preprotein translocase SecE subunit [Gluconacetobacter sp. SXCC-1] gi|329761249|gb|EGG77743.1| putative preprotein translocase SecE subunit [Gluconacetobacter sp. SXCC-1] Length = 64 Score = 70.6 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 38/61 (62%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ F + VR E++K+ WP+R L++ V+ M ++SVFF ++D+ IG + + G+ Sbjct: 3 VSPAKFVEDVRAEARKVTWPTRRATLMTTGAVLAMAGLASVFFFLVDEVIGLAVRKLFGL 62 Query: 66 G 66 G Sbjct: 63 G 63 >gi|153009271|ref|YP_001370486.1| preprotein translocase subunit SecE [Ochrobactrum anthropi ATCC 49188] gi|161619205|ref|YP_001593092.1| preprotein translocase subunit SecE [Brucella canis ATCC 23365] gi|163843514|ref|YP_001627918.1| preprotein translocase subunit SecE [Brucella suis ATCC 23445] gi|189024396|ref|YP_001935164.1| Protein secE/sec61-gamma protein [Brucella abortus S19] gi|225852746|ref|YP_002732979.1| preprotein translocase subunit SecE [Brucella melitensis ATCC 23457] gi|254689466|ref|ZP_05152720.1| preprotein translocase subunit SecE [Brucella abortus bv. 6 str. 870] gi|254693951|ref|ZP_05155779.1| preprotein translocase subunit SecE [Brucella abortus bv. 3 str. Tulya] gi|254697603|ref|ZP_05159431.1| preprotein translocase subunit SecE [Brucella abortus bv. 2 str. 86/8/59] gi|254701989|ref|ZP_05163817.1| preprotein translocase subunit SecE [Brucella suis bv. 5 str. 513] gi|254704531|ref|ZP_05166359.1| preprotein translocase subunit SecE [Brucella suis bv. 3 str. 686] gi|254706573|ref|ZP_05168401.1| preprotein translocase subunit SecE [Brucella pinnipedialis M163/99/10] gi|254710317|ref|ZP_05172128.1| preprotein translocase subunit SecE [Brucella pinnipedialis B2/94] gi|254714314|ref|ZP_05176125.1| preprotein translocase subunit SecE [Brucella ceti M644/93/1] gi|254717751|ref|ZP_05179562.1| preprotein translocase subunit SecE [Brucella ceti M13/05/1] gi|254719304|ref|ZP_05181115.1| preprotein translocase subunit SecE [Brucella sp. 83/13] gi|254730495|ref|ZP_05189073.1| preprotein translocase subunit SecE [Brucella abortus bv. 4 str. 292] gi|256031811|ref|ZP_05445425.1| preprotein translocase subunit SecE [Brucella pinnipedialis M292/94/1] gi|256044896|ref|ZP_05447800.1| preprotein translocase subunit SecE [Brucella melitensis bv. 1 str. Rev.1] gi|256061328|ref|ZP_05451476.1| preprotein translocase subunit SecE [Brucella neotomae 5K33] gi|256113804|ref|ZP_05454604.1| preprotein translocase subunit SecE [Brucella melitensis bv. 3 str. Ether] gi|256159984|ref|ZP_05457699.1| preprotein translocase subunit SecE [Brucella ceti M490/95/1] gi|256255212|ref|ZP_05460748.1| preprotein translocase subunit SecE [Brucella ceti B1/94] gi|256257713|ref|ZP_05463249.1| preprotein translocase subunit SecE [Brucella abortus bv. 9 str. C68] gi|256263767|ref|ZP_05466299.1| protein secE/sec61-gamma protein [Brucella melitensis bv. 2 str. 63/9] gi|260168945|ref|ZP_05755756.1| preprotein translocase subunit SecE [Brucella sp. F5/99] gi|260546705|ref|ZP_05822444.1| secE/sec61-gamma protein [Brucella abortus NCTC 8038] gi|260565502|ref|ZP_05835986.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260566225|ref|ZP_05836695.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260754990|ref|ZP_05867338.1| preprotein translocase subunit SecE [Brucella abortus bv. 6 str. 870] gi|260758206|ref|ZP_05870554.1| preprotein translocase subunit SecE [Brucella abortus bv. 4 str. 292] gi|260762033|ref|ZP_05874376.1| preprotein translocase subunit SecE [Brucella abortus bv. 2 str. 86/8/59] gi|260884000|ref|ZP_05895614.1| preprotein translocase subunit SecE [Brucella abortus bv. 9 str. C68] gi|261314032|ref|ZP_05953229.1| preprotein translocase subunit SecE [Brucella pinnipedialis M163/99/10] gi|261317881|ref|ZP_05957078.1| preprotein translocase subunit SecE [Brucella pinnipedialis B2/94] gi|261325333|ref|ZP_05964530.1| preprotein translocase subunit SecE [Brucella neotomae 5K33] gi|261752557|ref|ZP_05996266.1| preprotein translocase subunit SecE [Brucella suis bv. 5 str. 513] gi|261755215|ref|ZP_05998924.1| preprotein translocase subunit SecE [Brucella suis bv. 3 str. 686] gi|261758438|ref|ZP_06002147.1| protein secE/sec61-gamma protein [Brucella sp. F5/99] gi|265984305|ref|ZP_06097040.1| preprotein translocase subunit SecE [Brucella sp. 83/13] gi|265988910|ref|ZP_06101467.1| preprotein translocase subunit SecE [Brucella pinnipedialis M292/94/1] gi|265991324|ref|ZP_06103881.1| preprotein translocase subunit SecE [Brucella melitensis bv. 1 str. Rev.1] gi|265995161|ref|ZP_06107718.1| preprotein translocase subunit SecE [Brucella melitensis bv. 3 str. Ether] gi|265998374|ref|ZP_06110931.1| preprotein translocase subunit SecE [Brucella ceti M490/95/1] gi|294852585|ref|ZP_06793258.1| preprotein translocase [Brucella sp. NVSL 07-0026] gi|306838949|ref|ZP_07471774.1| preprotein translocase, SecE subunit [Brucella sp. NF 2653] gi|306844154|ref|ZP_07476748.1| preprotein translocase, SecE subunit [Brucella sp. BO1] gi|151561159|gb|ABS14657.1| preprotein translocase, SecE subunit [Ochrobactrum anthropi ATCC 49188] gi|161336016|gb|ABX62321.1| preprotein translocase, SecE subunit [Brucella canis ATCC 23365] gi|163674237|gb|ABY38348.1| preprotein translocase, SecE subunit [Brucella suis ATCC 23445] gi|189019968|gb|ACD72690.1| Protein secE/sec61-gamma protein [Brucella abortus S19] gi|225641111|gb|ACO01025.1| preprotein translocase, SecE subunit [Brucella melitensis ATCC 23457] gi|260095755|gb|EEW79632.1| secE/sec61-gamma protein [Brucella abortus NCTC 8038] gi|260151570|gb|EEW86664.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260155743|gb|EEW90823.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260668524|gb|EEX55464.1| preprotein translocase subunit SecE [Brucella abortus bv. 4 str. 292] gi|260672465|gb|EEX59286.1| preprotein translocase subunit SecE [Brucella abortus bv. 2 str. 86/8/59] gi|260675098|gb|EEX61919.1| preprotein translocase subunit SecE [Brucella abortus bv. 6 str. 870] gi|260873528|gb|EEX80597.1| preprotein translocase subunit SecE [Brucella abortus bv. 9 str. C68] gi|261297104|gb|EEY00601.1| preprotein translocase subunit SecE [Brucella pinnipedialis B2/94] gi|261301313|gb|EEY04810.1| preprotein translocase subunit SecE [Brucella neotomae 5K33] gi|261303058|gb|EEY06555.1| preprotein translocase subunit SecE [Brucella pinnipedialis M163/99/10] gi|261738422|gb|EEY26418.1| protein secE/sec61-gamma protein [Brucella sp. F5/99] gi|261742310|gb|EEY30236.1| preprotein translocase subunit SecE [Brucella suis bv. 5 str. 513] gi|261744968|gb|EEY32894.1| preprotein translocase subunit SecE [Brucella suis bv. 3 str. 686] gi|262552842|gb|EEZ08832.1| preprotein translocase subunit SecE [Brucella ceti M490/95/1] gi|262766274|gb|EEZ12063.1| preprotein translocase subunit SecE [Brucella melitensis bv. 3 str. Ether] gi|263002108|gb|EEZ14683.1| preprotein translocase subunit SecE [Brucella melitensis bv. 1 str. Rev.1] gi|263093878|gb|EEZ17829.1| protein secE/sec61-gamma protein [Brucella melitensis bv. 2 str. 63/9] gi|264661107|gb|EEZ31368.1| preprotein translocase subunit SecE [Brucella pinnipedialis M292/94/1] gi|264662897|gb|EEZ33158.1| preprotein translocase subunit SecE [Brucella sp. 83/13] gi|294821174|gb|EFG38173.1| preprotein translocase [Brucella sp. NVSL 07-0026] gi|306275597|gb|EFM57329.1| preprotein translocase, SecE subunit [Brucella sp. BO1] gi|306405982|gb|EFM62236.1| preprotein translocase, SecE subunit [Brucella sp. NF 2653] gi|326409271|gb|ADZ66336.1| Protein secE/sec61-gamma protein [Brucella melitensis M28] Length = 66 Score = 70.6 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 45/65 (69%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + FF+QVR E+ K+ WP+R E ++S I+V+IM +++ FF + DQ + + + FI Sbjct: 2 ASKTNPITFFQQVRAETAKVTWPTRRETVISTIMVVIMAFLAAAFFFLADQLMAYGVEFI 61 Query: 63 LGIGR 67 LG+GR Sbjct: 62 LGLGR 66 >gi|15965095|ref|NP_385448.1| preprotein translocase subunit SecE [Sinorhizobium meliloti 1021] gi|307314830|ref|ZP_07594423.1| preprotein translocase, SecE subunit [Sinorhizobium meliloti BL225C] gi|307322129|ref|ZP_07601503.1| preprotein translocase, SecE subunit [Sinorhizobium meliloti AK83] gi|15074275|emb|CAC45921.1| Putative preprotein translocase SecE subunit transmembrane [Sinorhizobium meliloti 1021] gi|306892214|gb|EFN23026.1| preprotein translocase, SecE subunit [Sinorhizobium meliloti AK83] gi|306898944|gb|EFN29591.1| preprotein translocase, SecE subunit [Sinorhizobium meliloti BL225C] Length = 66 Score = 70.6 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 40/64 (62%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ K+ WPSR E +S ++V +M+S ++ FF DQ +GW+M I Sbjct: 2 ASKTNPFAFLQQVRAETSKVTWPSRRETTISTLMVFVMVSFAAAFFFGADQLLGWVMSLI 61 Query: 63 LGIG 66 L +G Sbjct: 62 LNVG 65 >gi|150396193|ref|YP_001326660.1| preprotein translocase subunit SecE [Sinorhizobium medicae WSM419] gi|150027708|gb|ABR59825.1| preprotein translocase, SecE subunit [Sinorhizobium medicae WSM419] Length = 66 Score = 70.6 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 40/64 (62%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ K+ WPSR E +S ++V +M+S ++ FF DQ +GW+M I Sbjct: 2 ASKTNPFTFLQQVRSETSKVTWPSRRETTISTLMVFVMVSFAAAFFFGADQLLGWVMSLI 61 Query: 63 LGIG 66 L +G Sbjct: 62 LNVG 65 >gi|325293352|ref|YP_004279216.1| preprotein translocase subunit secE [Agrobacterium sp. H13-3] gi|325061205|gb|ADY64896.1| probable preprotein translocase subunit secE [Agrobacterium sp. H13-3] Length = 66 Score = 70.2 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 25/65 (38%), Positives = 42/65 (64%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ KI WPSR E ++S +V++M+ +++FF DQ IGW++ + Sbjct: 2 ASKTNPFTFLQQVRAEASKITWPSRRETMISTAMVLVMVIFAALFFFAADQLIGWVLSLV 61 Query: 63 LGIGR 67 L +GR Sbjct: 62 LNVGR 66 >gi|148260035|ref|YP_001234162.1| preprotein translocase, SecE subunit [Acidiphilium cryptum JF-5] gi|326403009|ref|YP_004283090.1| putative protein translocase subunit SecE/Sec61 [Acidiphilium multivorum AIU301] gi|146401716|gb|ABQ30243.1| protein translocase subunit secE/sec61 gamma [Acidiphilium cryptum JF-5] gi|325049870|dbj|BAJ80208.1| putative protein translocase subunit SecE/Sec61 [Acidiphilium multivorum AIU301] Length = 64 Score = 70.2 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 27/61 (44%), Positives = 38/61 (62%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F + VR E+ K WPSR E LV+ VV+ M+ ++ VFFLV+DQ IG+ M + G+G Sbjct: 4 NPAKFLRDVRSEASKTTWPSRKETLVTTGVVLAMVVVTIVFFLVVDQVIGFGMRLLFGVG 63 Query: 67 R 67 Sbjct: 64 N 64 >gi|254464491|ref|ZP_05077902.1| preprotein translocase, SecE subunit [Rhodobacterales bacterium Y4I] gi|206685399|gb|EDZ45881.1| preprotein translocase, SecE subunit [Rhodobacterales bacterium Y4I] Length = 65 Score = 70.2 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 41/60 (68%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + + F +QVR E K+ WP+R EVL++ ++V IM +++++FF ++D I + + +LG+ Sbjct: 4 INPVQFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALTALFFALVDLLIRYGLQGLLGM 63 >gi|328543343|ref|YP_004303452.1| Preprotein translocase, SecE subunit [Polymorphum gilvum SL003B-26A1] gi|326413088|gb|ADZ70151.1| Preprotein translocase, SecE subunit [Polymorphum gilvum SL003B-26A1] Length = 65 Score = 70.2 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 41/62 (66%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QVR E K+ WP+R E V+ ++V +M+ I+S+FFL+ DQ++ W + +LG Sbjct: 3 KTNPFTFVQQVRSEVSKVTWPTRRETAVTTVMVFVMVLIASIFFLLADQAMSWGIGLLLG 62 Query: 65 IG 66 IG Sbjct: 63 IG 64 >gi|85375047|ref|YP_459109.1| preprotein translocase, SecE subunit [Erythrobacter litoralis HTCC2594] gi|84788130|gb|ABC64312.1| preprotein translocase, SecE subunit [Erythrobacter litoralis HTCC2594] Length = 70 Score = 70.2 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 23/63 (36%), Positives = 39/63 (61%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + F +QVR E+ K+ WP+R E + + I V IM+ I S+FFL ID + G ++ ++L Sbjct: 8 KKTSPGEFVRQVRSETSKVVWPTREETIRTAIFVGIMVIILSLFFLAIDSAFGAIVRWLL 67 Query: 64 GIG 66 + Sbjct: 68 TLA 70 >gi|85706804|ref|ZP_01037895.1| preprotein translocase, SecE subunit [Roseovarius sp. 217] gi|85668597|gb|EAQ23467.1| preprotein translocase, SecE subunit [Roseovarius sp. 217] Length = 73 Score = 69.8 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 39/61 (63%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R L F +QVR E K+ WP+R EV+++ ++V IM +I+++FF ++D I + +L Sbjct: 11 RTNPLQFIQQVRSEVAKVVWPTRREVVLTTVMVFIMATITAIFFALVDLGIRSGLQGVLS 70 Query: 65 I 65 + Sbjct: 71 L 71 >gi|254509620|ref|ZP_05121687.1| preprotein translocase, SecE subunit [Rhodobacteraceae bacterium KLH11] gi|221533331|gb|EEE36319.1| preprotein translocase, SecE subunit [Rhodobacteraceae bacterium KLH11] Length = 65 Score = 69.8 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 38/59 (64%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QVR E K+ WP+R EVL++ ++V IM ++++VFF ++D I + +LG Sbjct: 4 TNPIQFIQQVRAEVAKVVWPTRREVLLTTVMVFIMAALTAVFFALVDLGIRGGLQLVLG 62 >gi|209548921|ref|YP_002280838.1| preprotein translocase subunit SecE [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209534677|gb|ACI54612.1| preprotein translocase, SecE subunit [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 66 Score = 69.8 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 41/65 (63%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW + F+ Sbjct: 2 ASKSNPFAFLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWALSFV 61 Query: 63 LGIGR 67 L G Sbjct: 62 LNTGN 66 >gi|218677876|ref|ZP_03525773.1| preprotein translocase subunit SecE [Rhizobium etli CIAT 894] Length = 68 Score = 69.8 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 42/65 (64%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW++ F+ Sbjct: 4 ASKSNPFAFLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWVLSFV 63 Query: 63 LGIGR 67 L G Sbjct: 64 LNTGN 68 >gi|241204151|ref|YP_002975247.1| preprotein translocase subunit SecE [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240858041|gb|ACS55708.1| preprotein translocase, SecE subunit [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 66 Score = 69.5 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 41/65 (63%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW + F+ Sbjct: 2 ASKSNPFTFLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWALSFV 61 Query: 63 LGIGR 67 L G Sbjct: 62 LNTGN 66 >gi|304391358|ref|ZP_07373300.1| preprotein translocase, SecE subunit [Ahrensia sp. R2A130] gi|303295587|gb|EFL89945.1| preprotein translocase, SecE subunit [Ahrensia sp. R2A130] Length = 63 Score = 69.5 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 39/62 (62%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +R F +QVR E K+ WP+R E +V+ I+ +I++ ++++FF V+DQ + + F+ Sbjct: 2 ASRTNPFTFLQQVRAEVSKVVWPTRKETVVTTIMTLILVFLTAIFFFVVDQLLSYGTGFL 61 Query: 63 LG 64 G Sbjct: 62 FG 63 >gi|182678324|ref|YP_001832470.1| preprotein translocase, SecE subunit [Beijerinckia indica subsp. indica ATCC 9039] gi|182634207|gb|ACB94981.1| preprotein translocase, SecE subunit [Beijerinckia indica subsp. indica ATCC 9039] Length = 63 Score = 69.5 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 42/61 (68%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F + VR E+ K+ WPSR E L++ ++VI+M+ ++S+FF+ +DQ++ ++ FIL +G Sbjct: 3 NPFQFLQDVRTEATKVTWPSRRETLITTLLVILMVLVASLFFVSVDQALRLIVTFILSLG 62 Query: 67 R 67 Sbjct: 63 H 63 >gi|90424963|ref|YP_533333.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris BisB18] gi|90106977|gb|ABD89014.1| protein translocase subunit secE/sec61 gamma [Rhodopseudomonas palustris BisB18] Length = 63 Score = 69.5 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 39/59 (66%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E+ K+ WPSR E ++ I+V +M++++S+FF DQ I + F+LGI Sbjct: 4 SPFKFLQEVRTETSKVTWPSRRETTITTIMVFVMVALASIFFFFADQIIRLFITFLLGI 62 >gi|46202851|ref|ZP_00052494.2| COG0690: Preprotein translocase subunit SecE [Magnetospirillum magnetotacticum MS-1] Length = 65 Score = 69.5 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 26/62 (41%), Positives = 39/62 (62%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + FFKQVR E K+ WP+R E VS +V +M+ I++VFFLV+DQ + + G Sbjct: 3 KTSPALFFKQVRQEVAKVTWPTRRETTVSTGMVFVMVVIAAVFFLVVDQIFAASVKLLFG 62 Query: 65 IG 66 +G Sbjct: 63 LG 64 >gi|115525608|ref|YP_782519.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris BisA53] gi|115519555|gb|ABJ07539.1| protein translocase subunit secE/sec61 gamma [Rhodopseudomonas palustris BisA53] Length = 63 Score = 69.5 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 27/59 (45%), Positives = 40/59 (67%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E+ K+ WPSR E ++ I+V IM+++SS+FF DQ I L+ FILGI Sbjct: 4 SPFKFLQEVRSETAKVTWPSRRETTITTIMVFIMVALSSIFFFFADQFIRLLVTFILGI 62 >gi|217979959|ref|YP_002364106.1| preprotein translocase, SecE subunit [Methylocella silvestris BL2] gi|217505335|gb|ACK52744.1| preprotein translocase, SecE subunit [Methylocella silvestris BL2] Length = 63 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 43/62 (69%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E+ K+ WP+R E +++ +VI+M+ +S+FF+ +DQ++ + + ++G+ Sbjct: 2 VNPFQFIQEVRTEAGKVTWPTRRETMITTGLVILMVLFASLFFVAVDQTLRFAVTLLMGL 61 Query: 66 GR 67 GR Sbjct: 62 GR 63 >gi|148555475|ref|YP_001263057.1| protein translocase subunit secE/sec61 gamma [Sphingomonas wittichii RW1] gi|148500665|gb|ABQ68919.1| protein translocase subunit secE/sec61 gamma [Sphingomonas wittichii RW1] Length = 65 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 37/61 (60%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + + F QV+ E++K+ WPSR E + + I+V IM + +FF IDQ ++ F+L Sbjct: 3 KTSPVEFINQVKAETRKVVWPSRKETIATTIMVGIMTLLLGLFFFGIDQMFASIVKFLLS 62 Query: 65 I 65 + Sbjct: 63 L 63 >gi|316933505|ref|YP_004108487.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris DX-1] gi|315601219|gb|ADU43754.1| preprotein translocase, SecE subunit [Rhodopseudomonas palustris DX-1] Length = 62 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 39/59 (66%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E+ K+ WP+R E ++ I+V +M++++S+FF DQ I L+ +LG+ Sbjct: 4 SPFKFLQEVRSETAKVTWPTRRETSITTIMVFVMVALASIFFFAADQVISLLIRLVLGV 62 >gi|192292064|ref|YP_001992669.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris TIE-1] gi|192285813|gb|ACF02194.1| preprotein translocase, SecE subunit [Rhodopseudomonas palustris TIE-1] Length = 62 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 39/59 (66%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E+ K+ WP+R E ++ I+V +M++++S+FF DQ I L+ +LG+ Sbjct: 4 SPFKFLQEVRSETAKVTWPTRRETSITTIMVFVMVALASIFFFAADQVISVLIRLLLGV 62 >gi|144900867|emb|CAM77731.1| Protein secE/sec61-gamma protein [Magnetospirillum gryphiswaldense MSR-1] Length = 66 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 41/62 (66%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + F KQVR E+ K+ WPSR E VS ++V +M+ +++VFFL++DQ + F+ G Sbjct: 4 KTSPAQFVKQVRQEAAKVTWPSRKETTVSTMMVFVMVVLAAVFFLLVDQVFATAVKFVFG 63 Query: 65 IG 66 +G Sbjct: 64 LG 65 >gi|86357291|ref|YP_469183.1| preprotein translocase subunit SecE [Rhizobium etli CFN 42] gi|86281393|gb|ABC90456.1| protein-export translocase protein [Rhizobium etli CFN 42] Length = 66 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 43/65 (66%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW++ F+ Sbjct: 2 ASKSNPIAFLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWVLSFV 61 Query: 63 LGIGR 67 L G Sbjct: 62 LNTGN 66 >gi|190891341|ref|YP_001977883.1| protein-export translocase protein [Rhizobium etli CIAT 652] gi|218512770|ref|ZP_03509610.1| preprotein translocase subunit SecE [Rhizobium etli 8C-3] gi|190696620|gb|ACE90705.1| protein-export translocase protein [Rhizobium etli CIAT 652] gi|327194520|gb|EGE61378.1| protein-export translocase protein [Rhizobium etli CNPAF512] Length = 66 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 42/65 (64%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW++ F+ Sbjct: 2 ASKSNPFAFLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWVLSFV 61 Query: 63 LGIGR 67 L G Sbjct: 62 LNTGN 66 >gi|296282314|ref|ZP_06860312.1| preprotein translocase, SecE subunit [Citromicrobium bathyomarinum JL354] Length = 78 Score = 69.1 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 38/65 (58%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 R + FF QV+ E+ K+ WP+R E + + I V I++ I S+FFL ID G ++ F Sbjct: 14 KKRRTSPGEFFNQVKAETSKVVWPTRQETVQTAIFVSILVLILSLFFLGIDTLFGAVVRF 73 Query: 62 ILGIG 66 +L + Sbjct: 74 LLTLA 78 >gi|149203663|ref|ZP_01880632.1| SecE subunit of protein translocation complex [Roseovarius sp. TM1035] gi|149142780|gb|EDM30822.1| SecE subunit of protein translocation complex [Roseovarius sp. TM1035] Length = 65 Score = 68.7 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 39/61 (63%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R + F +QVR E K+ WP+R EV+++ ++V IM +I+++FF ++D I + +L Sbjct: 3 RTNPVQFIQQVRSEVAKVVWPNRREVMLTTVMVFIMATITAIFFALVDLGIRSGLQGVLS 62 Query: 65 I 65 + Sbjct: 63 L 63 >gi|255263610|ref|ZP_05342952.1| preprotein translocase, SecE subunit [Thalassiobium sp. R2A62] gi|255105945|gb|EET48619.1| preprotein translocase, SecE subunit [Thalassiobium sp. R2A62] Length = 66 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 38/60 (63%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R + F +VR E K+ WP+R EV+++ I+V IM ++++VFF ++D I + +LG Sbjct: 3 RTNPIQFINEVRAEVSKVVWPTRREVVLTTIMVFIMAALTAVFFSIVDLIIRSGLQGVLG 62 >gi|163796065|ref|ZP_02190027.1| transcription antitermination protein NusG [alpha proteobacterium BAL199] gi|159178524|gb|EDP63064.1| transcription antitermination protein NusG [alpha proteobacterium BAL199] Length = 66 Score = 68.3 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 38/62 (61%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +++ F +QVR E ++ W +R + + ++V IM+ +S+FF ++D + W + +LG Sbjct: 4 KVSPAQFVRQVRQEVSRVTWATRKDTATATLMVFIMVFAASIFFFLVDLGLSWGVQKVLG 63 Query: 65 IG 66 +G Sbjct: 64 LG 65 >gi|126737139|ref|ZP_01752874.1| preprotein translocase, SecE subunit [Roseobacter sp. SK209-2-6] gi|126721724|gb|EBA18427.1| preprotein translocase, SecE subunit [Roseobacter sp. SK209-2-6] Length = 65 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 41/60 (68%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + + F +QVR E K+ WP+R EVL++ ++V IM ++++VFF ++D I + + +LG+ Sbjct: 4 INPVQFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALTAVFFALVDLLIRFGLQGLLGM 63 >gi|89071243|ref|ZP_01158422.1| preprotein translocase, SecE subunit [Oceanicola granulosus HTCC2516] gi|89043229|gb|EAR49459.1| preprotein translocase, SecE subunit [Oceanicola granulosus HTCC2516] Length = 66 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 38/61 (62%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R F QVR E K+ WP+R EV+++ ++V +M +++++FF ++D +I + +L Sbjct: 3 RTNPAQFISQVRAEVSKVTWPTRREVVLTTVMVFLMATLAAIFFFLVDLAIRSGLTGVLS 62 Query: 65 I 65 + Sbjct: 63 M 63 >gi|37913003|gb|AAR05332.1| predicted preprotein translocase subunit SecE [uncultured marine alpha proteobacterium HOT2C01] Length = 77 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 40/66 (60%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + VN + F ++VR E K+ WP+ E L ++V+++ + ++VFFL+IDQ + + Sbjct: 11 LKVNFMKPFKFIQEVRREGSKVTWPTSRETLTGSVMVVLITAFAAVFFLIIDQIFSFGLD 70 Query: 61 FILGIG 66 ++G+ Sbjct: 71 KLIGVA 76 >gi|296447966|ref|ZP_06889873.1| preprotein translocase, SecE subunit [Methylosinus trichosporium OB3b] gi|296254533|gb|EFH01653.1| preprotein translocase, SecE subunit [Methylosinus trichosporium OB3b] Length = 63 Score = 67.9 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 40/61 (65%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F + VR E+ K+ WP+R E L++ +VI+M+ +S+FF+++D+++ + +L +G Sbjct: 3 NPFQFLQDVRSEATKVVWPTRRETLITTGLVILMVLFASLFFVLVDKTLHVAVGLLLRMG 62 Query: 67 R 67 + Sbjct: 63 Q 63 >gi|218463230|ref|ZP_03503321.1| preprotein translocase subunit SecE [Rhizobium etli Kim 5] Length = 65 Score = 67.5 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 42/64 (65%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ F +QVR E+ K+ WPSR E ++S ++V++M+ +++FF DQ IGW++ F+ Sbjct: 2 ASKSNPFAFLQQVRSETSKVTWPSRRETMISTVMVLVMVVFAALFFFAADQLIGWVLSFV 61 Query: 63 LGIG 66 L G Sbjct: 62 LNTG 65 >gi|83949813|ref|ZP_00958546.1| preprotein translocase, SecE subunit [Roseovarius nubinhibens ISM] gi|83837712|gb|EAP77008.1| preprotein translocase, SecE subunit [Roseovarius nubinhibens ISM] Length = 65 Score = 67.5 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 38/61 (62%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R F +QVR E K+ WP+R EV ++ ++V IM +++++FF ++D I + +LG Sbjct: 3 RTNPFQFIQQVRSEVAKVVWPTRREVFLTTVMVFIMATLTAIFFALVDLGIRTGLTSVLG 62 Query: 65 I 65 + Sbjct: 63 L 63 >gi|319405862|emb|CBI79494.1| preprotein translocase, SecE subunit [Bartonella sp. AR 15-3] Length = 70 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 42/57 (73%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 +++ + F KQVR E+ K+ WP+R E ++S ++V+I+ +++SVFF V+DQ++ + + Sbjct: 2 ASKINPITFLKQVRAETAKVKWPTRRETVISTVMVLIVTALASVFFFVVDQTVNFGV 58 >gi|325679010|ref|ZP_08158608.1| preprotein translocase, SecE subunit [Ruminococcus albus 8] gi|324109514|gb|EGC03732.1| preprotein translocase, SecE subunit [Ruminococcus albus 8] Length = 84 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 38/57 (66%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 +FK++R E KK+ WP+R +V+ + VV++++S+ +F +D + + + ++G+G Sbjct: 26 KYFKELRAELKKVVWPTRQQVVNNTGVVLVVMSLMGLFLFAVDTGLSYGIRALIGLG 82 >gi|163739417|ref|ZP_02146827.1| preprotein translocase, SecE subunit, putative [Phaeobacter gallaeciensis BS107] gi|163740206|ref|ZP_02147600.1| preprotein translocase, SecE subunit [Phaeobacter gallaeciensis 2.10] gi|254475455|ref|ZP_05088841.1| preprotein translocase, SecE subunit [Ruegeria sp. R11] gi|161386064|gb|EDQ10439.1| preprotein translocase, SecE subunit [Phaeobacter gallaeciensis 2.10] gi|161387170|gb|EDQ11529.1| preprotein translocase, SecE subunit, putative [Phaeobacter gallaeciensis BS107] gi|214029698|gb|EEB70533.1| preprotein translocase, SecE subunit [Ruegeria sp. R11] Length = 65 Score = 66.8 bits (162), Expect = 9e-10, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 40/60 (66%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F +QVR E K+ WP+R EVL++ ++V +M ++++VFF ++D I + + ILG+ Sbjct: 4 TNPVQFIQQVRAEVSKVVWPTRREVLLTTVMVFVMAALTAVFFAIVDILIRFGLEGILGM 63 >gi|326386499|ref|ZP_08208122.1| protein translocase subunit secE/sec61 gamma [Novosphingobium nitrogenifigens DSM 19370] gi|326209160|gb|EGD59954.1| protein translocase subunit secE/sec61 gamma [Novosphingobium nitrogenifigens DSM 19370] Length = 65 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 22/62 (35%), Positives = 38/62 (61%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + FF QV+ E++K+ WP+R E + I V +M+ + SVFFL ID G+++ +L Sbjct: 3 KTSPNEFFNQVKAEARKVVWPTRQETTSTAIFVALMMVLLSVFFLGIDSLFGYVVKILLS 62 Query: 65 IG 66 + Sbjct: 63 LA 64 >gi|86749395|ref|YP_485891.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris HaA2] gi|86572423|gb|ABD06980.1| protein translocase subunit secE/sec61 gamma [Rhodopseudomonas palustris HaA2] Length = 63 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 25/59 (42%), Positives = 41/59 (69%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E+ K+ WPSR EV ++ I+V IM++++S+FF DQ I L+ F+LG+ Sbjct: 5 SPFKFLQEVRSETAKVTWPSRREVTITTIMVFIMVALASIFFFAADQVIRILITFVLGV 63 >gi|319404388|emb|CBI77991.1| preprotein translocase, SecE subunit [Bartonella rochalimae ATCC BAA-1498] Length = 70 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 43/57 (75%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 V+++ + F KQVR E+ K+ WPSR E ++S ++V+++ +++SVFF V+DQ++ + + Sbjct: 2 VSKINPITFLKQVRAETAKVKWPSRRETVISTVMVLVVTALASVFFFVVDQTVNFGV 58 >gi|86137178|ref|ZP_01055756.1| preprotein translocase, SecE subunit [Roseobacter sp. MED193] gi|85826502|gb|EAQ46699.1| preprotein translocase, SecE subunit [Roseobacter sp. MED193] Length = 64 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 41/60 (68%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L + F +QVR E K+ WP+R EVL++ ++V IM ++++VFF ++D I + + +LG+ Sbjct: 4 LNPVQFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALTAVFFALVDLVIRFGLQSLLGM 63 >gi|114319606|ref|YP_741289.1| preprotein translocase subunit SecE [Alkalilimnicola ehrlichii MLHE-1] gi|114226000|gb|ABI55799.1| protein translocase subunit secE/sec61 gamma [Alkalilimnicola ehrlichii MLHE-1] Length = 125 Score = 66.4 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 37/60 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 AV F + R E +K+ WP+R E L + ++V +M+ + ++F ++D GW + I+G+G Sbjct: 65 AVWQFARASRQELRKVVWPNRQETLQTTLIVFVMVVLVALFLWLVDLLAGWGIGRIIGLG 124 >gi|92117078|ref|YP_576807.1| preprotein translocase subunit SecE [Nitrobacter hamburgensis X14] gi|91799972|gb|ABE62347.1| protein translocase subunit secE/sec61 gamma [Nitrobacter hamburgensis X14] Length = 63 Score = 66.0 bits (160), Expect = 1e-09, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 39/59 (66%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E+ K+ WPSR E V+ I+V +M++++S+FF DQ I + F+LG+ Sbjct: 4 SPFKFLQEVRTETAKVTWPSRRETTVTTIMVFVMVALASLFFFFTDQIIRIFITFVLGL 62 >gi|159042814|ref|YP_001531608.1| preprotein translocase subunit SecE [Dinoroseobacter shibae DFL 12] gi|157910574|gb|ABV92007.1| preprotein translocase, SecE subunit [Dinoroseobacter shibae DFL 12] Length = 66 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 34/59 (57%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F +QVR E K+ WP+R EV+V+ ++V M ++++FF +D I + F+L Sbjct: 4 TNPFQFLQQVRAEVSKVTWPTRKEVMVTSLMVFAMAILTAIFFFFVDWMIRTGLQFVLN 62 >gi|87198853|ref|YP_496110.1| protein translocase subunit secE/sec61 gamma [Novosphingobium aromaticivorans DSM 12444] gi|87134534|gb|ABD25276.1| protein translocase subunit secE/sec61 gamma [Novosphingobium aromaticivorans DSM 12444] Length = 64 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 22/62 (35%), Positives = 37/62 (59%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + FF QV+ E++K+ WP+R E + I V IM+ I +VFFL +D ++ F+L Sbjct: 3 KTSPGEFFNQVKAEARKVVWPTRQETTTTAIFVGIMMLILAVFFLGVDSLFSAIVRFLLS 62 Query: 65 IG 66 + Sbjct: 63 LA 64 >gi|254486178|ref|ZP_05099383.1| preprotein translocase, SecE subunit [Roseobacter sp. GAI101] gi|214043047|gb|EEB83685.1| preprotein translocase, SecE subunit [Roseobacter sp. GAI101] Length = 65 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 24/59 (40%), Positives = 39/59 (66%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 L L F +QVR E KI WP+R EV+++ ++V I+ ++++VFF V+D I + +IL Sbjct: 4 LNPLQFIQQVRSEVSKIVWPTRREVMLTTVMVFILAALTAVFFAVVDILIRGGLQYILS 62 >gi|34580871|ref|ZP_00142351.1| preprotein translocase SecE subunit [Rickettsia sibirica 246] gi|229586373|ref|YP_002844874.1| preprotein translocase subunit SecE [Rickettsia africae ESF-5] gi|75442741|sp|Q7B6T4|SECE_RICSI RecName: Full=Preprotein translocase subunit secE gi|75444377|sp|Q7WWR6|SECE_RICPA RecName: Full=Preprotein translocase subunit secE gi|75448064|sp|Q8KHU8|SECE_RICRH RecName: Full=Preprotein translocase subunit secE gi|124053381|sp|Q92J92|SECE_RICCN RecName: Full=Preprotein translocase subunit secE gi|124053382|sp|Q4UKC8|SECE_RICFE RecName: Full=Preprotein translocase subunit secE gi|22087295|gb|AAM90916.1|AF502171_2 preprotein translocase SecE subunit [Rickettsia parkeri] gi|22087299|gb|AAM90918.1|AF502172_2 preprotein translocase SecE subunit [Rickettsia sibirica] gi|22087303|gb|AAM90920.1|AF502173_2 preprotein translocase SecE subunit [Rickettsia rhipicephali] gi|28262256|gb|EAA25760.1| preprotein translocase SecE subunit [Rickettsia sibirica 246] gi|228021423|gb|ACP53131.1| Preprotein translocase SecE subunit [Rickettsia africae ESF-5] Length = 66 Score = 66.0 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L Sbjct: 3 KEYKIYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLICLVLDYSIHNIMQLLL 62 Query: 64 GIGR 67 IG+ Sbjct: 63 NIGK 66 >gi|110681151|ref|YP_684158.1| preprotein translocase subunit SecE [Roseobacter denitrificans OCh 114] gi|163732874|ref|ZP_02140319.1| preprotein translocase, SecE subunit, putative [Roseobacter litoralis Och 149] gi|109457267|gb|ABG33472.1| preprotein translocase, SecE subunit, putative [Roseobacter denitrificans OCh 114] gi|161394234|gb|EDQ18558.1| preprotein translocase, SecE subunit, putative [Roseobacter litoralis Och 149] Length = 65 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 39/60 (65%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F +QVR E K+ WP+R EV+++ ++V I+ ++++VFF ++D I W + +L + Sbjct: 4 TNPLQFIQQVRAEVSKVVWPTRREVMLTTVMVFILAALTAVFFALVDILIRWGLQSVLTM 63 >gi|110634175|ref|YP_674383.1| preprotein translocase subunit SecE [Mesorhizobium sp. BNC1] gi|9957207|gb|AAG09264.1| SecE [EDTA-degrading bacterium BNC1] gi|110285159|gb|ABG63218.1| protein translocase subunit secE/sec61 gamma [Chelativorans sp. BNC1] Length = 67 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 25/66 (37%), Positives = 39/66 (59%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M F +QVR E+ K+ WPSR E L+S ++V+ +++++FF DQ + W + Sbjct: 1 MASRTTNPFTFLQQVRSETAKVTWPSRRETLISTVMVLAFAALAAIFFFAADQLMAWAIE 60 Query: 61 FILGIG 66 ILGIG Sbjct: 61 LILGIG 66 >gi|260577198|ref|ZP_05845174.1| preprotein translocase, SecE subunit [Rhodobacter sp. SW2] gi|259020578|gb|EEW23898.1| preprotein translocase, SecE subunit [Rhodobacter sp. SW2] Length = 66 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 38/59 (64%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + L F +QVR E K+ WP+R EV+++ I+V IM ++++ FF ++D + + + +L Sbjct: 3 KANPLQFIQQVRSEVSKVVWPTRREVMLTTIMVFIMAALAATFFSLVDIVLRFGLSTVL 61 >gi|75675536|ref|YP_317957.1| preprotein translocase subunit SecE [Nitrobacter winogradskyi Nb-255] gi|74420406|gb|ABA04605.1| protein translocase subunit secE/sec61 gamma [Nitrobacter winogradskyi Nb-255] Length = 63 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 39/59 (66%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E+ K+ WPSR E V+ I+V +M++++S+FF DQ I + F+LG+ Sbjct: 4 SPFKFLQEVRTETAKVTWPSRRETTVTTIMVFVMVALASIFFFFTDQIIRVFITFVLGL 62 >gi|75448742|sp|Q8KTB5|SECE_RICMO RecName: Full=Preprotein translocase subunit secE gi|22087307|gb|AAM90922.1|AF502174_2 preprotein translocase SecE subunit [Rickettsia montanensis] Length = 66 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 40/64 (62%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S LV+D SI +M +L Sbjct: 3 KEYKIYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSPICLVLDYSIHNIMQLLL 62 Query: 64 GIGR 67 IG+ Sbjct: 63 NIGK 66 >gi|319408377|emb|CBI82032.1| preprotein translocase, SecE subunit [Bartonella schoenbuchensis R1] Length = 71 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 39/57 (68%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 ++ + FFKQV E+ K+ WP+R E +VS ++V+++ + +S+FF V+DQ I + + Sbjct: 2 ASKTNPITFFKQVFAETAKVKWPTRRETVVSTVIVLVLAAFASIFFFVVDQVINFGV 58 >gi|319407389|emb|CBI81040.1| preprotein translocase, SecE subunit [Bartonella sp. 1-1C] Length = 70 Score = 65.6 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 41/57 (71%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 +++ + F KQVR E+ K+ WPSR E ++S ++V+++ +++SV F V+DQ++ + + Sbjct: 2 ASKINPITFLKQVRAETAKVKWPSRRETVISTVMVLVVTALASVLFFVVDQTVNFGI 58 >gi|84685455|ref|ZP_01013353.1| preprotein translocase, SecE subunit [Maritimibacter alkaliphilus HTCC2654] gi|84666612|gb|EAQ13084.1| preprotein translocase, SecE subunit [Rhodobacterales bacterium HTCC2654] Length = 65 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 36/60 (60%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R F +QVR E K+ WP+R EV+++ +VI + ++ +VFF ++D +I + +L Sbjct: 3 RTNPFQFIQQVRSEVSKVTWPTRREVMLTSGMVIALTALVAVFFSLVDLAIRSGLTGLLS 62 >gi|85715150|ref|ZP_01046134.1| SecE subunit of protein translocation complex [Nitrobacter sp. Nb-311A] gi|85698065|gb|EAQ35938.1| SecE subunit of protein translocation complex [Nitrobacter sp. Nb-311A] Length = 63 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 39/59 (66%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E+ K+ WPSR E V+ I+V +M++++S+FF DQ I + F+LG+ Sbjct: 4 SPFKFLQEVRTETAKVSWPSRRETTVTTIMVFVMVALASIFFFFTDQIIRVFITFVLGL 62 >gi|126734757|ref|ZP_01750503.1| SecE subunit of protein translocation complex [Roseobacter sp. CCS2] gi|126715312|gb|EBA12177.1| SecE subunit of protein translocation complex [Roseobacter sp. CCS2] Length = 66 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 38/57 (66%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F ++VR E K+ WP+R EVL++ ++V IM ++++VFF ++D I ++ +L Sbjct: 5 NPMKFIQEVRAEVSKVVWPTRREVLMTTVMVFIMAALTAVFFALVDLLIRTGLNGVL 61 >gi|262277082|ref|ZP_06054875.1| preprotein translocase, SecE subunit [alpha proteobacterium HIMB114] gi|262224185|gb|EEY74644.1| preprotein translocase, SecE subunit [alpha proteobacterium HIMB114] Length = 60 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 39/58 (67%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +NFF+ V+ E+ KI WPSR E L+ + VI M I+S+FFL++DQ + + F++G Sbjct: 3 NPINFFRSVKQEAFKITWPSRKETLMGSVTVIFMAIIASLFFLLLDQIFKFGLGFLIG 60 >gi|163868083|ref|YP_001609287.1| preprotein translocase subunit SecE [Bartonella tribocorum CIP 105476] gi|161017734|emb|CAK01292.1| preprotein translocase, SecE subunit [Bartonella tribocorum CIP 105476] Length = 70 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 41/63 (65%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + F KQV E+ K+ WP+R E ++S I+V+++ +++S FF ++DQ + + + + Sbjct: 2 ASKTNPIAFLKQVYAETVKVKWPTRRETVISTIMVLLVTALASAFFFIVDQVMHFGVWRV 61 Query: 63 LGI 65 + + Sbjct: 62 IDL 64 >gi|157828049|ref|YP_001494291.1| preprotein translocase subunit SecE [Rickettsia rickettsii str. 'Sheila Smith'] gi|165932746|ref|YP_001649535.1| preprotein translocase subunit SecE [Rickettsia rickettsii str. Iowa] gi|75448743|sp|Q8KTC0|SECE_RICRI RecName: Full=Preprotein translocase subunit secE gi|22087291|gb|AAM90914.1|AF502170_2 preprotein translocase SecE subunit [Rickettsia rickettsii] gi|157800530|gb|ABV75783.1| preprotein translocase subunit SecE [Rickettsia rickettsii str. 'Sheila Smith'] gi|165907833|gb|ABY72129.1| protein translocase subunit [Rickettsia rickettsii str. Iowa] Length = 66 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP+R E++ S +VV++ + I S+ LV+D SI +M +L Sbjct: 3 KEYKIYKFFEQVKQETYKVVWPTRKELVASTLVVVVAVFIFSLTCLVLDYSIHNIMQLLL 62 Query: 64 GIGR 67 IG+ Sbjct: 63 NIGK 66 >gi|83854995|ref|ZP_00948525.1| preprotein translocase, SecE subunit [Sulfitobacter sp. NAS-14.1] gi|83941517|ref|ZP_00953979.1| preprotein translocase, SecE subunit [Sulfitobacter sp. EE-36] gi|83842838|gb|EAP82005.1| preprotein translocase, SecE subunit [Sulfitobacter sp. NAS-14.1] gi|83847337|gb|EAP85212.1| preprotein translocase, SecE subunit [Sulfitobacter sp. EE-36] Length = 65 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 39/59 (66%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + L F +QVR E K+ WP+R EV+++ ++V I+ ++++VFF ++D I + +IL Sbjct: 4 VNPLQFIQQVRSEVSKVVWPTRREVMLTTVMVFILAALTAVFFAIVDILIRGGLQYILA 62 >gi|91205974|ref|YP_538329.1| preprotein translocase subunit SecE [Rickettsia bellii RML369-C] gi|157826662|ref|YP_001495726.1| preprotein translocase subunit SecE [Rickettsia bellii OSU 85-389] gi|75448741|sp|Q8KTA9|SECE_RICBE RecName: Full=Preprotein translocase subunit secE gi|122425300|sp|Q1RHC4|SECE_RICBR RecName: Full=Preprotein translocase subunit secE gi|22087319|gb|AAM90928.1|AF502177_2 preprotein translocase SecE subunit [Rickettsia bellii] gi|91069518|gb|ABE05240.1| Preprotein translocase SecE subunit [Rickettsia bellii RML369-C] gi|157801966|gb|ABV78689.1| preprotein translocase subunit SecE [Rickettsia bellii OSU 85-389] Length = 66 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 21/64 (32%), Positives = 39/64 (60%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+ WP++ E+ S +VVI+ + + S+ LV+D I ++ +L Sbjct: 3 KEYKIYKFFEQVKQEAYKVVWPTKKELTASTLVVIVAVFVFSLICLVLDYGIHNIIQILL 62 Query: 64 GIGR 67 IG+ Sbjct: 63 NIGK 66 >gi|91977670|ref|YP_570329.1| preprotein translocase subunit SecE [Rhodopseudomonas palustris BisB5] gi|91684126|gb|ABE40428.1| protein translocase subunit secE/sec61 gamma [Rhodopseudomonas palustris BisB5] Length = 62 Score = 64.8 bits (157), Expect = 3e-09, Method: Composition-based stats. Identities = 25/59 (42%), Positives = 42/59 (71%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E+ K+ WPSR EV ++ I+V +M++++S+FF V DQ I L+ F+LG+ Sbjct: 4 SPFKFLQEVRSETAKVTWPSRREVTITTIMVFVMVALASIFFFVADQVIRVLITFVLGV 62 >gi|163745520|ref|ZP_02152880.1| preprotein translocase, SecE subunit, putative [Oceanibulbus indolifex HEL-45] gi|161382338|gb|EDQ06747.1| preprotein translocase, SecE subunit, putative [Oceanibulbus indolifex HEL-45] Length = 65 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 39/60 (65%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F +QVR E K+ WP++ EV+++ ++V I+ ++++VFF ++D I + ILG+ Sbjct: 4 TNPLQFIQQVRTEVAKVVWPTKREVMLTTVMVFILAALTAVFFAIVDILIRGGLQQILGM 63 >gi|89053050|ref|YP_508501.1| protein translocase subunit secE/sec61 gamma [Jannaschia sp. CCS1] gi|88862599|gb|ABD53476.1| protein translocase subunit secE/sec61 gamma [Jannaschia sp. CCS1] Length = 63 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 31/58 (53%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F +Q R E K+ WP+R EV+ + +V ++ ++++FF +D I + +L Sbjct: 2 TNPFQFLQQTRAEVAKVVWPTRKEVITTTAMVFLLALVAAIFFFGVDWLIRNALELLL 59 >gi|84515190|ref|ZP_01002553.1| preprotein translocase, SecE subunit [Loktanella vestfoldensis SKA53] gi|84511349|gb|EAQ07803.1| preprotein translocase, SecE subunit [Loktanella vestfoldensis SKA53] Length = 66 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 39/58 (67%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++VR E K+ WP+R EV+++ I+V I+ ++++VFF ++D I + + +LG Sbjct: 5 NPVKFIQEVRSEVAKVVWPTRREVVLTTIMVFILAALTAVFFSLVDFVIRFGLSGVLG 62 >gi|240850286|ref|YP_002971679.1| preprotein translocase subunit SecE [Bartonella grahamii as4aup] gi|240267409|gb|ACS50997.1| preprotein translocase subunit SecE [Bartonella grahamii as4aup] Length = 70 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 41/63 (65%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + F KQV E+ K+ WP+R E ++S ++V+++ +++S FF ++DQ + + + + Sbjct: 2 ASKTNPITFLKQVYAETIKVKWPTRRETVISTVMVLLVTALASAFFFIVDQVMHFGVWRV 61 Query: 63 LGI 65 + + Sbjct: 62 IDL 64 >gi|299135274|ref|ZP_07028465.1| preprotein translocase, SecE subunit [Afipia sp. 1NLS2] gi|298590251|gb|EFI50455.1| preprotein translocase, SecE subunit [Afipia sp. 1NLS2] Length = 63 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 42/59 (71%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E+ K+ WP+R E +++ I+V ++++++S+FF V DQ I L+ F+LGI Sbjct: 4 SPFKFLQEVRSETSKVVWPTRRETMITTIMVFVLVAVASIFFFVTDQVIRMLITFVLGI 62 >gi|241761256|ref|ZP_04759344.1| preprotein translocase, SecE subunit [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|260752789|ref|YP_003225682.1| preprotein translocase, SecE subunit [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|302858698|ref|YP_003848907.1| preprotein translocase subunit SecE [Zymomonas mobilis subsp. mobilis ZM4] gi|241374163|gb|EER63660.1| preprotein translocase, SecE subunit [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|258552152|gb|ACV75098.1| preprotein translocase, SecE subunit [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|301503261|gb|ADK75088.1| preprotein translocase, SecE subunit [Zymomonas mobilis subsp. mobilis ZM4] Length = 65 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 37/61 (60%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ FF+QVR E+ K+ WPSR E +++ ++V IM + VFF +D + ++ +L Sbjct: 3 KITPAEFFRQVRAETAKVVWPSRRETVMTAVMVAIMAILLGVFFFAVDAAFSHVVRLLLS 62 Query: 65 I 65 + Sbjct: 63 L 63 >gi|85710260|ref|ZP_01041325.1| preprotein translocase [Erythrobacter sp. NAP1] gi|85688970|gb|EAQ28974.1| preprotein translocase [Erythrobacter sp. NAP1] Length = 74 Score = 64.1 bits (155), Expect = 5e-09, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 36/65 (55%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + ++ F QVR E+ K+ WP+R E + + I V I + I S+FF +D L++F Sbjct: 10 KKTKTSIPEFVNQVRTETSKVVWPTREETIRTAIFVFIFMVILSLFFFGVDSLFNALVNF 69 Query: 62 ILGIG 66 +L + Sbjct: 70 LLTLA 74 >gi|116748978|ref|YP_845665.1| preprotein translocase subunit SecE [Syntrophobacter fumaroxidans MPOB] gi|116698042|gb|ABK17230.1| protein translocase subunit secE/sec61 gamma [Syntrophobacter fumaroxidans MPOB] Length = 115 Score = 64.1 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 35/55 (63%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + ++V E KK+ WPSR E + S VV++++++ VF ++DQ + L+ ++G Sbjct: 61 QYLREVVSELKKVVWPSRKETVGSTAVVLVIVAVCGVFLGIVDQVLSLLVRMLIG 115 >gi|319899062|ref|YP_004159155.1| preprotein translocase, SecE subunit [Bartonella clarridgeiae 73] gi|319403026|emb|CBI76581.1| preprotein translocase, SecE subunit [Bartonella clarridgeiae 73] Length = 70 Score = 64.1 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 43/57 (75%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 +R+ ++ F KQVR E+ K+ WP+R E +VS I+V+++ +++SVFF V+DQ++ + + Sbjct: 2 ASRINLITFLKQVRAETAKVKWPTRRETVVSTIIVLVLTALASVFFFVVDQAVNFGV 58 >gi|294012698|ref|YP_003546158.1| preprotein translocase subunit SecE [Sphingobium japonicum UT26S] gi|292676028|dbj|BAI97546.1| preprotein translocase subunit SecE [Sphingobium japonicum UT26S] Length = 71 Score = 64.1 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 38/65 (58%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + +++ F QV+ E+ KI WP+ E +++ ++V+IM S+ +FF ID G ++ + Sbjct: 3 AMAKVSPGEFVNQVKAEASKIVWPTGRETIMTGVMVVIMTSLLGIFFFGIDTFFGAIVQW 62 Query: 62 ILGIG 66 +L Sbjct: 63 LLAFA 67 >gi|119713238|gb|ABL97304.1| putative preprotein translocase SecE subunit [uncultured marine bacterium HF10_12C08] Length = 62 Score = 64.1 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 37/61 (60%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++VR E K+ WP+ E L I+V+++ + ++VFFL+IDQ + + ++G+ Sbjct: 1 MKPFKFIQEVRREGSKVTWPTSRETLTGSIMVVLITAFAAVFFLIIDQIFSFGLDKLIGV 60 Query: 66 G 66 Sbjct: 61 A 61 >gi|254294453|ref|YP_003060476.1| preprotein translocase, SecE subunit [Hirschia baltica ATCC 49814] gi|254042984|gb|ACT59779.1| preprotein translocase, SecE subunit [Hirschia baltica ATCC 49814] Length = 67 Score = 63.7 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 24/62 (38%), Positives = 37/62 (59%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R FF QVR E +K+ W SR E + + I+V+IM+ +S+FFL+ D + ++ I Sbjct: 6 KRTNPFTFFGQVRAEGRKVTWTSRQETVAATIMVLIMVVFASIFFLLTDWVVSAVVKLIT 65 Query: 64 GI 65 GI Sbjct: 66 GI 67 >gi|254436562|ref|ZP_05050056.1| preprotein translocase, SecE subunit [Octadecabacter antarcticus 307] gi|198252008|gb|EDY76322.1| preprotein translocase, SecE subunit [Octadecabacter antarcticus 307] Length = 64 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 38/59 (64%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R + F +QVR E K+ WPSR EV ++ I+V+IM ++ ++FF ++D I + + +L Sbjct: 3 RTNPVQFIQQVRAEVGKVVWPSRREVTLTTIMVLIMATVMALFFTLVDMFIRFGLEEVL 61 >gi|94497191|ref|ZP_01303763.1| SecE subunit of protein translocation complex [Sphingomonas sp. SKA58] gi|94423296|gb|EAT08325.1| SecE subunit of protein translocation complex [Sphingomonas sp. SKA58] Length = 68 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 38/62 (61%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +++ F QV+ E+ KI WP+ E +++ ++V+IM ++ +FF ID G ++ ++L Sbjct: 3 KVSPGEFVNQVKTEASKIVWPTGRETVMTGVMVVIMTTLLGLFFFGIDTFFGAIVQWLLS 62 Query: 65 IG 66 + Sbjct: 63 LA 64 >gi|260425488|ref|ZP_05779468.1| preprotein translocase, SecE subunit [Citreicella sp. SE45] gi|260423428|gb|EEX16678.1| preprotein translocase, SecE subunit [Citreicella sp. SE45] Length = 63 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 35/59 (59%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F +Q R E KI WP+R EV+++ + V IM ++++ FF ++D I + +L I Sbjct: 3 NPIQFIQQTRSEIGKIVWPTRREVILTTVTVFIMAALTATFFALVDILIRSGLQGLLSI 61 >gi|149186889|ref|ZP_01865198.1| preprotein translocase, SecE subunit [Erythrobacter sp. SD-21] gi|148829398|gb|EDL47840.1| preprotein translocase, SecE subunit [Erythrobacter sp. SD-21] Length = 77 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 37/65 (56%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 ++ + F +QV+ E +K+ WP+ E + I V IM+ I S+FFL +D G ++ + Sbjct: 13 RGSKPSPAEFIRQVQTEGRKVVWPTWPETVRISIFVFIMMIILSLFFLGVDSLFGAVVRW 72 Query: 62 ILGIG 66 +L + Sbjct: 73 LLTLA 77 >gi|49474313|ref|YP_032355.1| preprotein translocase subunit SecE [Bartonella quintana str. Toulouse] gi|49239817|emb|CAF26208.1| Preprotein translocase secE subunit [Bartonella quintana str. Toulouse] Length = 70 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 37/56 (66%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 ++ + F KQV E+ K+ WP+R E ++S +V+++ S+++ FF ++DQ + + + Sbjct: 3 SKTNPITFLKQVYAETIKVKWPTRRETVISTFMVLLVTSLAAAFFFIVDQIMHFSV 58 >gi|19110416|gb|AAL82791.1| translocase SecE [Rickettsia typhi] Length = 66 Score = 62.9 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+FWP+R E++ S +VV+ + I S+ LV+D SI +M +L Sbjct: 3 REYKIYKFFEQVKQETYKVFWPNRKELIASTLVVVAAVFIFSLICLVLDYSIHNIMQLLL 62 Query: 64 GIGR 67 IG+ Sbjct: 63 TIGK 66 >gi|77462245|ref|YP_351749.1| preprotein translocase subunit SecE [Rhodobacter sphaeroides 2.4.1] gi|126461107|ref|YP_001042221.1| preprotein translocase subunit SecE [Rhodobacter sphaeroides ATCC 17029] gi|126461121|ref|YP_001042235.1| preprotein translocase subunit SecE [Rhodobacter sphaeroides ATCC 17029] gi|221641200|ref|YP_002527462.1| preprotein translocase subunit SecE [Rhodobacter sphaeroides KD131] gi|77386663|gb|ABA77848.1| protein translocase subunit secE/sec61 gamma [Rhodobacter sphaeroides 2.4.1] gi|126102771|gb|ABN75449.1| preprotein translocase, SecE subunit [Rhodobacter sphaeroides ATCC 17029] gi|126102785|gb|ABN75463.1| protein translocase subunit secE/sec61 gamma [Rhodobacter sphaeroides ATCC 17029] gi|221161981|gb|ACM02961.1| Preprotein translocase, SecE subunit [Rhodobacter sphaeroides KD131] Length = 64 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 35/60 (58%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F QVR E K+ WP R EVL++ I+V +M ++++ FF ++D +I + +L Sbjct: 3 KANPFTFISQVRSEVGKVAWPGRREVLLTTIMVFVMAALTATFFSLVDFAIRQGLSLLLN 62 >gi|254500990|ref|ZP_05113141.1| preprotein translocase, SecE subunit [Labrenzia alexandrii DFL-11] gi|222437061|gb|EEE43740.1| preprotein translocase, SecE subunit [Labrenzia alexandrii DFL-11] Length = 53 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 23/51 (45%), Positives = 36/51 (70%) Query: 16 RDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 R E+ K+ WP+R E V+ ++V IM+ I+S+FFLV DQ + + +ILG+G Sbjct: 2 RSETSKVTWPTRKETAVTTVMVFIMVMIASIFFLVADQLMSLGIGYILGVG 52 >gi|307297142|ref|ZP_07576956.1| preprotein translocase, SecE subunit [Sphingobium chlorophenolicum L-1] gi|306877446|gb|EFN08676.1| preprotein translocase, SecE subunit [Sphingobium chlorophenolicum L-1] Length = 68 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 38/62 (61%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +++ F QV+ E+KKI WP+ E +++ ++V+IM S+ +FF ID G ++ ++L Sbjct: 3 KVSPGEFVNQVQTEAKKIVWPTGRETIMTGVMVVIMTSLLGLFFFGIDTFFGAIVQWLLA 62 Query: 65 IG 66 Sbjct: 63 FA 64 >gi|114764161|ref|ZP_01443399.1| preprotein translocase, SecE subunit [Pelagibaca bermudensis HTCC2601] gi|114543313|gb|EAU46329.1| preprotein translocase, SecE subunit [Roseovarius sp. HTCC2601] Length = 63 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +Q R E KI WP+R EVL++ + V IM ++++ FF ++D I + +L Sbjct: 3 NPIQFIQQTRAEVAKIVWPTRREVLLTTVTVFIMAALTASFFAIVDILIRSGLQGLLS 60 >gi|126724846|ref|ZP_01740689.1| preprotein translocase, SecE subunit [Rhodobacterales bacterium HTCC2150] gi|126706010|gb|EBA05100.1| preprotein translocase, SecE subunit [Rhodobacterales bacterium HTCC2150] Length = 65 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 37/59 (62%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F +QVR E KI WP++ EVL++ +V +M +++++FF +D I + +LG+ Sbjct: 5 NPLQFLQQVRAEVAKIVWPTQREVLLTTAMVFVMATLTAIFFFFVDLIIRTGLTSVLGM 63 >gi|146278582|ref|YP_001168741.1| preprotein translocase subunit SecE [Rhodobacter sphaeroides ATCC 17025] gi|145556823|gb|ABP71436.1| protein translocase subunit secE/sec61 gamma [Rhodobacter sphaeroides ATCC 17025] Length = 64 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 34/60 (56%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F QVR E K+ WP R EVL++ ++V +M ++++ FF ++D I + +L Sbjct: 3 KANPFTFISQVRSEVGKVVWPGRREVLLTTVMVFVMAALTATFFSLVDFVIRQGLSLLLN 62 >gi|121602263|ref|YP_988875.1| preprotein translocase subunit SecE [Bartonella bacilliformis KC583] gi|120614440|gb|ABM45041.1| preprotein translocase, SecE subunit [Bartonella bacilliformis KC583] Length = 67 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 36/54 (66%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + F KQVR E KI WP+R E ++S ++V+++ +++S FF ++DQ I + + Sbjct: 2 TNPIAFLKQVRAEITKIKWPTRRETVISTVMVLVVTAVASAFFFIVDQVINFSV 55 >gi|209884792|ref|YP_002288649.1| preprotein translocase, SecE subunit [Oligotropha carboxidovorans OM5] gi|209872988|gb|ACI92784.1| preprotein translocase, SecE subunit [Oligotropha carboxidovorans OM5] Length = 63 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 41/59 (69%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + L F ++V E+ K+ WP+R E L++ ++V +++ ++++FF V DQ I L+ F+LGI Sbjct: 4 SPLKFLQEVNSETSKVIWPTRRETLITTVMVFVLVIVAALFFFVTDQVIRMLITFVLGI 62 >gi|315122751|ref|YP_004063240.1| hypothetical protein CKC_05015 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496153|gb|ADR52752.1| hypothetical protein CKC_05015 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 67 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 47/66 (71%), Positives = 57/66 (86%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M VN L+++NFFKQV+ E K+IFWPSR+EVL+SV+VVIIMLSISS+F L IDQ IGW MH Sbjct: 1 MRVNGLSIVNFFKQVKVEFKRIFWPSRNEVLISVVVVIIMLSISSMFLLAIDQLIGWFMH 60 Query: 61 FILGIG 66 F+L IG Sbjct: 61 FLLNIG 66 >gi|51473333|ref|YP_067090.1| preprotein translocase subunit SecE [Rickettsia typhi str. Wilmington] gi|81610831|sp|Q68XN4|SECE_RICTY RecName: Full=Preprotein translocase subunit secE gi|51459645|gb|AAU03608.1| preprotein translocase SecE subunit [Rickettsia typhi str. Wilmington] Length = 66 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+FWP+R E++ S +VV+ + I S+ LV+D SI +M +L Sbjct: 3 REYKMYKFFEQVKQETYKVFWPNRKELIASTLVVVAAVFIFSLICLVLDYSIHNIMQLLL 62 Query: 64 GIGR 67 IG+ Sbjct: 63 TIGK 66 >gi|49475392|ref|YP_033433.1| preprotein translocase subunit SecE [Bartonella henselae str. Houston-1] gi|49238198|emb|CAF27408.1| Preprotein translocase secE subunit [Bartonella henselae str. Houston-1] Length = 70 Score = 61.8 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 37/56 (66%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 ++ + F KQV E+ K+ WP+R E ++S +V+++ S++S FF ++DQ + + + Sbjct: 3 SKTNPITFLKQVYAETVKVKWPTRRETVISTFMVLLVTSLASAFFFIVDQVMHFSV 58 >gi|15604010|ref|NP_220525.1| preprotein translocase subunit SecE [Rickettsia prowazekii str. Madrid E] gi|1711361|sp|P50054|SECE_RICPR RecName: Full=Preprotein translocase subunit secE gi|987967|emb|CAA90885.1| SecE protein [Rickettsia prowazekii] gi|3860701|emb|CAA14602.1| unknown (secE) [Rickettsia prowazekii] gi|292571728|gb|ADE29643.1| Preprotein translocase SecE subunit [Rickettsia prowazekii Rp22] Length = 66 Score = 61.4 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 41/64 (64%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+QV+ E+ K+FWP++ E++ S +VV+ + I S+ LV+D SI +M +L Sbjct: 3 REYKIYKFFEQVKQETYKVFWPNKKELIASTLVVVATVFIFSLICLVLDYSIHNIMQLLL 62 Query: 64 GIGR 67 IG+ Sbjct: 63 TIGK 66 >gi|218779774|ref|YP_002431092.1| preprotein translocase, SecE subunit [Desulfatibacillum alkenivorans AK-01] gi|218761158|gb|ACL03624.1| preprotein translocase, SecE subunit [Desulfatibacillum alkenivorans AK-01] Length = 112 Score = 61.4 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 37/59 (62%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++VR E KK+ WPSR + + S VVII++++ S+F ++D + ++ ++G Sbjct: 54 TNSVQFLREVRGELKKVTWPSRKQTVGSTAVVIILVAVISMFLGLVDMGLTEIVRLVIG 112 >gi|83312246|ref|YP_422510.1| preprotein translocase subunit SecE [Magnetospirillum magneticum AMB-1] gi|82947087|dbj|BAE51951.1| Preprotein translocase subunit SecE [Magnetospirillum magneticum AMB-1] Length = 65 Score = 61.4 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 26/62 (41%), Positives = 40/62 (64%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + FFKQVR E K+ WP+R E VS +V++M+ I++VFFLV+DQ + + G Sbjct: 3 KTSPALFFKQVRQEVAKVTWPTRRETTVSTGMVVVMVVIAAVFFLVVDQIFAASVKLLFG 62 Query: 65 IG 66 +G Sbjct: 63 LG 64 >gi|71083816|ref|YP_266536.1| protein secE/sec61-gamma protein [Candidatus Pelagibacter ubique HTCC1062] gi|91763148|ref|ZP_01265112.1| Protein secE/sec61-gamma protein [Candidatus Pelagibacter ubique HTCC1002] gi|71062929|gb|AAZ21932.1| Protein secE/sec61-gamma protein [Candidatus Pelagibacter ubique HTCC1062] gi|91717561|gb|EAS84212.1| Protein secE/sec61-gamma protein [Candidatus Pelagibacter ubique HTCC1002] Length = 63 Score = 61.4 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 36/59 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F ++V+ E+ K+ WP+ E + ++V M I S+FFL++DQ + +L+ +L + Sbjct: 3 NPIKFIQEVKQEAFKVSWPTGKETMQGALMVFAMAVIMSLFFLLLDQVLKFLLEALLKV 61 >gi|262201103|ref|YP_003272311.1| preprotein translocase subunit SecE [Gordonia bronchialis DSM 43247] gi|262084450|gb|ACY20418.1| preprotein translocase, SecE subunit [Gordonia bronchialis DSM 43247] Length = 158 Score = 60.6 bits (146), Expect = 6e-08, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 31/59 (52%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F QV E KK+ WP+R E++ IVV++ + + + F ID + + ++ G Sbjct: 100 TRIWVFLTQVVAELKKVIWPTRREMITYTIVVLVFVIVMTAFISGIDLAFAKGVLWLFG 158 >gi|312141017|ref|YP_004008353.1| preprotein translocase sece [Rhodococcus equi 103S] gi|325675346|ref|ZP_08155030.1| preprotein translocase SecE subunit [Rhodococcus equi ATCC 33707] gi|311890356|emb|CBH49674.1| putative preprotein translocase SecE [Rhodococcus equi 103S] gi|325553317|gb|EGD22995.1| preprotein translocase SecE subunit [Rhodococcus equi ATCC 33707] Length = 162 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 31/57 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++V E +K+ WP+R +++ VV++ ++ F ++D G + ++ G Sbjct: 106 IRRFLREVVAELRKVIWPNRKQMITYTSVVLVFVAFMVTFISLLDIGFGKGISWLFG 162 >gi|157825314|ref|YP_001493034.1| preprotein translocase subunit SecE [Rickettsia akari str. Hartford] gi|157799272|gb|ABV74526.1| preprotein translocase subunit SecE [Rickettsia akari str. Hartford] Length = 68 Score = 60.6 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 21/64 (32%), Positives = 37/64 (57%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + +QV+ E K+ WP++ E++ S +VV+ + I S+ LV+D SI +M +L Sbjct: 3 KEYKIYKLCEQVKQEIYKVVWPTKKELVASTLVVVAAVFIFSLICLVLDYSIHNIMQLLL 62 Query: 64 GIGR 67 IG+ Sbjct: 63 NIGK 66 >gi|170750244|ref|YP_001756504.1| preprotein translocase, SecE subunit [Methylobacterium radiotolerans JCM 2831] gi|170656766|gb|ACB25821.1| preprotein translocase, SecE subunit [Methylobacterium radiotolerans JCM 2831] Length = 98 Score = 60.2 bits (145), Expect = 8e-08, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 43/62 (69%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R FF QVRDE++K+ WP+R E ++ I+V +M+ +S+FF V+DQ++ +++ IL Sbjct: 37 KRATPGEFFAQVRDEARKVTWPTRRETTITTIMVFVMVVAASLFFTVVDQALRFVVGLIL 96 Query: 64 GI 65 G+ Sbjct: 97 GV 98 >gi|148256409|ref|YP_001240994.1| protein translocase subunit secE/sec61 gamma [Bradyrhizobium sp. BTAi1] gi|146408582|gb|ABQ37088.1| protein translocase subunit secE/sec61 gamma [Bradyrhizobium sp. BTAi1] Length = 52 Score = 60.2 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 22/50 (44%), Positives = 36/50 (72%) Query: 16 RDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 R E+ K+ WPSR EV ++ I+V +M++++S+FF DQ I +L+ +LGI Sbjct: 2 RSETAKVTWPSRREVTITTIMVFVMVALASIFFFAADQIIRYLITLVLGI 51 >gi|84499878|ref|ZP_00998144.1| preprotein translocase, SecE subunit [Oceanicola batsensis HTCC2597] gi|84391812|gb|EAQ04080.1| preprotein translocase, SecE subunit [Oceanicola batsensis HTCC2597] Length = 63 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 20/50 (40%), Positives = 32/50 (64%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIG 56 + F Q R E KI WP+R EVL++ ++V IM ++++VFF ++D I Sbjct: 3 NPIQFINQTRAEISKITWPTRREVLLTTVMVFIMAALTAVFFALVDLLIR 52 >gi|146340038|ref|YP_001205086.1| putative preprotein translocase secE subunit [Bradyrhizobium sp. ORS278] gi|146192844|emb|CAL76849.1| putative preprotein translocase secE subunit [Bradyrhizobium sp. ORS278] Length = 52 Score = 59.4 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 23/50 (46%), Positives = 36/50 (72%) Query: 16 RDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 R E+ K+ WPSR EV ++ I+V +M++++SVFF DQ I +L+ +LGI Sbjct: 2 RSETAKVSWPSRREVTITTIMVFVMVALASVFFFAADQIIRYLITLVLGI 51 >gi|218886544|ref|YP_002435865.1| preprotein translocase subunit SecE [Desulfovibrio vulgaris str. 'Miyazaki F'] gi|218757498|gb|ACL08397.1| preprotein translocase, SecE subunit [Desulfovibrio vulgaris str. 'Miyazaki F'] Length = 83 Score = 59.4 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 38/64 (59%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 +G + ++F++ + E +K+ WP+R E + I V++++ + S+F V+D + L+ Sbjct: 20 IGDKITQLRDYFEEAKGELRKVTWPTRKETTATGIAVLVLVFVMSLFLGVVDLGLTKLVE 79 Query: 61 FILG 64 +IL Sbjct: 80 YILS 83 >gi|294675842|ref|YP_003576457.1| preprotein translocase subunit SecE [Rhodobacter capsulatus SB 1003] gi|294474662|gb|ADE84050.1| preprotein translocase, SecE subunit [Rhodobacter capsulatus SB 1003] Length = 60 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 34/57 (59%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F QVR E KI WP+R EV+++ ++V+ M ++++FF ++D I + + Sbjct: 3 NPIQFLSQVRSEVGKITWPTRREVVLTTVMVLTMAMVAAIFFSLVDWVINLGIKAMF 59 >gi|317057219|ref|YP_004105686.1| preprotein translocase subunit SecE [Ruminococcus albus 7] gi|315449488|gb|ADU23052.1| preprotein translocase, SecE subunit [Ruminococcus albus 7] Length = 84 Score = 59.1 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 41/63 (65%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ + +FK++R E KK+ WP+R +V+ + VV++++S+ +F +D + + + ++ Sbjct: 20 SKGGLKKYFKELRAELKKVVWPTRQQVVNNTGVVLVVMSVVGLFLFAVDTGLSYAIKQLI 79 Query: 64 GIG 66 G+G Sbjct: 80 GLG 82 >gi|288957407|ref|YP_003447748.1| hypothetical protein AZL_005660 [Azospirillum sp. B510] gi|288909715|dbj|BAI71204.1| hypothetical protein AZL_005660 [Azospirillum sp. B510] Length = 65 Score = 58.7 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 40/62 (64%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ F ++VR E ++ WP+R E ++ +V +M+ ++++FFLV+DQ + + ILG Sbjct: 3 KVNPAEFAREVRREVARVTWPTRKETGITTAMVFVMVVVAALFFLVVDQVLAVAVRLILG 62 Query: 65 IG 66 +G Sbjct: 63 LG 64 >gi|260893764|ref|YP_003239861.1| preprotein translocase, SecE subunit [Ammonifex degensii KC4] gi|260865905|gb|ACX53011.1| preprotein translocase, SecE subunit [Ammonifex degensii KC4] Length = 129 Score = 58.7 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 31/65 (47%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + + F V E KK+ WP+R EVL+ VV+ + + ++ + D ++ Sbjct: 65 LQASITKTREFLLSVWQELKKVHWPTRREVLIYTGVVLAAVGLVTLIIWLADSIFSQILR 124 Query: 61 FILGI 65 FIL + Sbjct: 125 FILKV 129 >gi|27380528|ref|NP_772057.1| preprotein translocase subunit SecE [Bradyrhizobium japonicum USDA 110] gi|27353692|dbj|BAC50682.1| preprotein translocase [Bradyrhizobium japonicum USDA 110] Length = 63 Score = 58.7 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 42/60 (70%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ F ++VR E+ K+ WP+R E ++ I+V +M++++S+FF DQ I +L+ F+LGI Sbjct: 3 VSPFKFLQEVRSETAKVTWPTRRETTITTIMVFVMVAVASIFFFAADQIIRYLITFLLGI 62 >gi|114798990|ref|YP_760700.1| preprotein translocase, SecE subunit [Hyphomonas neptunium ATCC 15444] gi|114739164|gb|ABI77289.1| preprotein translocase, SecE subunit [Hyphomonas neptunium ATCC 15444] Length = 72 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 34/63 (53%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 R+ + F +QVR E K+ W SR E + + I V+IM + ++F + D I ++F Sbjct: 9 KKKRIGPVTFLRQVRAEGNKVTWTSRQETIQATIFVLIMSFLIAIFLFLTDTVITIFVNF 68 Query: 62 ILG 64 + G Sbjct: 69 VRG 71 >gi|158520713|ref|YP_001528583.1| preprotein translocase, SecE subunit [Desulfococcus oleovorans Hxd3] gi|158509539|gb|ABW66506.1| preprotein translocase, SecE subunit [Desulfococcus oleovorans Hxd3] Length = 130 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 35/56 (62%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++V+ E KK+ WP+R + + S VV++++ I SVF + D +G L+ IL Sbjct: 75 VQFLREVKVELKKVTWPTRQQTIGSTAVVLLLVMIISVFLGLADLVLGRLIQVILN 130 >gi|99080067|ref|YP_612221.1| preprotein translocase subunit SecE [Ruegeria sp. TM1040] gi|99036347|gb|ABF62959.1| protein translocase subunit secE/sec61 gamma [Ruegeria sp. TM1040] Length = 65 Score = 58.3 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 40/60 (66%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + + F +QVR E K+ WP+R EVL++ ++V IM ++++ FF V+D I ++ +LG+ Sbjct: 4 INPVKFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALAAAFFAVVDLLIRTGLNGVLGL 63 >gi|283851490|ref|ZP_06368770.1| preprotein translocase, SecE subunit [Desulfovibrio sp. FW1012B] gi|283573024|gb|EFC21004.1| preprotein translocase, SecE subunit [Desulfovibrio sp. FW1012B] Length = 103 Score = 57.9 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 34/55 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+Q + E KK+ WP+R E + + I V++ + +++ V+D ++ L+ FIL Sbjct: 49 EFFEQSKVELKKVTWPTRQETVKTGIAVLVFSVVMAIYLGVVDMALSRLVAFILS 103 >gi|161831611|ref|YP_001596169.1| preprotein translocase, SecE subunit [Coxiella burnetii RSA 331] gi|161763478|gb|ABX79120.1| preprotein translocase, SecE subunit [Coxiella burnetii RSA 331] Length = 127 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 32/54 (59%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F K R E +K+ WP+R E L + +VVI+M+ I+++ +D W + ++ G Sbjct: 71 FIKNARAELRKVVWPTRQETLRTTLVVIVMVVITALILWGLDSFFMWAIGWMAG 124 >gi|259416653|ref|ZP_05740573.1| preprotein translocase, SecE subunit [Silicibacter sp. TrichCH4B] gi|259348092|gb|EEW59869.1| preprotein translocase, SecE subunit [Silicibacter sp. TrichCH4B] Length = 65 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 38/60 (63%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + + F +QVR E K+ WP+R EVL++ ++V IM ++++ FF V+D I + I GI Sbjct: 4 INPVKFIQQVRAEVSKVVWPTRREVLLTTVMVFIMAALAAAFFAVVDLLIRTGLSGIYGI 63 >gi|303247803|ref|ZP_07334072.1| preprotein translocase, SecE subunit [Desulfovibrio fructosovorans JJ] gi|302490887|gb|EFL50786.1| preprotein translocase, SecE subunit [Desulfovibrio fructosovorans JJ] Length = 100 Score = 57.5 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 34/55 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+Q + E KK+ WP+R E + + + V++ I +++ V+D ++ L+ FIL Sbjct: 46 EFFEQSKVELKKVTWPTRQETIKTGVAVLVFSVIMAIYLGVVDMALSRLVAFILS 100 >gi|109896920|ref|YP_660175.1| preprotein translocase, SecE subunit [Pseudoalteromonas atlantica T6c] gi|109699201|gb|ABG39121.1| protein translocase subunit secE/sec61 gamma [Pseudoalteromonas atlantica T6c] gi|332172373|gb|AEE21627.1| preprotein translocase, SecE subunit [Glaciecola agarilytica 4H-3-7+YE-5] Length = 125 Score = 57.5 bits (138), Expect = 5e-07, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 33/63 (52%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + L F K R E +K+ WP+R E + I+V++ + S+ +D I L+ FI Sbjct: 62 KGSSFLTFAKDARTEVRKVVWPTRQEATQTTIIVLVATAFMSLVLWGLDLIIVQLVSFIT 121 Query: 64 GIG 66 G+G Sbjct: 122 GLG 124 >gi|225017231|ref|ZP_03706423.1| hypothetical protein CLOSTMETH_01157 [Clostridium methylpentosum DSM 5476] gi|224950006|gb|EEG31215.1| hypothetical protein CLOSTMETH_01157 [Clostridium methylpentosum DSM 5476] Length = 77 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 41/57 (71%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + N+FK +R E+KK+ WP++S+++ + I+V++ + + +F ++D +G L++F+L Sbjct: 19 IANYFKDLRSETKKVVWPTKSQIINNTIIVLVTIIVLGIFIALLDFGLGALVNFLLN 75 >gi|270265418|ref|ZP_06193677.1| preprotein translocase subunit SecE [Serratia odorifera 4Rx13] gi|270040611|gb|EFA13716.1| preprotein translocase subunit SecE [Serratia odorifera 4Rx13] Length = 132 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 66 MTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 125 Query: 61 FILGI 65 FI G+ Sbjct: 126 FITGL 130 >gi|86606431|ref|YP_475194.1| preprotein translocase subunit SecE [Synechococcus sp. JA-3-3Ab] gi|86554973|gb|ABC99931.1| preprotein translocase, SecE subunit [Synechococcus sp. JA-3-3Ab] Length = 88 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 31/58 (53%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++ R E KI WPSR +++ + V++++ + F ++DQ GWL + Sbjct: 31 GIPGFLQETRAELAKIVWPSRQQLISESVGVLLIVLAFASFIYLVDQLFGWLATQLFS 88 >gi|293394016|ref|ZP_06638320.1| preprotein translocase [Serratia odorifera DSM 4582] gi|291423456|gb|EFE96681.1| preprotein translocase [Serratia odorifera DSM 4582] Length = 127 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 MTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|78358030|ref|YP_389479.1| preprotein translocase subunit SecE [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] gi|78220435|gb|ABB39784.1| protein translocase subunit secE/sec61 gamma [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] Length = 83 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 35/64 (54%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 +G F ++ + E +K+ WPSR E + I V++++ + S+F ++D + ++ Sbjct: 20 VGSKLTQFKEFLEESKVEIRKVTWPSRKETTATSIAVLVLVFVMSLFLGIVDLGLTRIVE 79 Query: 61 FILG 64 FIL Sbjct: 80 FILS 83 >gi|29653576|ref|NP_819268.1| protein translocase subunit [Coxiella burnetii RSA 493] gi|153208138|ref|ZP_01946566.1| preprotein translocase, SecE subunit [Coxiella burnetii 'MSU Goat Q177'] gi|154706284|ref|YP_001425196.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111] gi|165918639|ref|ZP_02218725.1| preprotein translocase, SecE subunit [Coxiella burnetii RSA 334] gi|212213264|ref|YP_002304200.1| protein translocase subunit [Coxiella burnetii CbuG_Q212] gi|212218058|ref|YP_002304845.1| protein translocase subunit [Coxiella burnetii CbuK_Q154] gi|29540838|gb|AAO89782.1| protein translocase subunit [Coxiella burnetii RSA 493] gi|120576151|gb|EAX32775.1| preprotein translocase, SecE subunit [Coxiella burnetii 'MSU Goat Q177'] gi|154355570|gb|ABS77032.1| protein translocase subunit [Coxiella burnetii Dugway 5J108-111] gi|165917667|gb|EDR36271.1| preprotein translocase, SecE subunit [Coxiella burnetii RSA 334] gi|212011674|gb|ACJ19055.1| protein translocase subunit [Coxiella burnetii CbuG_Q212] gi|212012320|gb|ACJ19700.1| protein translocase subunit [Coxiella burnetii CbuK_Q154] Length = 127 Score = 57.5 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 32/54 (59%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F K R E +K+ WP+R E L + +VVI+M+ I+++ +D W + ++ G Sbjct: 71 FIKNARTELRKVVWPTRQETLQTTLVVIVMVVITALILWGLDSFFMWAIGWMAG 124 >gi|188532308|ref|YP_001906105.1| preprotein translocase subunit SecE [Erwinia tasmaniensis Et1/99] gi|188027350|emb|CAO95195.1| Preprotein translocase, secE subunit [Erwinia tasmaniensis Et1/99] Length = 127 Score = 57.5 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 35/63 (55%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 63 VKGKATLAFAREARTEVRKVVWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGL 125 >gi|220909379|ref|YP_002484690.1| preprotein translocase subunit SecE [Cyanothece sp. PCC 7425] gi|219865990|gb|ACL46329.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 7425] Length = 83 Score = 57.1 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 30/57 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF++ ++E K+ WP R ++ + V++M+++S+ ++DQ W I Sbjct: 27 NPAQFFQETKEELDKVVWPDRQRLIGESVAVVLMVALSATTIYLVDQLFSWAASLIF 83 >gi|308047967|ref|YP_003911533.1| protein translocase subunit secE/sec61 gamma [Ferrimonas balearica DSM 9799] gi|307630157|gb|ADN74459.1| protein translocase subunit secE/sec61 gamma [Ferrimonas balearica DSM 9799] Length = 123 Score = 57.1 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 33/62 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A F ++ R+E +K+ WP+R E + + ++V + + ++D + W+++ I Sbjct: 62 KGKAAWAFAQESRNEVRKVVWPTRQETVQTTLIVFAATAFMAFCLWLLDMGLVWIVNLIT 121 Query: 64 GI 65 G+ Sbjct: 122 GV 123 >gi|312882840|ref|ZP_07742573.1| preprotein translocase subunit SecE [Vibrio caribbenthicus ATCC BAA-2122] gi|309369532|gb|EFP97051.1| preprotein translocase subunit SecE [Vibrio caribbenthicus ATCC BAA-2122] Length = 141 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 35/62 (56%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A + F K+ R E +K+ WP+R E + + ++V+ + + ++ ID + +++F+ Sbjct: 80 KGKAAIEFAKESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALILYGIDSIMYHIVNFVT 139 Query: 64 GI 65 G+ Sbjct: 140 GV 141 >gi|51594632|ref|YP_068823.1| preprotein translocase subunit SecE [Yersinia pseudotuberculosis IP 32953] gi|108809616|ref|YP_653532.1| preprotein translocase subunit SecE [Yersinia pestis Antiqua] gi|108810379|ref|YP_646146.1| preprotein translocase subunit SecE [Yersinia pestis Nepal516] gi|145600994|ref|YP_001165070.1| preprotein translocase subunit SecE [Yersinia pestis Pestoides F] gi|153947517|ref|YP_001402817.1| preprotein translocase subunit SecE [Yersinia pseudotuberculosis IP 31758] gi|153997213|ref|ZP_02022320.1| preprotein translocase SecE subunit [Yersinia pestis CA88-4125] gi|161484891|ref|NP_667816.2| preprotein translocase subunit SecE [Yersinia pestis KIM 10] gi|161511332|ref|NP_994409.2| preprotein translocase subunit SecE [Yersinia pestis biovar Microtus str. 91001] gi|162419346|ref|YP_001607190.1| preprotein translocase subunit SecE [Yersinia pestis Angola] gi|165928319|ref|ZP_02224151.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Orientalis str. F1991016] gi|165938231|ref|ZP_02226790.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Orientalis str. IP275] gi|166012041|ref|ZP_02232939.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Antiqua str. E1979001] gi|166214395|ref|ZP_02240430.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Antiqua str. B42003004] gi|167402426|ref|ZP_02307886.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167422948|ref|ZP_02314701.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167426803|ref|ZP_02318556.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Mediaevalis str. K1973002] gi|170022591|ref|YP_001719096.1| preprotein translocase subunit SecE [Yersinia pseudotuberculosis YPIII] gi|186893633|ref|YP_001870745.1| preprotein translocase subunit SecE [Yersinia pseudotuberculosis PB1/+] gi|218930758|ref|YP_002348633.1| preprotein translocase subunit SecE [Yersinia pestis CO92] gi|229837499|ref|ZP_04457661.1| preprotein translocase membrane subunit [Yersinia pestis Pestoides A] gi|229839435|ref|ZP_04459594.1| preprotein translocase membrane subunit [Yersinia pestis biovar Orientalis str. PEXU2] gi|229900554|ref|ZP_04515680.1| preprotein translocase membrane subunit [Yersinia pestis Nepal516] gi|270488910|ref|ZP_06205984.1| preprotein translocase, SecE subunit [Yersinia pestis KIM D27] gi|294505421|ref|YP_003569483.1| translocase [Yersinia pestis Z176003] gi|51587914|emb|CAH19517.1| preprotein translocase SecE subunit [Yersinia pseudotuberculosis IP 32953] gi|108774027|gb|ABG16546.1| protein translocase subunit secE/sec61 gamma [Yersinia pestis Nepal516] gi|108781529|gb|ABG15587.1| protein translocase subunit secE/sec61 gamma [Yersinia pestis Antiqua] gi|115349369|emb|CAL22340.1| preprotein translocase SecE subunit [Yersinia pestis CO92] gi|145212690|gb|ABP42097.1| protein translocase subunit secE/sec61 gamma [Yersinia pestis Pestoides F] gi|149289321|gb|EDM39400.1| preprotein translocase SecE subunit [Yersinia pestis CA88-4125] gi|152959012|gb|ABS46473.1| preprotein translocase, SecE subunit [Yersinia pseudotuberculosis IP 31758] gi|162352161|gb|ABX86109.1| preprotein translocase, SecE subunit [Yersinia pestis Angola] gi|165913892|gb|EDR32510.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Orientalis str. IP275] gi|165919658|gb|EDR36991.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Orientalis str. F1991016] gi|165989036|gb|EDR41337.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Antiqua str. E1979001] gi|166204399|gb|EDR48879.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Antiqua str. B42003004] gi|166957159|gb|EDR55180.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167048206|gb|EDR59614.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167054185|gb|EDR64010.1| preprotein translocase, SecE subunit [Yersinia pestis biovar Mediaevalis str. K1973002] gi|169749125|gb|ACA66643.1| preprotein translocase, SecE subunit [Yersinia pseudotuberculosis YPIII] gi|186696659|gb|ACC87288.1| preprotein translocase, SecE subunit [Yersinia pseudotuberculosis PB1/+] gi|229682374|gb|EEO78464.1| preprotein translocase membrane subunit [Yersinia pestis Nepal516] gi|229695801|gb|EEO85848.1| preprotein translocase membrane subunit [Yersinia pestis biovar Orientalis str. PEXU2] gi|229704187|gb|EEO91198.1| preprotein translocase membrane subunit [Yersinia pestis Pestoides A] gi|262367415|gb|ACY63972.1| translocase [Yersinia pestis D182038] gi|270337414|gb|EFA48191.1| preprotein translocase, SecE subunit [Yersinia pestis KIM D27] gi|294355880|gb|ADE66221.1| translocase [Yersinia pestis Z176003] gi|320013651|gb|ADV97222.1| preprotein translocase membrane subunit [Yersinia pestis biovar Medievalis str. Harbin 35] Length = 127 Score = 57.1 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 MTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|283476716|emb|CAY72545.1| secE [Erwinia pyrifoliae DSM 12163] gi|310766068|gb|ADP11018.1| hypothetical protein EJP617_13370 [Erwinia sp. Ejp617] Length = 127 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 35/63 (55%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 63 VKGKATLAFAREARTEVRKVVWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGL 125 >gi|157368520|ref|YP_001476509.1| preprotein translocase subunit SecE [Serratia proteamaculans 568] gi|157320284|gb|ABV39381.1| preprotein translocase, SecE subunit [Serratia proteamaculans 568] Length = 127 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 MTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|239907758|ref|YP_002954499.1| preprotein translocase SecE subunit [Desulfovibrio magneticus RS-1] gi|239797624|dbj|BAH76613.1| preprotein translocase SecE subunit [Desulfovibrio magneticus RS-1] Length = 99 Score = 56.7 bits (136), Expect = 9e-07, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 33/55 (60%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+Q + E +K+ WP+R E + + I V++ + +++ V+D ++ L+ IL Sbjct: 45 EFFEQAKGELRKVTWPTREETVKTGIAVLVFSVVMAIYLGVVDMALSRLVALILS 99 >gi|117924142|ref|YP_864759.1| protein translocase subunit secE/sec61 gamma [Magnetococcus sp. MC-1] gi|117607898|gb|ABK43353.1| protein translocase subunit secE/sec61 gamma [Magnetococcus sp. MC-1] Length = 63 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + VR E +K+ WPSR E + + IVV M+ S+F ++D + + I+G Sbjct: 10 YLGDVRSEMRKVVWPSRKETMQTTIVVFGMVVAVSLFLWLVDAILSSTVQAIIG 63 >gi|257438469|ref|ZP_05614224.1| preprotein translocase, SecE subunit [Faecalibacterium prausnitzii A2-165] gi|257199048|gb|EEU97332.1| preprotein translocase, SecE subunit [Faecalibacterium prausnitzii A2-165] Length = 79 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 38/64 (59%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M + FF+ + E KK+ WPS+++V + IVV++ ++I++V + +D G ++ Sbjct: 15 MKGFGANIAKFFRDTKSELKKVVWPSKADVKTNTIVVLVTVAIAAVVMIALDAIFGGILG 74 Query: 61 FILG 64 I+G Sbjct: 75 LIIG 78 >gi|114778897|ref|ZP_01453694.1| hypothetical protein SPV1_12145 [Mariprofundus ferrooxydans PV-1] gi|114550866|gb|EAU53432.1| hypothetical protein SPV1_12145 [Mariprofundus ferrooxydans PV-1] Length = 62 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 34/54 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F +V+ E+KK+ WP R E L S ++V +M+ ++F ++D S+ WL+ ++ Sbjct: 9 KFMSEVKVEAKKVTWPERRETLQSTLMVFVMVIFIALFLWLVDSSLSWLVRQVI 62 >gi|320120547|gb|ADW16182.1| hypothetical protein HMPREF0389_01737 [Filifactor alocis ATCC 35896] Length = 69 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 35/60 (58%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + +F +V+ E KK+ WPS+ E+ VIIM+ ++++F ID +G ++ ++ Sbjct: 8 TKTSPTEYFGEVKTELKKVHWPSKQELSEHTFTVIIMVLVTALFIFCIDAGVGAVIEKLI 67 >gi|292486721|ref|YP_003529591.1| preprotein translocase subunit SecE [Erwinia amylovora CFBP1430] gi|292897954|ref|YP_003537323.1| preprotein translocase SecE subunit [Erwinia amylovora ATCC 49946] gi|291197802|emb|CBJ44897.1| preprotein translocase SecE subunit [Erwinia amylovora ATCC 49946] gi|291552138|emb|CBA19175.1| Preprotein translocase subunit secE [Erwinia amylovora CFBP1430] gi|312170786|emb|CBX79047.1| Preprotein translocase subunit secE [Erwinia amylovora ATCC BAA-2158] Length = 127 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 35/63 (55%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 63 VKGKATLAFAREARTEVRKVVWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGL 125 >gi|256752773|ref|ZP_05493618.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus CCSD1] gi|307725167|ref|YP_003904918.1| preprotein translocase subunit SecE [Thermoanaerobacter sp. X513] gi|256748334|gb|EEU61393.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus CCSD1] gi|307582228|gb|ADN55627.1| preprotein translocase, SecE subunit [Thermoanaerobacter sp. X513] Length = 65 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 38/65 (58%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M ++ FFK +R E KK+ WPSR V+ +V+I++++ +VF +ID +L+ Sbjct: 1 MAGEGRKIVKFFKDIRAEMKKVTWPSRKTVITYTEIVLIVMALLTVFIFLIDSIFSYLLK 60 Query: 61 FILGI 65 I+ + Sbjct: 61 LIIKV 65 >gi|224370703|ref|YP_002604867.1| SecE [Desulfobacterium autotrophicum HRM2] gi|223693420|gb|ACN16703.1| SecE [Desulfobacterium autotrophicum HRM2] Length = 113 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 35/56 (62%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FF++VR E KK+ WP++ + S +VVII++ I + F ++D + L+ +L Sbjct: 58 VRFFREVRVELKKVTWPNQKQTAGSTVVVIILVFILAAFLGLVDFGLSKLVQVVLA 113 >gi|21957174|gb|AAM84067.1|AE013648_9 preprotein translocase [Yersinia pestis KIM 10] gi|45437736|gb|AAS63286.1| preprotein translocase SecE subunit [Yersinia pestis biovar Microtus str. 91001] Length = 132 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 66 MTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 125 Query: 61 FILGI 65 FI G+ Sbjct: 126 FITGL 130 >gi|259906923|ref|YP_002647279.1| preprotein translocase subunit SecE [Erwinia pyrifoliae Ep1/96] gi|224962545|emb|CAX54000.1| Preprotein translocase SecE subunit [Erwinia pyrifoliae Ep1/96] Length = 132 Score = 56.4 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 35/63 (55%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 68 VKGKATLAFAREARTEVRKVVWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFI 127 Query: 63 LGI 65 G+ Sbjct: 128 TGL 130 >gi|307267206|ref|ZP_07548712.1| preprotein translocase, SecE subunit [Thermoanaerobacter wiegelii Rt8.B1] gi|326390675|ref|ZP_08212230.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus JW 200] gi|306917785|gb|EFN48053.1| preprotein translocase, SecE subunit [Thermoanaerobacter wiegelii Rt8.B1] gi|325993353|gb|EGD51790.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus JW 200] Length = 65 Score = 56.4 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 38/65 (58%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M ++ FFK VR E KK+ WPSR ++ +V+I++++ +VF +ID +L+ Sbjct: 1 MAGEGRKIVKFFKDVRAEMKKVTWPSRETMITYTEIVLIVVALFTVFIFLIDSVFSYLLK 60 Query: 61 FILGI 65 I+ + Sbjct: 61 LIIKV 65 >gi|297582434|ref|YP_003698214.1| preprotein translocase subunit SecE [Bacillus selenitireducens MLS10] gi|297140891|gb|ADH97648.1| preprotein translocase, SecE subunit [Bacillus selenitireducens MLS10] Length = 68 Score = 56.4 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 30/61 (49%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F K V E K++ WP+R E+ IVV + I ++FF + D +I ++ I Sbjct: 8 KSKNPIKFLKDVSTEMKRVTWPNRQELTKYTIVVSTTVIIMAIFFAISDFAISGILDLIT 67 Query: 64 G 64 Sbjct: 68 N 68 >gi|160944619|ref|ZP_02091846.1| hypothetical protein FAEPRAM212_02132 [Faecalibacterium prausnitzii M21/2] gi|158443803|gb|EDP20807.1| hypothetical protein FAEPRAM212_02132 [Faecalibacterium prausnitzii M21/2] gi|295104377|emb|CBL01921.1| preprotein translocase, SecE subunit, bacterial [Faecalibacterium prausnitzii SL3/3] Length = 83 Score = 56.4 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 37/57 (64%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V FF+ + E KK+ WPS+ +V + IVV++ ++I++V +++D G ++ I+G Sbjct: 26 VAKFFRDTKSELKKVVWPSKQDVKTNTIVVLVTVAIAAVVMILLDAIFGGILGLIIG 82 >gi|255994045|ref|ZP_05427180.1| conserved domain protein [Eubacterium saphenum ATCC 49989] gi|255993713|gb|EEU03802.1| conserved domain protein [Eubacterium saphenum ATCC 49989] Length = 104 Score = 56.4 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 34/64 (53%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 +L++ +FK V+ E KK+ WP++ E+ V++ + ++ F D I + M Sbjct: 39 KKEKLSLKEYFKGVKLEMKKVVWPTKKELGSYTTYVLVTCAFFTLLFYAADTGILFGMKK 98 Query: 62 ILGI 65 +LGI Sbjct: 99 LLGI 102 >gi|262370139|ref|ZP_06063466.1| preprotein translocase subunit SecE [Acinetobacter johnsonii SH046] gi|262315178|gb|EEY96218.1| preprotein translocase subunit SecE [Acinetobacter johnsonii SH046] Length = 146 Score = 56.0 bits (134), Expect = 1e-06, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 31/53 (58%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K R E +++ WP++ E + + V+ ++ ++S+ D +GWLM FI+G Sbjct: 94 LKDSRIELRRVTWPTKQETMTTSWQVLAVVVVASILLWCFDYILGWLMKFIIG 146 >gi|296533969|ref|ZP_06896487.1| preprotein translocase [Roseomonas cervicalis ATCC 49957] gi|296265700|gb|EFH11807.1| preprotein translocase [Roseomonas cervicalis ATCC 49957] Length = 65 Score = 56.0 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 39/62 (62%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +L F + VR E ++ WP+R E L++ +V+ + ++++VFFL+ D+ I +L+ + G Sbjct: 3 KLDPALFIRDVRQEVARVTWPTRKETLITTGLVLALSALAAVFFLLTDKLIQFLVSLLFG 62 Query: 65 IG 66 G Sbjct: 63 FG 64 >gi|255320103|ref|ZP_05361295.1| preprotein translocase iisp family, membrane subunit [Acinetobacter radioresistens SK82] gi|262379960|ref|ZP_06073115.1| preprotein translocase subunit SecE [Acinetobacter radioresistens SH164] gi|255302821|gb|EET82046.1| preprotein translocase iisp family, membrane subunit [Acinetobacter radioresistens SK82] gi|262298154|gb|EEY86068.1| preprotein translocase subunit SecE [Acinetobacter radioresistens SH164] Length = 146 Score = 56.0 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 31/53 (58%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K R E +++ WP++ E + + V+ ++ ++S+ D +GWLM FI+G Sbjct: 94 LKDSRIELRRVTWPTKQETMTTSWQVLAVVVVASILLWCFDYILGWLMKFIIG 146 >gi|167036787|ref|YP_001664365.1| preprotein translocase, SecE subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|320115209|ref|YP_004185368.1| preprotein translocase subunit SecE [Thermoanaerobacter brockii subsp. finnii Ako-1] gi|166855621|gb|ABY94029.1| preprotein translocase, SecE subunit [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|319928300|gb|ADV78985.1| preprotein translocase, SecE subunit [Thermoanaerobacter brockii subsp. finnii Ako-1] Length = 65 Score = 56.0 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 38/65 (58%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M ++ FFK +R E KK+ WPSR V+ +V+I++++ +VF +ID +L+ Sbjct: 1 MAGEGRKIVKFFKDIRAEMKKVTWPSRKTVITYTEIVLIVVALFTVFIFLIDSVFSYLLK 60 Query: 61 FILGI 65 I+ + Sbjct: 61 LIIKV 65 >gi|254456161|ref|ZP_05069590.1| preprotein translocase, SecE subunit [Candidatus Pelagibacter sp. HTCC7211] gi|207083163|gb|EDZ60589.1| preprotein translocase, SecE subunit [Candidatus Pelagibacter sp. HTCC7211] Length = 63 Score = 56.0 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 29/48 (60%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQS 54 + F ++V+ E+ K+ WP+ E L ++V M I S+FFL++DQ Sbjct: 3 NPIKFIQEVKQEAFKVSWPTWKETLQGALMVFAMAVIMSLFFLLLDQV 50 >gi|269215894|ref|ZP_06159748.1| preprotein translocase, SecE subunit [Slackia exigua ATCC 700122] gi|269130844|gb|EEZ61920.1| preprotein translocase, SecE subunit [Slackia exigua ATCC 700122] Length = 130 Score = 56.0 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 31/58 (53%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F K VR E K++ WP+R EV+ VV+ L VF V+D I ++ I G+G Sbjct: 72 FKFLKDVRLELKRVTWPTRQEVIRWTGVVLGALVFFGVFVAVLDAVIQPIVVAISGLG 129 >gi|56750898|ref|YP_171599.1| preprotein translocase subunit SecE [Synechococcus elongatus PCC 6301] gi|81299447|ref|YP_399655.1| preprotein translocase subunit SecE [Synechococcus elongatus PCC 7942] gi|56685857|dbj|BAD79079.1| preprotein translocase SecE subunit [Synechococcus elongatus PCC 6301] gi|81168328|gb|ABB56668.1| protein translocase subunit secE/sec61 gamma [Synechococcus elongatus PCC 7942] Length = 81 Score = 56.0 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 35/63 (55%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + L +++F ++ R E K+ WPSR +++ V++M+S+S+ +I++ W Sbjct: 19 ASSGLNLVSFLQETRAELSKVVWPSRQQLISESAAVLLMVSLSATLIYLINELFSWASSR 78 Query: 62 ILG 64 + G Sbjct: 79 VFG 81 >gi|229490697|ref|ZP_04384535.1| preprotein translocase subunit SecE [Rhodococcus erythropolis SK121] gi|229322517|gb|EEN88300.1| preprotein translocase subunit SecE [Rhodococcus erythropolis SK121] Length = 167 Score = 56.0 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF++V E +K+ WP+R +++ VV+ + F +D ++ + ++ G Sbjct: 113 KFFREVIAELRKVIWPNRKQMITYTSVVLTFVVFMVAFISGVDIAVIKGVTWLFG 167 >gi|301047714|ref|ZP_07194774.1| preprotein translocase, SecE subunit [Escherichia coli MS 185-1] gi|300300399|gb|EFJ56784.1| preprotein translocase, SecE subunit [Escherichia coli MS 185-1] Length = 127 Score = 56.0 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|300782524|ref|YP_003762815.1| preprotein translocase SecE subunit [Amycolatopsis mediterranei U32] gi|299792038|gb|ADJ42413.1| preprotein translocase SecE subunit [Amycolatopsis mediterranei U32] Length = 146 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ F ++V E +K+ WP+R +++ +VV+ + V+D + W + I G Sbjct: 90 LMRFIREVWAELRKVIWPNRKQMVTYTVVVLAFVVFMVGLVSVLDLAFKWGIGKIFG 146 >gi|300915243|ref|ZP_07132558.1| preprotein translocase, SecE subunit [Thermoanaerobacter sp. X561] gi|300888967|gb|EFK84114.1| preprotein translocase, SecE subunit [Thermoanaerobacter sp. X561] Length = 65 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 37/65 (56%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M ++ FFK +R E KK+ WPSR V+ +V+I++++ +VF ID +L+ Sbjct: 1 MAGEGRKIVKFFKDIRAEMKKVTWPSRKTVITYTEIVLIVMALLTVFIFFIDSIFSYLLK 60 Query: 61 FILGI 65 I+ + Sbjct: 61 LIIKV 65 >gi|262375154|ref|ZP_06068388.1| preprotein translocase subunit SecE [Acinetobacter lwoffii SH145] gi|262310167|gb|EEY91296.1| preprotein translocase subunit SecE [Acinetobacter lwoffii SH145] Length = 146 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 33/56 (58%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + K R E +++ WP++ E + + V++++ I+S+ D +GWLM FI+G Sbjct: 91 IRLLKDARIELRRVTWPTKQETMSTSWQVLVVVVIASILLWCFDYILGWLMKFIIG 146 >gi|298531098|ref|ZP_07018499.1| preprotein translocase, SecE subunit [Desulfonatronospira thiodismutans ASO3-1] gi|298509121|gb|EFI33026.1| preprotein translocase, SecE subunit [Desulfonatronospira thiodismutans ASO3-1] Length = 79 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 32/63 (50%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + + ++V+ E KK+ WP+R E L + + V+ ++ I S++ + D L+ Sbjct: 16 LQAKYEHTKEYLEEVKGELKKVTWPTRKETLSTALAVVALVIIVSIYLGIADFIFSRLVA 75 Query: 61 FIL 63 IL Sbjct: 76 LIL 78 >gi|238897919|ref|YP_002923598.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] gi|229465676|gb|ACQ67450.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] Length = 127 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A L F ++ R E +K+ WP+R E L + ++V ++ + S+ ID + L+ Sbjct: 61 LTKKGKASLEFAREARIEMRKVIWPTRQETLQTTLIVALITLVMSLILWGIDSILVRLIS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|78484627|ref|YP_390552.1| SecE subunit of protein translocation complex [Thiomicrospira crunogena XCL-2] gi|78362913|gb|ABB40878.1| protein translocase subunit secE/sec61 gamma [Thiomicrospira crunogena XCL-2] Length = 132 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 30/58 (51%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 ++ + E K++ WP+R E + ++V ++ + S+F ++D W + + G G Sbjct: 74 FSYLSHAQKEVKQVIWPTRQETVQMTLIVFAVVIVMSIFLWLVDMFFLWAVQMLTGQG 131 >gi|119502909|ref|ZP_01624994.1| translocase [marine gamma proteobacterium HTCC2080] gi|119461255|gb|EAW42345.1| translocase [marine gamma proteobacterium HTCC2080] Length = 119 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 31/56 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K R E +K+ WP+R E + ++V++ + I ++ ID +GWL+ ++G Sbjct: 64 WQLIKGSRTEIRKVVWPTRQETTQTTLIVVVFVFIMALILWGIDSVLGWLVGMVIG 119 >gi|113474162|ref|YP_720223.1| preprotein translocase subunit SecE [Trichodesmium erythraeum IMS101] gi|110165210|gb|ABG49750.1| protein translocase subunit secE/sec61 gamma [Trichodesmium erythraeum IMS101] Length = 74 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 35/59 (59%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 L+ + FF++ ++E K+ WPSR +++ + V++M+ +S+ ++D+ W + G Sbjct: 16 LSPVTFFQETKEELDKVVWPSREQLISESVAVLLMVILSATIIYLVDEFFSWGAQVVFG 74 >gi|295095133|emb|CBK84223.1| protein translocase subunit secE/sec61 gamma [Enterobacter cloacae subsp. cloacae NCTC 9394] Length = 127 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|237727885|ref|ZP_04558366.1| preprotein translocase subunit SecE [Citrobacter sp. 30_2] gi|261340890|ref|ZP_05968748.1| preprotein translocase, SecE subunit [Enterobacter cancerogenus ATCC 35316] gi|283836717|ref|ZP_06356458.1| preprotein translocase, SecE subunit [Citrobacter youngae ATCC 29220] gi|226910442|gb|EEH96360.1| preprotein translocase subunit SecE [Citrobacter sp. 30_2] gi|288316943|gb|EFC55881.1| preprotein translocase, SecE subunit [Enterobacter cancerogenus ATCC 35316] gi|291067264|gb|EFE05373.1| preprotein translocase, SecE subunit [Citrobacter youngae ATCC 29220] Length = 127 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|157147226|ref|YP_001454545.1| preprotein translocase subunit SecE [Citrobacter koseri ATCC BAA-895] gi|157084431|gb|ABV14109.1| hypothetical protein CKO_03009 [Citrobacter koseri ATCC BAA-895] Length = 127 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|296100609|ref|YP_003610755.1| preprotein translocase subunit SecE [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|311281469|ref|YP_003943700.1| preprotein translocase, SecE subunit [Enterobacter cloacae SCF1] gi|295055068|gb|ADF59806.1| preprotein translocase subunit SecE [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|308750664|gb|ADO50416.1| preprotein translocase, SecE subunit [Enterobacter cloacae SCF1] Length = 127 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|15804571|ref|NP_290612.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 EDL933] gi|15834158|ref|NP_312931.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. Sakai] gi|16131811|ref|NP_418408.1| preprotein translocase membrane subunit [Escherichia coli str. K-12 substr. MG1655] gi|26250750|ref|NP_756790.1| preprotein translocase subunit SecE [Escherichia coli CFT073] gi|74314475|ref|YP_312894.1| preprotein translocase subunit SecE [Shigella sonnei Ss046] gi|89110058|ref|AP_003838.1| preprotein translocase membrane subunit [Escherichia coli str. K-12 substr. W3110] gi|91212814|ref|YP_542800.1| preprotein translocase subunit SecE [Escherichia coli UTI89] gi|110644316|ref|YP_672046.1| preprotein translocase subunit SecE [Escherichia coli 536] gi|117626245|ref|YP_859568.1| preprotein translocase subunit SecE [Escherichia coli APEC O1] gi|157155377|ref|YP_001465472.1| preprotein translocase subunit SecE [Escherichia coli E24377A] gi|157163449|ref|YP_001460767.1| preprotein translocase subunit SecE [Escherichia coli HS] gi|168771451|ref|ZP_02796458.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4486] gi|168777408|ref|ZP_02802415.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4196] gi|168780364|ref|ZP_02805371.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4076] gi|168790339|ref|ZP_02815346.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC869] gi|170022016|ref|YP_001726970.1| preprotein translocase subunit SecE [Escherichia coli ATCC 8739] gi|170083441|ref|YP_001732761.1| preprotein translocase membrane subunit [Escherichia coli str. K-12 substr. DH10B] gi|170679747|ref|YP_001746365.1| preprotein translocase subunit SecE [Escherichia coli SMS-3-5] gi|170770137|ref|ZP_02904590.1| preprotein translocase subunit secE [Escherichia albertii TW07627] gi|187730737|ref|YP_001882666.1| preprotein translocase subunit SecE [Shigella boydii CDC 3083-94] gi|188492920|ref|ZP_03000190.1| preprotein translocase, SecE subunit [Escherichia coli 53638] gi|191172715|ref|ZP_03034253.1| preprotein translocase subunit secE [Escherichia coli F11] gi|193071947|ref|ZP_03052780.1| preprotein translocase subunit secE [Escherichia coli E110019] gi|194440250|ref|ZP_03072269.1| preprotein translocase subunit secE [Escherichia coli 101-1] gi|195939606|ref|ZP_03084988.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. EC4024] gi|208808098|ref|ZP_03250435.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4206] gi|208813674|ref|ZP_03255003.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4045] gi|208819192|ref|ZP_03259512.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4042] gi|209396026|ref|YP_002273497.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4115] gi|209921459|ref|YP_002295543.1| preprotein translocase subunit SecE [Escherichia coli SE11] gi|217325998|ref|ZP_03442082.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. TW14588] gi|218551035|ref|YP_002384826.1| preprotein translocase subunit SecE [Escherichia fergusonii ATCC 35469] gi|218556535|ref|YP_002389449.1| preprotein translocase subunit SecE [Escherichia coli IAI1] gi|218561047|ref|YP_002393960.1| preprotein translocase subunit SecE [Escherichia coli S88] gi|218692262|ref|YP_002400474.1| preprotein translocase subunit SecE [Escherichia coli ED1a] gi|218697688|ref|YP_002405355.1| preprotein translocase subunit SecE [Escherichia coli 55989] gi|218702611|ref|YP_002410240.1| preprotein translocase subunit SecE [Escherichia coli IAI39] gi|218707599|ref|YP_002415118.1| preprotein translocase subunit SecE [Escherichia coli UMN026] gi|227885490|ref|ZP_04003295.1| preprotein translocase subunit SecE [Escherichia coli 83972] gi|237702748|ref|ZP_04533229.1| preprotein translocase subunit SecE [Escherichia sp. 3_2_53FAA] gi|238903037|ref|YP_002928833.1| preprotein translocase membrane subunit [Escherichia coli BW2952] gi|253775390|ref|YP_003038221.1| preprotein translocase subunit SecE [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254039236|ref|ZP_04873285.1| preprotein translocase membrane subunit [Escherichia sp. 1_1_43] gi|254163922|ref|YP_003047030.1| preprotein translocase subunit SecE [Escherichia coli B str. REL606] gi|254795979|ref|YP_003080816.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. TW14359] gi|256021699|ref|ZP_05435564.1| preprotein translocase subunit SecE [Shigella sp. D9] gi|256026296|ref|ZP_05440161.1| preprotein translocase subunit SecE [Escherichia sp. 4_1_40B] gi|260846781|ref|YP_003224559.1| preprotein translocase membrane subunit SecE [Escherichia coli O103:H2 str. 12009] gi|260870692|ref|YP_003237094.1| preprotein translocase membrane subunit SecE [Escherichia coli O111:H- str. 11128] gi|261227308|ref|ZP_05941589.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. FRIK2000] gi|261257055|ref|ZP_05949588.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. FRIK966] gi|291285395|ref|YP_003502213.1| Preprotein translocase [Escherichia coli O55:H7 str. CB9615] gi|293407597|ref|ZP_06651515.1| secE [Escherichia coli FVEC1412] gi|293413416|ref|ZP_06656076.1| secE [Escherichia coli B354] gi|293417484|ref|ZP_06660107.1| preprotein translocase SecE subunit [Escherichia coli B185] gi|293474288|ref|ZP_06664697.1| preprotein translocase SecE subunit [Escherichia coli B088] gi|297519741|ref|ZP_06938127.1| preprotein translocase subunit SecE [Escherichia coli OP50] gi|298383345|ref|ZP_06992937.1| preprotein translocase SecE subunit [Escherichia coli FVEC1302] gi|300819791|ref|ZP_07099978.1| preprotein translocase, SecE subunit [Escherichia coli MS 107-1] gi|300824640|ref|ZP_07104748.1| preprotein translocase, SecE subunit [Escherichia coli MS 119-7] gi|300897606|ref|ZP_07116014.1| preprotein translocase, SecE subunit [Escherichia coli MS 198-1] gi|300907532|ref|ZP_07125172.1| preprotein translocase, SecE subunit [Escherichia coli MS 84-1] gi|300919396|ref|ZP_07135902.1| preprotein translocase, SecE subunit [Escherichia coli MS 115-1] gi|300925846|ref|ZP_07141691.1| preprotein translocase, SecE subunit [Escherichia coli MS 182-1] gi|300928798|ref|ZP_07144307.1| preprotein translocase, SecE subunit [Escherichia coli MS 187-1] gi|300938795|ref|ZP_07153507.1| preprotein translocase, SecE subunit [Escherichia coli MS 21-1] gi|300947416|ref|ZP_07161607.1| preprotein translocase, SecE subunit [Escherichia coli MS 116-1] gi|300954790|ref|ZP_07167219.1| preprotein translocase, SecE subunit [Escherichia coli MS 175-1] gi|300979571|ref|ZP_07174614.1| preprotein translocase, SecE subunit [Escherichia coli MS 45-1] gi|300985576|ref|ZP_07177492.1| preprotein translocase, SecE subunit [Escherichia coli MS 200-1] gi|301019393|ref|ZP_07183570.1| preprotein translocase, SecE subunit [Escherichia coli MS 69-1] gi|301023347|ref|ZP_07187139.1| preprotein translocase, SecE subunit [Escherichia coli MS 196-1] gi|301302208|ref|ZP_07208340.1| preprotein translocase, SecE subunit [Escherichia coli MS 124-1] gi|301326088|ref|ZP_07219486.1| preprotein translocase, SecE subunit [Escherichia coli MS 78-1] gi|301645765|ref|ZP_07245685.1| preprotein translocase, SecE subunit [Escherichia coli MS 146-1] gi|306811996|ref|ZP_07446204.1| preprotein translocase subunit SecE [Escherichia coli NC101] gi|307140672|ref|ZP_07500028.1| preprotein translocase subunit SecE [Escherichia coli H736] gi|307315046|ref|ZP_07594632.1| preprotein translocase, SecE subunit [Escherichia coli W] gi|309783932|ref|ZP_07678577.1| preprotein translocase, SecE subunit [Shigella dysenteriae 1617] gi|309797684|ref|ZP_07692070.1| preprotein translocase, SecE subunit [Escherichia coli MS 145-7] gi|312965366|ref|ZP_07779599.1| preprotein translocase, SecE subunit [Escherichia coli 2362-75] gi|312974233|ref|ZP_07788403.1| preprotein translocase, SecE subunit [Escherichia coli 1827-70] gi|331644715|ref|ZP_08345833.1| preprotein translocase subunit SecE [Escherichia coli H736] gi|331649834|ref|ZP_08350912.1| preprotein translocase subunit SecE [Escherichia coli M605] gi|331655678|ref|ZP_08356668.1| preprotein translocase subunit SecE [Escherichia coli M718] gi|331660540|ref|ZP_08361473.1| preprotein translocase subunit SecE [Escherichia coli TA206] gi|331665635|ref|ZP_08366531.1| preprotein translocase subunit SecE [Escherichia coli TA143] gi|331670833|ref|ZP_08371668.1| preprotein translocase subunit SecE [Escherichia coli TA271] gi|331675468|ref|ZP_08376217.1| preprotein translocase subunit SecE [Escherichia coli TA280] gi|331680101|ref|ZP_08380762.1| preprotein translocase subunit SecE [Escherichia coli H591] gi|331685722|ref|ZP_08386304.1| preprotein translocase subunit SecE [Escherichia coli H299] gi|84028690|sp|P0AG98|SECE_ECO57 RecName: Full=Preprotein translocase subunit secE gi|84028691|sp|P0AG97|SECE_ECOL6 RecName: Full=Preprotein translocase subunit secE gi|84028692|sp|P0AG96|SECE_ECOLI RecName: Full=Preprotein translocase subunit SecE gi|12518903|gb|AAG59177.1|AE005629_6 preprotein translocase [Escherichia coli O157:H7 str. EDL933] gi|26111181|gb|AAN83364.1|AE016770_164 Preprotein translocase secE subunit [Escherichia coli CFT073] gi|147800|gb|AAA24621.1| SecE protein [Escherichia coli] gi|396320|gb|AAC43079.1| ORF_o127a [Escherichia coli str. K-12 substr. MG1655] gi|1790413|gb|AAC76955.1| preprotein translocase membrane subunit [Escherichia coli str. K-12 substr. MG1655] gi|13364380|dbj|BAB38327.1| preprotein translocase [Escherichia coli O157:H7 str. Sakai] gi|73857952|gb|AAZ90659.1| preprotein translocase [Shigella sonnei Ss046] gi|85676089|dbj|BAE77339.1| preprotein translocase membrane subunit [Escherichia coli str. K12 substr. W3110] gi|91074388|gb|ABE09269.1| inner membrane preprotein translocase [Escherichia coli UTI89] gi|110345908|gb|ABG72145.1| preprotein translocase secE subunit [Escherichia coli 536] gi|115515369|gb|ABJ03444.1| preprotein translocase SecE subunit [Escherichia coli APEC O1] gi|157069129|gb|ABV08384.1| preprotein translocase subunit secE [Escherichia coli HS] gi|157077407|gb|ABV17115.1| preprotein translocase subunit secE [Escherichia coli E24377A] gi|169756944|gb|ACA79643.1| preprotein translocase, SecE subunit [Escherichia coli ATCC 8739] gi|169891276|gb|ACB04983.1| preprotein translocase membrane subunit [Escherichia coli str. K-12 substr. DH10B] gi|170121019|gb|EDS89950.1| preprotein translocase subunit secE [Escherichia albertii TW07627] gi|170517465|gb|ACB15643.1| preprotein translocase subunit secE [Escherichia coli SMS-3-5] gi|187427729|gb|ACD07003.1| preprotein translocase subunit secE [Shigella boydii CDC 3083-94] gi|187767368|gb|EDU31212.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4196] gi|188488119|gb|EDU63222.1| preprotein translocase, SecE subunit [Escherichia coli 53638] gi|189001848|gb|EDU70834.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4076] gi|189359753|gb|EDU78172.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4486] gi|189370178|gb|EDU88594.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC869] gi|190907019|gb|EDV66620.1| preprotein translocase subunit secE [Escherichia coli F11] gi|192954739|gb|EDV85309.1| preprotein translocase subunit secE [Escherichia coli E110019] gi|194420816|gb|EDX36884.1| preprotein translocase subunit secE [Escherichia coli 101-1] gi|208727899|gb|EDZ77500.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4206] gi|208734951|gb|EDZ83638.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4045] gi|208739315|gb|EDZ86997.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4042] gi|209157426|gb|ACI34859.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. EC4115] gi|209751868|gb|ACI74241.1| component in transcription antitermination [Escherichia coli] gi|209751870|gb|ACI74242.1| component in transcription antitermination [Escherichia coli] gi|209751872|gb|ACI74243.1| component in transcription antitermination [Escherichia coli] gi|209751874|gb|ACI74244.1| component in transcription antitermination [Escherichia coli] gi|209751876|gb|ACI74245.1| component in transcription antitermination [Escherichia coli] gi|209914718|dbj|BAG79792.1| preprotein translocase [Escherichia coli SE11] gi|217322219|gb|EEC30643.1| preprotein translocase subunit secE [Escherichia coli O157:H7 str. TW14588] gi|218354420|emb|CAV01218.1| preprotein translocase membrane subunit [Escherichia coli 55989] gi|218358576|emb|CAQ91224.1| preprotein translocase membrane subunit [Escherichia fergusonii ATCC 35469] gi|218363304|emb|CAR00954.1| preprotein translocase membrane subunit [Escherichia coli IAI1] gi|218367816|emb|CAR05611.1| preprotein translocase membrane subunit [Escherichia coli S88] gi|218372597|emb|CAR20472.1| preprotein translocase membrane subunit [Escherichia coli IAI39] gi|218429826|emb|CAR10795.2| preprotein translocase membrane subunit [Escherichia coli ED1a] gi|218434696|emb|CAR15628.1| preprotein translocase membrane subunit [Escherichia coli UMN026] gi|222035692|emb|CAP78437.1| Preprotein translocase secE subunit [Escherichia coli LF82] gi|226838471|gb|EEH70501.1| preprotein translocase membrane subunit [Escherichia sp. 1_1_43] gi|226903061|gb|EEH89320.1| preprotein translocase subunit SecE [Escherichia sp. 3_2_53FAA] gi|227837564|gb|EEJ48030.1| preprotein translocase subunit SecE [Escherichia coli 83972] gi|238863273|gb|ACR65271.1| preprotein translocase membrane subunit [Escherichia coli BW2952] gi|242379511|emb|CAQ34327.1| secE, subunit of SecEGY-Secretion Complex and Sec Protein Secretion Complex [Escherichia coli BL21(DE3)] gi|253326434|gb|ACT31036.1| preprotein translocase, SecE subunit [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|253975823|gb|ACT41494.1| translocase [Escherichia coli B str. REL606] gi|253979979|gb|ACT45649.1| translocase [Escherichia coli BL21(DE3)] gi|254595379|gb|ACT74740.1| preprotein translocase membrane subunit [Escherichia coli O157:H7 str. TW14359] gi|257761928|dbj|BAI33425.1| preprotein translocase membrane subunit SecE [Escherichia coli O103:H2 str. 12009] gi|257767048|dbj|BAI38543.1| preprotein translocase membrane subunit SecE [Escherichia coli O111:H- str. 11128] gi|260451192|gb|ACX41614.1| preprotein translocase, SecE subunit [Escherichia coli DH1] gi|281181045|dbj|BAI57375.1| preprotein translocase [Escherichia coli SE15] gi|284924073|emb|CBG37172.1| preprotein translocase SecE subunit [Escherichia coli 042] gi|290765268|gb|ADD59229.1| Preprotein translocase [Escherichia coli O55:H7 str. CB9615] gi|291321318|gb|EFE60759.1| preprotein translocase SecE subunit [Escherichia coli B088] gi|291425365|gb|EFE98405.1| secE [Escherichia coli FVEC1412] gi|291430811|gb|EFF03808.1| preprotein translocase SecE subunit [Escherichia coli B185] gi|291468011|gb|EFF10510.1| secE [Escherichia coli B354] gi|294493030|gb|ADE91786.1| preprotein translocase subunit secE [Escherichia coli IHE3034] gi|298276224|gb|EFI17745.1| preprotein translocase SecE subunit [Escherichia coli FVEC1302] gi|299880907|gb|EFI89118.1| preprotein translocase, SecE subunit [Escherichia coli MS 196-1] gi|300306522|gb|EFJ61042.1| preprotein translocase, SecE subunit [Escherichia coli MS 200-1] gi|300318259|gb|EFJ68043.1| preprotein translocase, SecE subunit [Escherichia coli MS 175-1] gi|300358653|gb|EFJ74523.1| preprotein translocase, SecE subunit [Escherichia coli MS 198-1] gi|300399277|gb|EFJ82815.1| preprotein translocase, SecE subunit [Escherichia coli MS 69-1] gi|300400739|gb|EFJ84277.1| preprotein translocase, SecE subunit [Escherichia coli MS 84-1] gi|300409475|gb|EFJ93013.1| preprotein translocase, SecE subunit [Escherichia coli MS 45-1] gi|300413531|gb|EFJ96841.1| preprotein translocase, SecE subunit [Escherichia coli MS 115-1] gi|300418071|gb|EFK01382.1| preprotein translocase, SecE subunit [Escherichia coli MS 182-1] gi|300452985|gb|EFK16605.1| preprotein translocase, SecE subunit [Escherichia coli MS 116-1] gi|300456279|gb|EFK19772.1| preprotein translocase, SecE subunit [Escherichia coli MS 21-1] gi|300463209|gb|EFK26702.1| preprotein translocase, SecE subunit [Escherichia coli MS 187-1] gi|300522889|gb|EFK43958.1| preprotein translocase, SecE subunit [Escherichia coli MS 119-7] gi|300527612|gb|EFK48674.1| preprotein translocase, SecE subunit [Escherichia coli MS 107-1] gi|300842371|gb|EFK70131.1| preprotein translocase, SecE subunit [Escherichia coli MS 124-1] gi|300847181|gb|EFK74941.1| preprotein translocase, SecE subunit [Escherichia coli MS 78-1] gi|301075976|gb|EFK90782.1| preprotein translocase, SecE subunit [Escherichia coli MS 146-1] gi|305854601|gb|EFM55037.1| preprotein translocase subunit SecE [Escherichia coli NC101] gi|306905551|gb|EFN36084.1| preprotein translocase, SecE subunit [Escherichia coli W] gi|307556124|gb|ADN48899.1| preprotein translocase SecE subunit [Escherichia coli ABU 83972] gi|307628402|gb|ADN72706.1| preprotein translocase subunit SecE [Escherichia coli UM146] gi|308118696|gb|EFO55958.1| preprotein translocase, SecE subunit [Escherichia coli MS 145-7] gi|308928303|gb|EFP73765.1| preprotein translocase, SecE subunit [Shigella dysenteriae 1617] gi|309704396|emb|CBJ03745.1| preprotein translocase SecE subunit [Escherichia coli ETEC H10407] gi|310331400|gb|EFP98665.1| preprotein translocase, SecE subunit [Escherichia coli 1827-70] gi|312290040|gb|EFR17927.1| preprotein translocase, SecE subunit [Escherichia coli 2362-75] gi|312948555|gb|ADR29382.1| preprotein translocase subunit SecE [Escherichia coli O83:H1 str. NRG 857C] gi|315063306|gb|ADT77633.1| preprotein translocase membrane subunit [Escherichia coli W] gi|315138537|dbj|BAJ45696.1| preprotein translocase [Escherichia coli DH1] gi|315253053|gb|EFU33021.1| preprotein translocase, SecE subunit [Escherichia coli MS 85-1] gi|315288349|gb|EFU47747.1| preprotein translocase, SecE subunit [Escherichia coli MS 110-3] gi|315294337|gb|EFU53688.1| preprotein translocase, SecE subunit [Escherichia coli MS 153-1] gi|315300754|gb|EFU59979.1| preprotein translocase, SecE subunit [Escherichia coli MS 16-3] gi|315617344|gb|EFU97950.1| preprotein translocase, SecE subunit [Escherichia coli 3431] gi|320172758|gb|EFW47992.1| Preprotein translocase subunit SecE [Shigella dysenteriae CDC 74-1112] gi|320179558|gb|EFW54509.1| Preprotein translocase subunit SecE [Shigella boydii ATCC 9905] gi|320190923|gb|EFW65573.1| Preprotein translocase subunit SecE [Escherichia coli O157:H7 str. EC1212] gi|320197124|gb|EFW71742.1| Preprotein translocase subunit SecE [Escherichia coli WV_060327] gi|320200180|gb|EFW74769.1| Preprotein translocase subunit SecE [Escherichia coli EC4100B] gi|320639071|gb|EFX08711.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. G5101] gi|320644465|gb|EFX13528.1| preprotein translocase subunit SecE [Escherichia coli O157:H- str. 493-89] gi|320649784|gb|EFX18305.1| preprotein translocase subunit SecE [Escherichia coli O157:H- str. H 2687] gi|320655117|gb|EFX23073.1| preprotein translocase subunit SecE [Escherichia coli O55:H7 str. 3256-97 TW 07815] gi|320660761|gb|EFX28215.1| preprotein translocase subunit SecE [Escherichia coli O55:H7 str. USDA 5905] gi|320665879|gb|EFX32910.1| preprotein translocase subunit SecE [Escherichia coli O157:H7 str. LSU-61] gi|323167451|gb|EFZ53159.1| preprotein translocase, SecE subunit [Shigella sonnei 53G] gi|323174510|gb|EFZ60135.1| preprotein translocase, SecE subunit [Escherichia coli LT-68] gi|323177534|gb|EFZ63119.1| preprotein translocase, SecE subunit [Escherichia coli 1180] gi|323190162|gb|EFZ75440.1| preprotein translocase, SecE subunit [Escherichia coli RN587/1] gi|323380630|gb|ADX52898.1| preprotein translocase, SecE subunit [Escherichia coli KO11] gi|323933977|gb|EGB30451.1| preprotein translocase [Escherichia coli E1520] gi|323938902|gb|EGB35122.1| preprotein translocase [Escherichia coli E482] gi|323943602|gb|EGB39711.1| preprotein translocase [Escherichia coli H120] gi|323953806|gb|EGB49613.1| preprotein translocase [Escherichia coli H263] gi|323958907|gb|EGB54582.1| preprotein translocase [Escherichia coli H489] gi|323963801|gb|EGB59300.1| preprotein translocase [Escherichia coli M863] gi|323969054|gb|EGB64362.1| preprotein translocase [Escherichia coli TA007] gi|323974181|gb|EGB69313.1| preprotein translocase [Escherichia coli TW10509] gi|324009472|gb|EGB78691.1| preprotein translocase, SecE subunit [Escherichia coli MS 57-2] gi|324015276|gb|EGB84495.1| preprotein translocase, SecE subunit [Escherichia coli MS 60-1] gi|324017336|gb|EGB86555.1| preprotein translocase, SecE subunit [Escherichia coli MS 117-3] gi|324110893|gb|EGC04885.1| preprotein translocase [Escherichia fergusonii B253] gi|324115412|gb|EGC09357.1| preprotein translocase [Escherichia coli E1167] gi|325499287|gb|EGC97146.1| preprotein translocase subunit SecE [Escherichia fergusonii ECD227] gi|326347169|gb|EGD70899.1| Preprotein translocase subunit SecE [Escherichia coli O157:H7 str. 1125] gi|326347580|gb|EGD71302.1| Preprotein translocase subunit SecE [Escherichia coli O157:H7 str. 1044] gi|327250451|gb|EGE62161.1| preprotein translocase, SecE subunit [Escherichia coli STEC_7v] gi|330908298|gb|EGH36817.1| preprotein translocase subunit SecE [Escherichia coli AA86] gi|331036015|gb|EGI08252.1| preprotein translocase subunit SecE [Escherichia coli H736] gi|331041300|gb|EGI13452.1| preprotein translocase subunit SecE [Escherichia coli M605] gi|331046603|gb|EGI18690.1| preprotein translocase subunit SecE [Escherichia coli M718] gi|331052323|gb|EGI24361.1| preprotein translocase subunit SecE [Escherichia coli TA206] gi|331057153|gb|EGI29145.1| preprotein translocase subunit SecE [Escherichia coli TA143] gi|331061921|gb|EGI33845.1| preprotein translocase subunit SecE [Escherichia coli TA271] gi|331067346|gb|EGI38752.1| preprotein translocase subunit SecE [Escherichia coli TA280] gi|331072256|gb|EGI43590.1| preprotein translocase subunit SecE [Escherichia coli H591] gi|331077032|gb|EGI48248.1| preprotein translocase subunit SecE [Escherichia coli H299] gi|332105294|gb|EGJ08640.1| preprotein translocase subunit SecE [Shigella sp. D9] Length = 127 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|260858090|ref|YP_003231981.1| preprotein translocase membrane subunit SecE [Escherichia coli O26:H11 str. 11368] gi|257756739|dbj|BAI28241.1| preprotein translocase membrane subunit SecE [Escherichia coli O26:H11 str. 11368] gi|323155527|gb|EFZ41705.1| preprotein translocase, SecE subunit [Escherichia coli EPECa14] Length = 127 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 36/65 (55%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + N A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTNGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|262373976|ref|ZP_06067253.1| preprotein translocase subunit SecE [Acinetobacter junii SH205] gi|262310987|gb|EEY92074.1| preprotein translocase subunit SecE [Acinetobacter junii SH205] Length = 145 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 31/56 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + R E +++ WP++ E + + V++++ I+S+ D +GW + I+G Sbjct: 90 VRLLQDARIELRRVTWPTKQETITTSWQVLLVVIIASLVLWCFDYGLGWFIKLIIG 145 >gi|300714841|ref|YP_003739644.1| Preprotein translocase SecE subunit [Erwinia billingiae Eb661] gi|299060677|emb|CAX57784.1| Preprotein translocase SecE subunit [Erwinia billingiae Eb661] Length = 127 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + + L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKSTLAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|158319529|ref|YP_001512036.1| preprotein translocase, SecE subunit [Alkaliphilus oremlandii OhILAs] gi|158139728|gb|ABW18040.1| preprotein translocase, SecE subunit [Alkaliphilus oremlandii OhILAs] Length = 71 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 35/54 (64%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K VR E KK+ WP++ E+ + +VV+I +++++V ID +G+ ++ I+ Sbjct: 17 KFIKGVRSELKKVNWPNKKELTNNSVVVVITVTLATVAIWAIDSILGYGLNLII 70 >gi|117618782|ref|YP_858462.1| preprotein translocase, SecE subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966] gi|117560189|gb|ABK37137.1| preprotein translocase, SecE subunit [Aeromonas hydrophila subsp. hydrophila ATCC 7966] Length = 123 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 37/62 (59%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A L F ++ R E +K+ WP+R E + + ++V+ + ++ + ++D ++ WL++ I Sbjct: 62 KGKATLAFARESRLEVRKVVWPTRQEAIQTTLIVLAVTAVMGLLLFILDGALVWLVNLIT 121 Query: 64 GI 65 G+ Sbjct: 122 GV 123 >gi|322834827|ref|YP_004214854.1| preprotein translocase SecE subunit [Rahnella sp. Y9602] gi|321170028|gb|ADW75727.1| preprotein translocase, SecE subunit [Rahnella sp. Y9602] Length = 127 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|218246574|ref|YP_002371945.1| preprotein translocase subunit SecE [Cyanothece sp. PCC 8801] gi|257059614|ref|YP_003137502.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 8802] gi|218167052|gb|ACK65789.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 8801] gi|256589780|gb|ACV00667.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 8802] Length = 78 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 29/59 (49%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NF + ++E K+ WPSR ++L + VI+M+S+ + ++D W + Sbjct: 20 ETKPANFINETKEELGKVVWPSRQQLLSESVAVILMVSLVATVIYLVDNLFAWGAGKVF 78 >gi|118594013|ref|ZP_01551360.1| translocase [Methylophilales bacterium HTCC2181] gi|118439791|gb|EAV46418.1| translocase [Methylophilales bacterium HTCC2181] Length = 114 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 31/56 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F E+KK+ WP+R E ++V I++ + ++F +D ++++ ILG G Sbjct: 59 FLNDAITEAKKVVWPTRKETFQMTLIVFILVVLMAIFLAFVDIGFSYIINMILGRG 114 >gi|82778844|ref|YP_405193.1| preprotein translocase subunit SecE [Shigella dysenteriae Sd197] gi|81242992|gb|ABB63702.1| preprotein translocase [Shigella dysenteriae Sd197] Length = 127 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVPLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FIPGL 125 >gi|332083869|gb|EGI89082.1| preprotein translocase, SecE subunit [Shigella boydii 5216-82] Length = 127 Score = 55.2 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|325577260|ref|ZP_08147744.1| preprotein translocase [Haemophilus parainfluenzae ATCC 33392] gi|325160842|gb|EGC72963.1| preprotein translocase [Haemophilus parainfluenzae ATCC 33392] Length = 138 Score = 54.8 bits (131), Expect = 3e-06, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 35/60 (58%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF + + E +K+ WP+R+E + ++VI + ++S+FF ID I L++F+ + Sbjct: 77 TKARTFFSEAKVEGRKVVWPTRAETRQTTLIVIAVTVLTSLFFWAIDSIIIALINFLTDL 136 >gi|145297372|ref|YP_001140213.1| preprotein translocase subunit SecE [Aeromonas salmonicida subsp. salmonicida A449] gi|142850144|gb|ABO88465.1| preprotein translocase subunit SecE [Aeromonas salmonicida subsp. salmonicida A449] Length = 123 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 37/62 (59%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A L F ++ R E +K+ WP+R E + + ++V+ + ++ + ++D ++ WL++ I Sbjct: 62 KGKATLAFARESRLEVRKVVWPTRQEAIQTTLIVLAVTAVMGLLLFMLDGALVWLVNLIT 121 Query: 64 GI 65 G+ Sbjct: 122 GV 123 >gi|30064736|ref|NP_838907.1| preprotein translocase subunit SecE [Shigella flexneri 2a str. 2457T] gi|110807831|ref|YP_691351.1| preprotein translocase subunit SecE [Shigella flexneri 5 str. 8401] gi|30042996|gb|AAP18718.1| preprotein translocase [Shigella flexneri 2a str. 2457T] gi|110617379|gb|ABF06046.1| preprotein translocase [Shigella flexneri 5 str. 8401] gi|281603367|gb|ADA76351.1| Preprotein translocase [Shigella flexneri 2002017] gi|313648631|gb|EFS13071.1| preprotein translocase, SecE subunit [Shigella flexneri 2a str. 2457T] Length = 127 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATIAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|92112541|ref|YP_572469.1| protein translocase subunit secE/sec61 gamma [Chromohalobacter salexigens DSM 3043] gi|91795631|gb|ABE57770.1| protein translocase subunit secE/sec61 gamma [Chromohalobacter salexigens DSM 3043] Length = 122 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 33/61 (54%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ + R E +++ WP+R E + + +V++ + + + +ID +GW+M I+ Sbjct: 62 KGRALAELARGSRKEIRRVVWPTRPETIQTTAIVLVAVLLVGIMLWLIDTLLGWIMSGII 121 Query: 64 G 64 G Sbjct: 122 G 122 >gi|86608695|ref|YP_477457.1| preprotein translocase subunit SecE [Synechococcus sp. JA-2-3B'a(2-13)] gi|86557237|gb|ABD02194.1| preprotein translocase, SecE subunit [Synechococcus sp. JA-2-3B'a(2-13)] Length = 90 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 30/57 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F ++ R E KI WPSR +++ + V++++ + F ++DQ W+ + Sbjct: 33 GIPGFIQETRTELSKIVWPSRRQLIGESVGVLLIVLAFASFIYLVDQVFAWVATQLF 89 >gi|94971708|ref|YP_593756.1| SecE subunit of protein translocation complex [Candidatus Koribacter versatilis Ellin345] gi|94553758|gb|ABF43682.1| SecE subunit of protein translocation complex [Candidatus Koribacter versatilis Ellin345] Length = 86 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 20/53 (37%), Positives = 33/53 (62%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F+ VR E KK+ PSR EV + +VVII + I ++F ++D +IG + ++ Sbjct: 28 FYNDVRTEMKKVSTPSRKEVQSTTVVVIITVFIFGLYFWLVDNAIGKGIDYMF 80 >gi|332159906|ref|YP_004296483.1| preprotein translocase subunit SecE [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|318607544|emb|CBY29042.1| preprotein translocase subunit SecE [Yersinia enterocolitica subsp. palearctica Y11] gi|325664136|gb|ADZ40780.1| preprotein translocase subunit SecE [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|330863584|emb|CBX73696.1| preprotein translocase subunit secE [Yersinia enterocolitica W22703] Length = 127 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 MTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|159039850|ref|YP_001539103.1| preprotein translocase, SecE subunit [Salinispora arenicola CNS-205] gi|157918685|gb|ABW00113.1| preprotein translocase, SecE subunit [Salinispora arenicola CNS-205] Length = 125 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 31/57 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ F ++V E +K+ WP+R E+L VVI+ +++ +D + + ++ G Sbjct: 66 IVRFVREVVAELRKVIWPTRKELLTYTAVVIVFVAVMLAIVAGLDLAFAEGVLWVFG 122 >gi|253998001|ref|YP_003050064.1| preprotein translocase subunit SecE [Methylovorus sp. SIP3-4] gi|313200069|ref|YP_004038727.1| preprotein translocase subunit SecE [Methylovorus sp. MP688] gi|253984680|gb|ACT49537.1| preprotein translocase, SecE subunit [Methylovorus sp. SIP3-4] gi|312439385|gb|ADQ83491.1| preprotein translocase, SecE subunit [Methylovorus sp. MP688] Length = 115 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 32/58 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F + E++++ WP+R E + + + V +++ + +VF ++D W + ++G G Sbjct: 57 FAFVQDSAAEARRVVWPTRKETIQTTVAVFVLVMVMAVFLWLVDIGFLWGVKMLMGRG 114 >gi|150392174|ref|YP_001322223.1| preprotein translocase, SecE subunit [Alkaliphilus metalliredigens QYMF] gi|149952036|gb|ABR50564.1| preprotein translocase, SecE subunit [Alkaliphilus metalliredigens QYMF] Length = 71 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 32/60 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F + VR E KK+ WP+R+E+ VVII ++ V ++D G+ ++ ++ Sbjct: 12 KAKGLGKFLRGVRSELKKVNWPNRAEIKNHTGVVIIATLMAVVLLWILDSVFGFGLNLLI 71 >gi|323948847|gb|EGB44744.1| preprotein translocase [Escherichia coli H252] Length = 127 Score = 54.8 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|304399297|ref|ZP_07381162.1| preprotein translocase, SecE subunit [Pantoea sp. aB] gi|304353153|gb|EFM17535.1| preprotein translocase, SecE subunit [Pantoea sp. aB] Length = 127 Score = 54.4 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEMRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|304315926|ref|YP_003851071.1| preprotein translocase, SecE subunit [Thermoanaerobacterium thermosaccharolyticum DSM 571] gi|302777428|gb|ADL67987.1| preprotein translocase, SecE subunit [Thermoanaerobacterium thermosaccharolyticum DSM 571] Length = 66 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 35/60 (58%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R FF++++ E KK+ WP+R+++L VV++++ ++ + D + +L+ I+ Sbjct: 6 RRKAGKFFREIKAEMKKVTWPTRNDLLAYTEVVLVVVIAFTLLIFLADSAFSYLLKLIIK 65 >gi|323161297|gb|EFZ47207.1| preprotein translocase, SecE subunit [Escherichia coli E128010] Length = 127 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|146309858|ref|YP_001174932.1| preprotein translocase subunit SecE [Enterobacter sp. 638] gi|145316734|gb|ABP58881.1| protein translocase subunit secE/sec61 gamma [Enterobacter sp. 638] Length = 127 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|82546323|ref|YP_410270.1| preprotein translocase subunit SecE [Shigella boydii Sb227] gi|81247734|gb|ABB68442.1| preprotein translocase [Shigella boydii Sb227] Length = 127 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|261367233|ref|ZP_05980116.1| preprotein translocase, SecE subunit [Subdoligranulum variabile DSM 15176] gi|282570833|gb|EFB76368.1| preprotein translocase, SecE subunit [Subdoligranulum variabile DSM 15176] Length = 91 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 35/58 (60%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + +FK + E KK+ WPS+ +V + I VI ++ I+++ +V+D G +H ++G Sbjct: 33 GIAKYFKDTKSELKKVVWPSKKDVKTNTITVIAVVLIAAIVLIVLDLIFGGAIHLVVG 90 >gi|261819560|ref|YP_003257666.1| preprotein translocase subunit SecE [Pectobacterium wasabiae WPP163] gi|261603573|gb|ACX86059.1| preprotein translocase, SecE subunit [Pectobacterium wasabiae WPP163] Length = 127 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|291615762|ref|YP_003518504.1| SecE [Pantoea ananatis LMG 20103] gi|291150792|gb|ADD75376.1| SecE [Pantoea ananatis LMG 20103] gi|327396028|dbj|BAK13450.1| preprotein translocase SecE subunit [Pantoea ananatis AJ13355] Length = 132 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 66 LTTKGKATVAFAREARTEMRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 125 Query: 61 FILGI 65 FI G+ Sbjct: 126 FITGL 130 >gi|310817024|ref|YP_003964988.1| preprotein translocase, SecE subunit [Ketogulonicigenium vulgare Y25] gi|308755759|gb|ADO43688.1| preprotein translocase, SecE subunit [Ketogulonicigenium vulgare Y25] Length = 66 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 24/60 (40%), Positives = 40/60 (66%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R + F +QVR E KI WP+R EV V+ ++V+ + +++++FF +D SI +L+ ILG Sbjct: 3 RTNPIQFAQQVRAEIGKITWPTRREVTVTTLMVVAIAALAALFFSAVDISIRFLLDVILG 62 >gi|317046438|ref|YP_004114086.1| preprotein translocase subunit SecE [Pantoea sp. At-9b] gi|316948055|gb|ADU67530.1| preprotein translocase, SecE subunit [Pantoea sp. At-9b] Length = 127 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEMRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|50083573|ref|YP_045083.1| preprotein translocase subunit SecE [Acinetobacter sp. ADP1] gi|49529549|emb|CAG67261.1| preprotein translocase IISP family, membrane subunit [Acinetobacter sp. ADP1] Length = 146 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + K R E +++ WP++ E + + V++++ I+S+ D +GWL+ I+G Sbjct: 91 IRLLKDARIELRRVTWPTKQETVTTSWQVLLVVVITSIVLWCFDYGLGWLIKLIIG 146 >gi|238756066|ref|ZP_04617389.1| Preprotein translocase subunit secE [Yersinia ruckeri ATCC 29473] gi|238705733|gb|EEP98127.1| Preprotein translocase subunit secE [Yersinia ruckeri ATCC 29473] Length = 127 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 36/65 (55%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M V A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 MTVKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|154249534|ref|YP_001410359.1| preprotein translocase, SecE subunit [Fervidobacterium nodosum Rt17-B1] gi|154153470|gb|ABS60702.1| preprotein translocase, SecE subunit [Fervidobacterium nodosum Rt17-B1] Length = 63 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 34/54 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF +V+ E+KK WP+R E+L S VV+ +L++S+V+ ++D + +L Sbjct: 7 KFFAEVKSEAKKTTWPNREELLASTGVVLFILAVSAVYLFLVDLLFSGTLGALL 60 >gi|123440669|ref|YP_001004662.1| preprotein translocase subunit SecE [Yersinia enterocolitica subsp. enterocolitica 8081] gi|238760250|ref|ZP_04621394.1| Preprotein translocase subunit secE [Yersinia aldovae ATCC 35236] gi|238785544|ref|ZP_04629525.1| Preprotein translocase subunit secE [Yersinia bercovieri ATCC 43970] gi|122087630|emb|CAL10412.1| preprotein translocase SecE subunit [Yersinia enterocolitica subsp. enterocolitica 8081] gi|238701514|gb|EEP94087.1| Preprotein translocase subunit secE [Yersinia aldovae ATCC 35236] gi|238713529|gb|EEQ05560.1| Preprotein translocase subunit secE [Yersinia bercovieri ATCC 43970] Length = 127 Score = 54.4 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 MTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|330831433|ref|YP_004394385.1| preprotein translocase subunit SecE [Aeromonas veronii B565] gi|328806569|gb|AEB51768.1| Preprotein translocase, SecE subunit [Aeromonas veronii B565] Length = 95 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 37/62 (59%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A L F ++ R E +K+ WP+R E + + ++V+ + ++ + V+D ++ WL++ I Sbjct: 34 KGKATLAFARESRLEVRKVVWPTRQEAIQTTLIVLAVTAVMGLLLFVLDGALVWLVNLIT 93 Query: 64 GI 65 G+ Sbjct: 94 GV 95 >gi|238752783|ref|ZP_04614251.1| Preprotein translocase subunit secE [Yersinia rohdei ATCC 43380] gi|238708981|gb|EEQ01231.1| Preprotein translocase subunit secE [Yersinia rohdei ATCC 43380] Length = 127 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 MTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|238794965|ref|ZP_04638562.1| Preprotein translocase subunit secE [Yersinia intermedia ATCC 29909] gi|238725723|gb|EEQ17280.1| Preprotein translocase subunit secE [Yersinia intermedia ATCC 29909] Length = 127 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 MTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|85058106|ref|YP_453808.1| preprotein translocase subunit SecE [Sodalis glossinidius str. 'morsitans'] gi|84778626|dbj|BAE73403.1| preprotein translocase SecE subunit [Sodalis glossinidius str. 'morsitans'] Length = 127 Score = 54.0 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + + + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + ++ Sbjct: 61 ITAKGKSTVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRVVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|238765323|ref|ZP_04626249.1| Preprotein translocase subunit secE [Yersinia kristensenii ATCC 33638] gi|238798657|ref|ZP_04642131.1| Preprotein translocase subunit secE [Yersinia mollaretii ATCC 43969] gi|238696450|gb|EEP89241.1| Preprotein translocase subunit secE [Yersinia kristensenii ATCC 33638] gi|238717475|gb|EEQ09317.1| Preprotein translocase subunit secE [Yersinia mollaretii ATCC 43969] Length = 132 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 66 MTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 125 Query: 61 FILGI 65 FI G+ Sbjct: 126 FITGL 130 >gi|225874473|ref|YP_002755932.1| preprotein translocase, SecE subunit [Acidobacterium capsulatum ATCC 51196] gi|225791321|gb|ACO31411.1| preprotein translocase, SecE subunit [Acidobacterium capsulatum ATCC 51196] Length = 85 Score = 53.7 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 34/58 (58%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FFK VR E +K+ PSR+EV + +VVI + + S FF V+D +G + +L Sbjct: 22 TRSMEFFKDVRSEMRKVVTPSRAEVQSTTLVVIFSVFLFSAFFYVVDSIVGRGLQALL 79 >gi|237809528|ref|YP_002893968.1| preprotein translocase, SecE subunit [Tolumonas auensis DSM 9187] gi|237501789|gb|ACQ94382.1| preprotein translocase, SecE subunit [Tolumonas auensis DSM 9187] Length = 127 Score = 53.7 bits (128), Expect = 7e-06, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A+L F ++ E +K+ WP+R E + + +++ + +F +ID ++ WL+ I G+ Sbjct: 67 ALLTFSRESIKEVRKVVWPTRQETIQTTLIIFAFTVVMGLFLFLIDGALIWLVELITGM 125 >gi|320540640|ref|ZP_08040290.1| preprotein translocase membrane subunit [Serratia symbiotica str. Tucson] gi|320029571|gb|EFW11600.1| preprotein translocase membrane subunit [Serratia symbiotica str. Tucson] Length = 154 Score = 53.7 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 88 MTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSMILWGLDGVLVRLVS 147 Query: 61 FILGI 65 FI G+ Sbjct: 148 FITGL 152 >gi|319950478|ref|ZP_08024391.1| preprotein translocase subunit SecE [Dietzia cinnamea P4] gi|319435837|gb|EFV91044.1| preprotein translocase subunit SecE [Dietzia cinnamea P4] Length = 113 Score = 53.7 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 29/62 (46%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 R + QV +E +K+ WP+R++++ IVV + L + +D G L+ Sbjct: 50 RTARANPFQYIGQVVEELRKVIWPTRNQMVTYTIVVFLFLIFMTALVSGVDFGAGKLVEL 109 Query: 62 IL 63 + Sbjct: 110 VF 111 >gi|53804630|ref|YP_113535.1| preprotein translocase, SecE subunit [Methylococcus capsulatus str. Bath] gi|53758391|gb|AAU92682.1| preprotein translocase, SecE subunit [Methylococcus capsulatus str. Bath] Length = 124 Score = 53.7 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 34/62 (54%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A+L FF++ R E +K+ WP+R E + ++V+ ++ +F ++D + W + I Sbjct: 63 AKGRALLGFFRESRIEVRKVVWPTRQEAAQATLMVVALVFFVGIFLWLLDMLLFWAITSI 122 Query: 63 LG 64 G Sbjct: 123 TG 124 >gi|322513222|ref|ZP_08066348.1| preprotein translocase [Actinobacillus ureae ATCC 25976] gi|322120998|gb|EFX92839.1| preprotein translocase [Actinobacillus ureae ATCC 25976] Length = 158 Score = 53.7 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 30/55 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 102 FIKESRTELRKIIWPTRPEATQATLIVLAMCVVVSLVLWGIDSIIVTLITFLTNL 156 >gi|284009038|emb|CBA75990.1| preprotein translocase SecE subunit [Arsenophonus nasoniae] Length = 127 Score = 53.7 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 34/63 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A L F ++ R E +K+ WP+R E L + ++V + ++ ++ +D + L+ FI Sbjct: 63 AKGKATLAFAREARIEMRKVIWPTRQETLQTTLIVAAVTAVMALILWGLDGILVRLVSFI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGL 125 >gi|226361073|ref|YP_002778851.1| preprotein translocase subunit SecE [Rhodococcus opacus B4] gi|226239558|dbj|BAH49906.1| preprotein translocase SecE subunit [Rhodococcus opacus B4] Length = 158 Score = 53.7 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F ++V E +K+ WP+R +++ VV+ + F V+D ++ + ++ G Sbjct: 104 RFLREVIAELRKVIWPNRKQMITYTSVVLAFVVFMVTFIGVLDLAVIKGVTWLFG 158 >gi|300725137|ref|YP_003714465.1| preprotein translocase membrane protein [Xenorhabdus nematophila ATCC 19061] gi|297631682|emb|CBJ92395.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Xenorhabdus nematophila ATCC 19061] Length = 127 Score = 53.7 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 35/63 (55%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 63 VKGKAALAFAREARIEMRKVIWPTRQEALHTTLIVAAVTAVMSLILWGLDGILVRLVSFI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGL 125 >gi|307823428|ref|ZP_07653657.1| preprotein translocase, SecE subunit [Methylobacter tundripaludum SV96] gi|307735413|gb|EFO06261.1| preprotein translocase, SecE subunit [Methylobacter tundripaludum SV96] Length = 125 Score = 53.7 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 30/60 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + F + + E +K+ WP+R E + ++V M+ I + ++D + W + + G G Sbjct: 65 NIWGFVLESKQEVRKVVWPTREETFRTTLLVFGMVFIVGLILWLLDMFLFWGVRLLTGQG 124 >gi|330470188|ref|YP_004407931.1| preprotein translocase subunit SecE [Verrucosispora maris AB-18-032] gi|328813159|gb|AEB47331.1| preprotein translocase, sece subunit [Verrucosispora maris AB-18-032] Length = 130 Score = 53.7 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++V E +K+ WP+R E+L VVI +S+ ++D + + ++ G Sbjct: 71 IARFIREVVAELRKVIWPTRKELLTYTGVVIAFVSMMLAIVALLDFAFAKGVLWVFG 127 >gi|300114749|ref|YP_003761324.1| preprotein translocase subunit SecE [Nitrosococcus watsonii C-113] gi|300114761|ref|YP_003761336.1| preprotein translocase subunit SecE [Nitrosococcus watsonii C-113] gi|299540686|gb|ADJ29003.1| preprotein translocase, SecE subunit [Nitrosococcus watsonii C-113] gi|299540698|gb|ADJ29015.1| preprotein translocase, SecE subunit [Nitrosococcus watsonii C-113] Length = 115 Score = 53.7 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 34/60 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 A L+F + R E +K+ WP+R E + + ++V++M+ I + + D + W + + G G Sbjct: 55 AALSFAGETRLEFRKVVWPTRQETIRTTLLVLLMVMIMASILWLFDTLLMWAVRLLTGQG 114 >gi|156972591|ref|YP_001443498.1| preprotein translocase subunit SecE [Vibrio harveyi ATCC BAA-1116] gi|156524185|gb|ABU69271.1| hypothetical protein VIBHAR_00231 [Vibrio harveyi ATCC BAA-1116] Length = 126 Score = 53.7 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A ++F K+ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ Sbjct: 65 KGKAAISFAKESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALALWGIDGIMVRLVALAT 124 Query: 64 GI 65 G+ Sbjct: 125 GV 126 >gi|167949632|ref|ZP_02536706.1| preprotein translocase subunit SecE [Endoriftia persephone 'Hot96_1+Hot96_2'] Length = 125 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V F + E +++ WPSR E + + ++V +M+ I + D +GW++ + G Sbjct: 67 TVWQFASDSKVEVRRVVWPSRQETVQTTLIVFVMVLIMGFVLWMFDMMLGWVLRTLTG 124 >gi|262392941|ref|YP_003284795.1| preprotein translocase subunit SecE [Vibrio sp. Ex25] gi|7994688|sp|Q9ZNE7|SECE_VIBAL RecName: Full=Preprotein translocase subunit secE gi|3810893|dbj|BAA34065.1| preprotein translocase SecE subunit [Vibrio alginolyticus] gi|262336535|gb|ACY50330.1| preprotein translocase subunit SecE [Vibrio sp. Ex25] Length = 126 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A ++F K+ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ Sbjct: 65 KGKAAISFAKESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALVLWGIDGIMVRLVALAT 124 Query: 64 GI 65 G+ Sbjct: 125 GV 126 >gi|28899702|ref|NP_799307.1| preprotein translocase subunit SecE [Vibrio parahaemolyticus RIMD 2210633] gi|260878170|ref|ZP_05890525.1| preprotein translocase, SecE subunit [Vibrio parahaemolyticus AN-5034] gi|269965854|ref|ZP_06179948.1| translocase [Vibrio alginolyticus 40B] gi|28807954|dbj|BAC61191.1| preprotein translocase, SecE subunit [Vibrio parahaemolyticus RIMD 2210633] gi|269829518|gb|EEZ83758.1| translocase [Vibrio alginolyticus 40B] gi|308090233|gb|EFO39928.1| preprotein translocase, SecE subunit [Vibrio parahaemolyticus AN-5034] gi|328471077|gb|EGF41983.1| preprotein translocase subunit SecE [Vibrio parahaemolyticus 10329] Length = 126 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A ++F K+ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ Sbjct: 65 KGKAAISFAKESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALVLWGIDGIMVRLVALAT 124 Query: 64 GI 65 G+ Sbjct: 125 GV 126 >gi|261249251|emb|CBG27113.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580] Length = 142 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 76 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 135 Query: 61 FILGI 65 FI G+ Sbjct: 136 FITGL 140 >gi|242241133|ref|YP_002989314.1| preprotein translocase subunit SecE [Dickeya dadantii Ech703] gi|242133190|gb|ACS87492.1| preprotein translocase, SecE subunit [Dickeya dadantii Ech703] Length = 127 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + + + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTSKGKSTVLFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|145628434|ref|ZP_01784235.1| transcription antitermination protein NusG [Haemophilus influenzae 22.1-21] gi|148827884|ref|YP_001292637.1| preprotein translocase subunit SecE [Haemophilus influenzae PittGG] gi|144980209|gb|EDJ89868.1| transcription antitermination protein NusG [Haemophilus influenzae 22.1-21] gi|148719126|gb|ABR00254.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittGG] Length = 138 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 35/60 (58%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF R E++K+ WP+R+E + ++VI + I+S+FF +D I +++F+ + Sbjct: 77 TKARAFFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFLTDL 136 >gi|308188902|ref|YP_003933033.1| preprotein translocase subunit SecE [Pantoea vagans C9-1] gi|308059412|gb|ADO11584.1| Preprotein translocase subunit SecE [Pantoea vagans C9-1] Length = 127 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEMRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|329666016|pdb|3J01|B Chain B, Structure Of The Ribosome-Secye Complex In The Membrane Environment Length = 116 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 50 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 109 Query: 61 FILGI 65 FI G+ Sbjct: 110 FITGL 114 >gi|24115266|ref|NP_709776.1| preprotein translocase subunit SecE [Shigella flexneri 2a str. 301] gi|24054559|gb|AAN45483.1| preprotein translocase [Shigella flexneri 2a str. 301] Length = 127 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R + L + ++V + ++ S+ +D + L+ Sbjct: 61 LSTKGKATIAFAREARTEVRKVIWPTRQKTLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|297537518|ref|YP_003673287.1| preprotein translocase subunit SecE [Methylotenera sp. 301] gi|297256865|gb|ADI28710.1| preprotein translocase, SecE subunit [Methylotenera sp. 301] Length = 115 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 33/56 (58%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F + E++K+ WP+R E + +VV +++ I + F V+D +++ +++G G Sbjct: 59 FIGEAVAEARKVVWPTRKETTQTTMVVFVLVVIMAAFLAVVDIGFAFMVQWLMGRG 114 >gi|227115001|ref|ZP_03828657.1| preprotein translocase subunit SecE [Pectobacterium carotovorum subsp. brasiliensis PBR1692] gi|227328358|ref|ZP_03832382.1| preprotein translocase subunit SecE [Pectobacterium carotovorum subsp. carotovorum WPP14] gi|253686605|ref|YP_003015795.1| preprotein translocase, SecE subunit [Pectobacterium carotovorum subsp. carotovorum PC1] gi|251753183|gb|ACT11259.1| preprotein translocase, SecE subunit [Pectobacterium carotovorum subsp. carotovorum PC1] Length = 127 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|258651254|ref|YP_003200410.1| preprotein translocase subunit SecE [Nakamurella multipartita DSM 44233] gi|258554479|gb|ACV77421.1| preprotein translocase, SecE subunit [Nakamurella multipartita DSM 44233] Length = 168 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 30/67 (44%), Gaps = 4/67 (5%) Query: 2 GVNRLAVL----NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 V + F ++V E +K+ WPSR++++ IVVI ++ V+D Sbjct: 102 AVKKPNPFARLGRFLREVVAELRKVIWPSRNQMVTYTIVVIAFVTFMVALVGVLDLLFAK 161 Query: 58 LMHFILG 64 + + G Sbjct: 162 GVFAVFG 168 >gi|290477022|ref|YP_003469934.1| preprotein translocase membrane protein transport across inner membrane [Xenorhabdus bovienii SS-2004] gi|289176367|emb|CBJ83172.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Xenorhabdus bovienii SS-2004] Length = 127 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 34/63 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 63 AKGKATLAFAREARVEMRKVIWPTRQEALHTTLIVAAVTAVMSLILWGLDGILVRLVSFI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGL 125 >gi|87122750|ref|ZP_01078624.1| preprotein translocase, SecE subunit [Marinomonas sp. MED121] gi|86161978|gb|EAQ63269.1| preprotein translocase, SecE subunit [Marinomonas sp. MED121] Length = 122 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 32/52 (61%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ + E +++ WP+R E + + ++V+ ++ S+ +D +GW++ ++G Sbjct: 71 REAKTEIRRVVWPTRQETVQTTLIVLAVVIFMSLVLWGVDSFLGWVVSSVIG 122 >gi|271962614|ref|YP_003336810.1| hypothetical protein Sros_1067 [Streptosporangium roseum DSM 43021] gi|270505789|gb|ACZ84067.1| hypothetical protein Sros_1067 [Streptosporangium roseum DSM 43021] Length = 82 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 30/63 (47%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 R + F++QV E +K+ WP+R +++ I+V++ + I +D + Sbjct: 18 KAKRTSPALFYRQVVAELRKVIWPTRKDLISYTIIVLVFVLIMVGIVSGLDAVFTEGVLR 77 Query: 62 ILG 64 I G Sbjct: 78 IFG 80 >gi|269962514|ref|ZP_06176862.1| translocase [Vibrio harveyi 1DA3] gi|269832709|gb|EEZ86820.1| translocase [Vibrio harveyi 1DA3] Length = 126 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A ++F K+ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ Sbjct: 65 KGKAAISFAKESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALVLWGIDGIMVRLVALAT 124 Query: 64 GI 65 G+ Sbjct: 125 GV 126 >gi|190151045|ref|YP_001969570.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|303253130|ref|ZP_07339279.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|307248769|ref|ZP_07530782.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|307251012|ref|ZP_07532937.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|307257803|ref|ZP_07539560.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|307262207|ref|ZP_07543857.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|307264408|ref|ZP_07545994.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 13 str. N273] gi|189916176|gb|ACE62428.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|302647812|gb|EFL78019.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|306854696|gb|EFM86886.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|306856952|gb|EFM89083.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|306863709|gb|EFM95635.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|306868081|gb|EFM99907.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|306870224|gb|EFN01982.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 13 str. N273] Length = 137 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 30/55 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 81 FIKESRTELRKIIWPTRPEATQTTLIVLAMCVVVSLVLWGIDSIIVTLVTFLTNL 135 >gi|50119177|ref|YP_048344.1| preprotein translocase subunit SecE [Pectobacterium atrosepticum SCRI1043] gi|49609703|emb|CAG73136.1| preprotein translocase SecE subunit [Pectobacterium atrosepticum SCRI1043] Length = 127 Score = 53.3 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|238790610|ref|ZP_04634375.1| Preprotein translocase subunit secE [Yersinia frederiksenii ATCC 33641] gi|238721279|gb|EEQ12954.1| Preprotein translocase subunit secE [Yersinia frederiksenii ATCC 33641] Length = 97 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 31 MTAKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 90 Query: 61 FILGI 65 FI G+ Sbjct: 91 FITGL 95 >gi|120402245|ref|YP_952074.1| preprotein translocase subunit SecE [Mycobacterium vanbaalenii PYR-1] gi|119955063|gb|ABM12068.1| protein translocase subunit secE/sec61 gamma [Mycobacterium vanbaalenii PYR-1] Length = 147 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V+N+ K+V E +K+ WP+R E+ VV++ L +D +G L+ +I Sbjct: 91 VINYLKEVVGELRKVIWPNRKEMATYTTVVLLFLVFMVALIGGVDLGLGKLVTWIFA 147 >gi|165977152|ref|YP_001652745.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|303249958|ref|ZP_07336160.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|307246642|ref|ZP_07528713.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|307253388|ref|ZP_07535259.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|307255627|ref|ZP_07537432.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|307260078|ref|ZP_07541790.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|165877253|gb|ABY70301.1| preprotein translocase SecE subunit [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|302651021|gb|EFL81175.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306852514|gb|EFM84748.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|306859067|gb|EFM91109.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306861476|gb|EFM93465.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|306865914|gb|EFM97790.1| Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 11 str. 56153] Length = 137 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 30/55 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 81 FIKESRTELRKIIWPTRPEATQTTLIVLAMCVVVSLVLWGIDSIIVTLVTFLTNL 135 >gi|126209180|ref|YP_001054405.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae L20] gi|126097972|gb|ABN74800.1| preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 5b str. L20] Length = 137 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 30/55 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 81 FIKEARTELRKIIWPTRPEATQTTLIVLAMCVVVSLVLWGIDSIIVTLVTFLTNL 135 >gi|332188802|ref|ZP_08390512.1| preprotein translocase, SecE subunit [Sphingomonas sp. S17] gi|332011155|gb|EGI53250.1| preprotein translocase, SecE subunit [Sphingomonas sp. S17] Length = 65 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 41/63 (65%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + FF QV+ E+KK+ WP+R E +++ ++V++M +I ++FFL +D L+ +L Sbjct: 3 KTTPIEFFNQVKTETKKVVWPTRRETVMTGVMVVVMTTILAIFFLAVDSFFETLVRTLLS 62 Query: 65 IGR 67 + + Sbjct: 63 LAK 65 >gi|20808674|ref|NP_623845.1| preprotein translocase subunit SecE [Thermoanaerobacter tengcongensis MB4] gi|20517310|gb|AAM25449.1| Preprotein translocase subunit SecE [Thermoanaerobacter tengcongensis MB4] Length = 66 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 36/64 (56%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M ++ FF++V+ E KK+ WP R ++ VV++++ + ++F ++D +++ Sbjct: 1 MAGEGRKIVKFFREVKAEMKKVTWPGRDTMITYTEVVLVVMVLFTIFIFLVDSVFSYILK 60 Query: 61 FILG 64 IL Sbjct: 61 LILK 64 >gi|288554710|ref|YP_003426645.1| preprotein translocase subunit, secE [Bacillus pseudofirmus OF4] gi|288545870|gb|ADC49753.1| preprotein translocase subunit, secE [Bacillus pseudofirmus OF4] Length = 64 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 20/64 (31%), Positives = 34/64 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M + FFK V E K++ WP+R E+ VV+ ++ +VFF ++D I ++ Sbjct: 1 MAGGEKNIGKFFKDVVLEMKRVSWPTRKELTRYTWVVLGTVAFITVFFAIVDYGISSVVR 60 Query: 61 FILG 64 +LG Sbjct: 61 LLLG 64 >gi|46581326|ref|YP_012134.1| preprotein translocase subunit SecE [Desulfovibrio vulgaris str. Hildenborough] gi|120601495|ref|YP_965895.1| preprotein translocase subunit SecE [Desulfovibrio vulgaris DP4] gi|46450748|gb|AAS97394.1| preprotein translocase, SecE subunit [Desulfovibrio vulgaris str. Hildenborough] gi|120561724|gb|ABM27468.1| protein translocase subunit secE/sec61 gamma [Desulfovibrio vulgaris DP4] gi|311234986|gb|ADP87840.1| preprotein translocase, SecE subunit [Desulfovibrio vulgaris RCH1] Length = 83 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 34/64 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 +G ++ ++ + E +K+ WP+R E + + V++ + + S+F +D + L+ Sbjct: 20 LGDKVTQFRDYVEEAKVELRKVSWPTRKEAWATSMTVLVFVFVMSLFLGFVDLGLTHLIE 79 Query: 61 FILG 64 FIL Sbjct: 80 FILS 83 >gi|223041759|ref|ZP_03611952.1| preprotein translocase subunit SecE [Actinobacillus minor 202] gi|240948038|ref|ZP_04752455.1| preprotein translocase subunit SecE [Actinobacillus minor NM305] gi|223017443|gb|EEF15861.1| preprotein translocase subunit SecE [Actinobacillus minor 202] gi|240297654|gb|EER48131.1| preprotein translocase subunit SecE [Actinobacillus minor NM305] Length = 135 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 30/55 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 81 FAKESRTELRKIIWPTRPEATQTTLIVLAMCVVVSLVLWGIDSLIVALITFLTNL 135 >gi|296268524|ref|YP_003651156.1| preprotein translocase subunit SecE [Thermobispora bispora DSM 43833] gi|296091311|gb|ADG87263.1| preprotein translocase, SecE subunit [Thermobispora bispora DSM 43833] Length = 85 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 33/63 (52%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 R + + F++QV E +K+ WP R+E++ VV++ + I +D +G ++ Sbjct: 21 KAKRTSPVLFYRQVVAELRKVIWPRRNELITYTAVVLVFVLIMVGIVFGLDTLMGKVVLM 80 Query: 62 ILG 64 + G Sbjct: 81 VFG 83 >gi|256380625|ref|YP_003104285.1| preprotein translocase, SecE subunit [Actinosynnema mirum DSM 43827] gi|255924928|gb|ACU40439.1| preprotein translocase, SecE subunit [Actinosynnema mirum DSM 43827] Length = 136 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 29/56 (51%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + ++V E +K+ WP+R +++ VV++ ++ + +D + + ++ G Sbjct: 81 FRYIREVVGELRKVIWPTRKQMVTYTSVVLVFVAFMTALVFGLDIAFAEGVFWLFG 136 >gi|215489313|ref|YP_002331744.1| preprotein translocase subunit SecE [Escherichia coli O127:H6 str. E2348/69] gi|215267385|emb|CAS11836.1| preprotein translocase membrane subunit [Escherichia coli O127:H6 str. E2348/69] Length = 127 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 34/65 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVALAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|183980991|ref|YP_001849282.1| preprotein translocase (tail-anchored membrane protein), SecE [Mycobacterium marinum M] gi|183174317|gb|ACC39427.1| preprotein translocase (tail-anchored membrane protein), SecE [Mycobacterium marinum M] Length = 162 Score = 52.9 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R ++L VV++ L+ D + LM + G Sbjct: 106 VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLVFLAFMVALVGSADLGLSKLMLLVFG 162 >gi|197286620|ref|YP_002152492.1| preprotein translocase subunit SecE [Proteus mirabilis HI4320] gi|227355187|ref|ZP_03839596.1| preprotein translocase SecE subunit [Proteus mirabilis ATCC 29906] gi|194684107|emb|CAR45506.1| preprotein translocase SecE subunit [Proteus mirabilis HI4320] gi|227164696|gb|EEI49550.1| preprotein translocase SecE subunit [Proteus mirabilis ATCC 29906] Length = 125 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E L + ++V + +I S+ +D + L+ FI G+ Sbjct: 67 ATLAFAREARIEMRKVVWPTRQETLQTTLIVAAVTAIVSLVLWGLDGILVRLVSFITGL 125 >gi|301154975|emb|CBW14438.1| preprotein translocase membrane subunit [Haemophilus parainfluenzae T3T1] Length = 138 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 35/60 (58%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF + + E +K+ WP+R+E + ++VI + ++S+FF ID I L++F+ + Sbjct: 77 TKARTFFSEAKVEGRKVVWPTRAETRQTTLIVIGVTVLTSLFFWAIDSIIIALINFLTDL 136 >gi|118616513|ref|YP_904845.1| preprotein translocase subunit SecE [Mycobacterium ulcerans Agy99] gi|118568623|gb|ABL03374.1| preprotein translocase (tail-anchored membrane protein), SecE [Mycobacterium ulcerans Agy99] Length = 162 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R ++L VV++ L+ D + LM + G Sbjct: 106 VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLVFLAFMVALVGSADLGLSKLMLLVFG 162 >gi|268592955|ref|ZP_06127176.1| preprotein translocase, SecE subunit [Providencia rettgeri DSM 1131] gi|291311426|gb|EFE51879.1| preprotein translocase, SecE subunit [Providencia rettgeri DSM 1131] Length = 128 Score = 52.9 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 33/62 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 64 KGKATLAFAREARVEMRKVIWPTRQETLQTTLIVAAVTAVMSLILWGLDGILVRLVSFIT 123 Query: 64 GI 65 + Sbjct: 124 SL 125 >gi|226305204|ref|YP_002765162.1| preprotein translocase SecE subunit [Rhodococcus erythropolis PR4] gi|226184319|dbj|BAH32423.1| probable preprotein translocase SecE subunit [Rhodococcus erythropolis PR4] Length = 127 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF++V E +K+ WP+R +++ VV+ + F +D ++ + ++ G Sbjct: 73 KFFREVIAELRKVIWPNRKQMITYTSVVLTFVVFMVAFISGVDIAVIKGVTWLFG 127 >gi|323705647|ref|ZP_08117221.1| preprotein translocase, SecE subunit [Thermoanaerobacterium xylanolyticum LX-11] gi|323535124|gb|EGB24901.1| preprotein translocase, SecE subunit [Thermoanaerobacterium xylanolyticum LX-11] Length = 66 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 34/60 (56%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R V FF++++ E KK+ WP+R ++ VV++++ ++ + D + +L+ I+ Sbjct: 6 RRKVGKFFREIKAEMKKVTWPTRDNLIAYTEVVLVVVIAFTLLIFLADSAFSYLLKLIIK 65 >gi|313835993|gb|EFS73707.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL037PA2] gi|314929669|gb|EFS93500.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL044PA1] gi|314970508|gb|EFT14606.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL037PA3] gi|328906261|gb|EGG26036.1| putative SecE/Sec61-gamma subunit of protein translocation complex [Propionibacterium sp. P08] Length = 215 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 30/60 (50%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R + F KQ E +K+ WP+ E+ IVV++ + + + +D GW++ + G Sbjct: 155 RAGPVIFTKQSVAELRKVKWPTGDELGQYFIVVLVFVLLIIAYVSSLDVLFGWIVIKLFG 214 >gi|270160342|ref|ZP_06188995.1| preprotein translocase SecE subunit [Legionella longbeachae D-4968] gi|289163817|ref|YP_003453955.1| Preprotein translocase secE subunit [Legionella longbeachae NSW150] gi|269987154|gb|EEZ93412.1| preprotein translocase SecE subunit [Legionella longbeachae D-4968] gi|288856990|emb|CBJ10804.1| Preprotein translocase secE subunit [Legionella longbeachae NSW150] Length = 123 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 33/60 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 V +F ++ + E K+ WP+R E + + +VI+M++++ +D + W + I +G Sbjct: 64 KVYHFAQESKVELLKVVWPTRQETVQTTTIVIVMVTLTGFILWGVDSIMMWAIAKITHLG 123 >gi|240169412|ref|ZP_04748071.1| preprotein translocase subunit SecE [Mycobacterium kansasii ATCC 12478] Length = 171 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R +++ VV++ L+ D +G L+ + G Sbjct: 115 VYNYIKQVVAEMRKVIWPNRRQMITYTSVVLVFLAFMVALVGGADLGLGRLVMLVFG 171 >gi|16762306|ref|NP_457923.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|16767401|ref|NP_463016.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|29143794|ref|NP_807136.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|56415974|ref|YP_153049.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|62182601|ref|YP_219018.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|161505372|ref|YP_001572484.1| preprotein translocase subunit SecE [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|161617283|ref|YP_001591248.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|167554341|ref|ZP_02348082.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|168264793|ref|ZP_02686766.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|194444349|ref|YP_002043399.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194449614|ref|YP_002048134.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194469508|ref|ZP_03075492.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194735761|ref|YP_002117050.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197248847|ref|YP_002149058.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197364901|ref|YP_002144538.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|198242551|ref|YP_002218064.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|200386796|ref|ZP_03213408.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|205354450|ref|YP_002228251.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|207859325|ref|YP_002245976.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|213022867|ref|ZP_03337314.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] gi|213163866|ref|ZP_03349576.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] gi|213417732|ref|ZP_03350852.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. E01-6750] gi|213425732|ref|ZP_03358482.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. E02-1180] gi|213623115|ref|ZP_03375898.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068] gi|213650882|ref|ZP_03380935.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. J185] gi|213852741|ref|ZP_03382273.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. M223] gi|224585689|ref|YP_002639488.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|238913726|ref|ZP_04657563.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] gi|289826707|ref|ZP_06545672.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. E98-3139] gi|61242522|sp|P0A2D3|SECE_SALTY RecName: Full=Preprotein translocase subunit secE gi|61242527|sp|P0A2D4|SECE_SALTI RecName: Full=Preprotein translocase subunit secE gi|25301348|pir||AC0934 preprotein translocase SecE chain [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gi|6960334|gb|AAF33494.1| 96% identity over 127 amino acids with E. coli protein-export protein (SECE) (SW:P16920); contains similarity to Pfam domain PF00584 (SecE), Score=96.3, E=6,2e-25, N=1 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|16422704|gb|AAL22975.1| preprotein translocase IISP family, membrane subunit [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|16504610|emb|CAD09493.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Typhi] gi|29139429|gb|AAO70996.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|56130231|gb|AAV79737.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|62130234|gb|AAX67937.1| preprotein translocase IISP family, membrane subunit [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|160866719|gb|ABX23342.1| hypothetical protein SARI_03517 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] gi|161366647|gb|ABX70415.1| hypothetical protein SPAB_05134 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|194403012|gb|ACF63234.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194407918|gb|ACF68137.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194455872|gb|EDX44711.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194711263|gb|ACF90484.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197096378|emb|CAR61983.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|197212550|gb|ACH49947.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197937067|gb|ACH74400.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|199603894|gb|EDZ02439.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|205274231|emb|CAR39250.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|205321447|gb|EDZ09286.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|205346819|gb|EDZ33450.1| preprotein translocase subunit secE [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|206711128|emb|CAR35502.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|224470217|gb|ACN48047.1| translocase [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|267996445|gb|ACY91330.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] gi|301160643|emb|CBW20174.1| preprotein translocase SecE subunit [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|312915252|dbj|BAJ39226.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240] gi|320088578|emb|CBY98337.1| Preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] gi|321223347|gb|EFX48414.1| Preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] gi|322616257|gb|EFY13167.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] gi|322617300|gb|EFY14202.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] gi|322625928|gb|EFY22743.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] gi|322626674|gb|EFY23476.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] gi|322631509|gb|EFY28266.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] gi|322635222|gb|EFY31940.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] gi|322642611|gb|EFY39205.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] gi|322646784|gb|EFY43288.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] gi|322650783|gb|EFY47176.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675] gi|322655918|gb|EFY52219.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] gi|322657317|gb|EFY53596.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] gi|322665579|gb|EFY61764.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] gi|322669762|gb|EFY65907.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] gi|322670959|gb|EFY67091.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] gi|322679217|gb|EFY75270.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] gi|322679375|gb|EFY75422.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] gi|322688142|gb|EFY84106.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] gi|322717097|gb|EFZ08668.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] gi|323132482|gb|ADX19912.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] gi|323193410|gb|EFZ78620.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] gi|323200670|gb|EFZ85743.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] gi|323202159|gb|EFZ87215.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] gi|323209270|gb|EFZ94205.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] gi|323211595|gb|EFZ96432.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] gi|323218067|gb|EGA02780.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] gi|323221356|gb|EGA05778.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] gi|323225717|gb|EGA09938.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] gi|323230995|gb|EGA15112.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] gi|323235777|gb|EGA19859.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] gi|323240091|gb|EGA24137.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] gi|323242576|gb|EGA26598.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] gi|323249716|gb|EGA33623.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] gi|323252599|gb|EGA36440.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] gi|323256907|gb|EGA40619.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283] gi|323262071|gb|EGA45635.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] gi|323263924|gb|EGA47438.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] gi|323268463|gb|EGA51933.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287] gi|326625857|gb|EGE32202.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Dublin str. 3246] gi|326629583|gb|EGE35926.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Gallinarum str. 9] Length = 127 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|283787346|ref|YP_003367211.1| preprotein translocase SecE subunit [Citrobacter rodentium ICC168] gi|282950800|emb|CBG90476.1| preprotein translocase SecE subunit [Citrobacter rodentium ICC168] Length = 127 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|289579159|ref|YP_003477786.1| preprotein translocase, SecE subunit [Thermoanaerobacter italicus Ab9] gi|289528872|gb|ADD03224.1| preprotein translocase, SecE subunit [Thermoanaerobacter italicus Ab9] Length = 65 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 34/65 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M + FFK VR E KK+ WPS+ ++ +V+I + +VF +ID +L+ Sbjct: 1 MAGEGRKFVKFFKDVRAEMKKVTWPSKESMITYTEIVLIAMVFFTVFIFLIDSVFSYLLK 60 Query: 61 FILGI 65 I+ + Sbjct: 61 LIIKV 65 >gi|304415280|ref|ZP_07395975.1| preprotein translocase subunit E [Candidatus Regiella insecticola LSR1] gi|304282870|gb|EFL91338.1| preprotein translocase subunit E [Candidatus Regiella insecticola LSR1] Length = 127 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 36/63 (57%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V A + F ++ R E +K+ WP+R E L + ++V ++ ++ S+ +D + L+ FI Sbjct: 63 VKGKASVGFAREARTEMRKVIWPTRQEALQTTLIVAVVTAVMSLILWGLDGILIHLVSFI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGL 125 >gi|262273345|ref|ZP_06051160.1| preprotein translocase subunit SecE [Grimontia hollisae CIP 101886] gi|262222718|gb|EEY74028.1| preprotein translocase subunit SecE [Grimontia hollisae CIP 101886] Length = 123 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 33/62 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A + F ++ R E +K+ WP+R E L + ++V+ + + ++ ID + L+ I Sbjct: 62 KGKAAITFARESRMEVRKVVWPTRQETLQTTLIVLAVTVVMALILWGIDGIMVRLVRLIT 121 Query: 64 GI 65 G+ Sbjct: 122 GV 123 >gi|145642381|ref|ZP_01797941.1| transcription antitermination protein NusG [Haemophilus influenzae R3021] gi|145272924|gb|EDK12810.1| transcription antitermination protein NusG [Haemophilus influenzae 22.4-21] Length = 138 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 35/60 (58%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF R E++K+ WP+R+E + ++VI + I+S+FF +D I +++F+ + Sbjct: 77 TKARAFFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFLTDL 136 >gi|160872765|ref|ZP_02062897.1| preprotein translocase, SecE subunit [Rickettsiella grylli] gi|159121564|gb|EDP46902.1| preprotein translocase, SecE subunit [Rickettsiella grylli] Length = 104 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 32/52 (61%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F + R E +K+ WP+R E + + ++VI+M+ ++ +F ID + W + F+ Sbjct: 51 FAQASRAELRKVVWPTREETIRTTLIVIVMVIVAGLFLWAIDTLLLWAVAFL 102 >gi|186685894|ref|YP_001869090.1| preprotein translocase subunit SecE [Nostoc punctiforme PCC 73102] gi|186468346|gb|ACC84147.1| preprotein translocase, SecE subunit [Nostoc punctiforme PCC 73102] Length = 73 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 33/60 (55%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 N ++ NF + ++E K+ WPSR +++ V++M+++S+ ++D GW + Sbjct: 14 NGFSLGNFIQGTKEELDKVVWPSRKQIVSESAAVLLMVALSASLIYLVDGLFGWAAKQVF 73 >gi|307128973|ref|YP_003880989.1| preprotein translocase membrane subunit [Dickeya dadantii 3937] gi|306526502|gb|ADM96432.1| preprotein translocase membrane subunit [Dickeya dadantii 3937] Length = 127 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVLFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|269469124|gb|EEZ80672.1| hypothetical protein Sup05_0529 [uncultured SUP05 cluster bacterium] Length = 129 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 12/48 (25%), Positives = 28/48 (58%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 FFK+ + E +K+ WP+R E + + ++++ + I ++F ++D Sbjct: 70 FFKETKIELRKVVWPNREETVKTTGMIMVAVVIVAIFLWIVDAFFTLG 117 >gi|83754006|pdb|2AKH|Z Chain Z, Normal Mode-Based Flexible Fitted Coordinates Of A Non- Translocating Secyeg Protein-Conducting Channel Into The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome Complex From E. Coli gi|83754009|pdb|2AKH|C Chain C, Normal Mode-Based Flexible Fitted Coordinates Of A Non- Translocating Secyeg Protein-Conducting Channel Into The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome Complex From E. Coli gi|83754012|pdb|2AKI|Z Chain Z, Normal Mode-Based Flexible Fitted Coordinates Of A Translocating Secyeg Protein-Conducting Channel Into The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome Complex From E. Coli gi|83754015|pdb|2AKI|C Chain C, Normal Mode-Based Flexible Fitted Coordinates Of A Translocating Secyeg Protein-Conducting Channel Into The Cryo-Em Map Of A Secyeg-Nascent Chain-70s Ribosome Complex From E. Coli Length = 111 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 45 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 104 Query: 61 FILGI 65 FI G+ Sbjct: 105 FITGL 109 >gi|226328677|ref|ZP_03804195.1| hypothetical protein PROPEN_02572 [Proteus penneri ATCC 35198] gi|225201863|gb|EEG84217.1| hypothetical protein PROPEN_02572 [Proteus penneri ATCC 35198] Length = 125 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 33/59 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A L F ++ R E +K+ WP+R E L + ++V + +I S+ +D + + FI G+ Sbjct: 67 ATLAFAREARIEMRKVVWPTRQETLQTTLIVAAVTAIVSLVLWGLDGILVRFVSFITGL 125 >gi|254283529|ref|ZP_04958497.1| preprotein translocase, SecE subunit [gamma proteobacterium NOR51-B] gi|219679732|gb|EED36081.1| preprotein translocase, SecE subunit [gamma proteobacterium NOR51-B] Length = 137 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 32/62 (51%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V A + K R E +K+ WP+R E + ++V++ + + ++ +D +GW+ Sbjct: 76 VKGGAFWSLVKGARTEIRKVVWPTRQETTQTTLIVVVFVIVMALILWALDSLLGWVASMF 135 Query: 63 LG 64 +G Sbjct: 136 IG 137 >gi|217076741|ref|YP_002334457.1| preprotein translocase, SecE subunit [Thermosipho africanus TCF52B] gi|217036594|gb|ACJ75116.1| preprotein translocase, SecE subunit [Thermosipho africanus TCF52B] Length = 62 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF++V+ E KK WP+R E+ + VV+++L ++ V+F +D + + Sbjct: 6 KFFREVKTEIKKTHWPNRKELWGATGVVLVILLVTGVYFFALDLIFSGALSALFK 60 >gi|167629452|ref|YP_001679951.1| sece subunit of protein translocation complex, putative [Heliobacterium modesticaldum Ice1] gi|167592192|gb|ABZ83940.1| sece subunit of protein translocation complex, putative [Heliobacterium modesticaldum Ice1] Length = 105 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NF + V E KK+ WP+R EV+ VV+ + + V+D+++ + ++ Sbjct: 51 NFARGVASEMKKVHWPTRQEVITYTGVVLTAVVFVAALIFVVDEALSLTLKALIK 105 >gi|15643218|ref|NP_228262.1| preprotein translocase SecE subunit [Thermotoga maritima MSB8] gi|148269608|ref|YP_001244068.1| preprotein translocase, SecE subunit [Thermotoga petrophila RKU-1] gi|170288284|ref|YP_001738522.1| preprotein translocase, SecE subunit [Thermotoga sp. RQ2] gi|281411674|ref|YP_003345753.1| preprotein translocase, SecE subunit [Thermotoga naphthophila RKU-10] gi|548915|sp|P35874|SECE_THEMA RecName: Full=Preprotein translocase subunit secE gi|209156623|pdb|3DIN|D Chain D, Crystal Structure Of The Protein-Translocation Complex Formed By The Secy Channel And The Seca Atpase gi|209156627|pdb|3DIN|G Chain G, Crystal Structure Of The Protein-Translocation Complex Formed By The Secy Channel And The Seca Atpase gi|4980958|gb|AAD35535.1|AE001723_5 preprotein translocase SecE subunit [Thermotoga maritima MSB8] gi|407023|emb|CAA77865.1| SecE [Thermotoga maritima MSB8] gi|147735152|gb|ABQ46492.1| protein translocase subunit secE/sec61 gamma [Thermotoga petrophila RKU-1] gi|170175787|gb|ACB08839.1| preprotein translocase, SecE subunit [Thermotoga sp. RQ2] gi|281372777|gb|ADA66339.1| preprotein translocase, SecE subunit [Thermotoga naphthophila RKU-10] Length = 65 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 23/55 (41%), Positives = 37/55 (67%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF++V E+KKI WPSR E+L S VV+++L+++SV+F V+D ++ I Sbjct: 6 KFFREVIAEAKKISWPSRKELLTSFGVVLVILAVTSVYFFVLDFIFSGVVSAIFK 60 >gi|133872294|gb|ABO40214.1| preprotein translocase [Candidatus Liberibacter americanus] Length = 65 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 35/60 (58%), Positives = 48/60 (80%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 +A+L+F K V+ E KKI WPSR+EV+VS I+V+IML +SSVFFL++D IG +M FIL + Sbjct: 5 MALLDFLKNVKIEVKKIIWPSRNEVVVSAILVMIMLVVSSVFFLMVDHFIGSIMSFILYV 64 >gi|145639476|ref|ZP_01795081.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittII] gi|145271523|gb|EDK11435.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittII] Length = 138 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 35/60 (58%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF R E++K+ WP+R+E + ++VI + I+S+FF +D I +++F+ + Sbjct: 77 TKARAFFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFLTDL 136 >gi|303239008|ref|ZP_07325538.1| preprotein translocase, SecE subunit [Acetivibrio cellulolyticus CD2] gi|302593346|gb|EFL63064.1| preprotein translocase, SecE subunit [Acetivibrio cellulolyticus CD2] Length = 74 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 30/59 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + FFK +R E KK+ WP+R +V+ + V+I + + + D G+L + I Sbjct: 16 KIGKFFKDIRSELKKVVWPTRVQVVKNTATVLIACFLVGIIIWLADAGFGYLRTLVFKI 74 >gi|302336398|ref|YP_003801605.1| preprotein translocase, SecE subunit [Olsenella uli DSM 7084] gi|301320238|gb|ADK68725.1| preprotein translocase, SecE subunit [Olsenella uli DSM 7084] Length = 124 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 29/62 (46%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + ++ +VR E ++ WPSR E+ + VI ML + + ++D + Sbjct: 61 KKGRIGSYLSEVRAEMHRVVWPSRPELKNYSVAVIAMLIVFGIVIWLVDTGFVAALVGFT 120 Query: 64 GI 65 G+ Sbjct: 121 GL 122 >gi|255067814|ref|ZP_05319669.1| preprotein translocase, SecE subunit [Neisseria sicca ATCC 29256] gi|255047905|gb|EET43369.1| preprotein translocase, SecE subunit [Neisseria sicca ATCC 29256] Length = 90 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 32/55 (58%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 R +L++FK E KK+ WP+R + + + V+I ++I +VF D +I WL Sbjct: 27 KREGLLSYFKNSWSEFKKVVWPTRDDAVKMTVFVVIFVAILAVFIYAADSAISWL 81 >gi|157363335|ref|YP_001470102.1| preprotein translocase, SecE subunit [Thermotoga lettingae TMO] gi|157313939|gb|ABV33038.1| preprotein translocase, SecE subunit [Thermotoga lettingae TMO] Length = 65 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FF++V E+KK WPSR+E+L S VV+++L + V+F V+D + L Sbjct: 3 KIKKFFREVAAEAKKTHWPSRNELLTSTSVVVLILVVMGVYFFVLDMVFSGAIRTFLK 60 >gi|271498786|ref|YP_003331811.1| preprotein translocase subunit SecE [Dickeya dadantii Ech586] gi|270342341|gb|ACZ75106.1| preprotein translocase, SecE subunit [Dickeya dadantii Ech586] Length = 127 Score = 52.1 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVLFVREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|119485149|ref|ZP_01619534.1| translocase [Lyngbya sp. PCC 8106] gi|119457377|gb|EAW38502.1| translocase [Lyngbya sp. PCC 8106] Length = 74 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 32/58 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V++FFK+ ++E K+ WPSR ++ V++M+ +S+ ++D W + G Sbjct: 17 NVVDFFKETKEELDKVVWPSRQQLFSESAGVLLMIMLSATLIYLVDNIFRWASGQVFG 74 >gi|251791449|ref|YP_003006170.1| preprotein translocase subunit SecE [Dickeya zeae Ech1591] gi|247540070|gb|ACT08691.1| preprotein translocase, SecE subunit [Dickeya zeae Ech1591] Length = 127 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVLFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|52840561|ref|YP_094360.1| preprotein translocase subunit SecE [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|54296352|ref|YP_122721.1| preprotein translocase subunit SecE [Legionella pneumophila str. Paris] gi|52627672|gb|AAU26413.1| preprotein translocase, SecE subunit [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|53750137|emb|CAH11529.1| Preprotein translocase secE subunit [Legionella pneumophila str. Paris] Length = 123 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 31/59 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 V F ++ + E K+ WP+R E + + +V++M+ ++ +D + W + + +G Sbjct: 65 VFVFAQEAKVELLKVVWPTRQETIQTTTIVMVMVGLTGFILWGVDSIMMWAIAKLTHLG 123 >gi|317153970|ref|YP_004122018.1| preprotein translocase subunit SecE [Desulfovibrio aespoeensis Aspo-2] gi|316944221|gb|ADU63272.1| preprotein translocase, SecE subunit [Desulfovibrio aespoeensis Aspo-2] Length = 85 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 34/56 (60%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++ + E KK+ WP+R E + + + V+I+ + +++ ++D ++ ++ IL Sbjct: 30 IEFLEESKVEIKKVVWPTRKETITTCVAVLIVSLVVALYLGIVDLALSKIVEAILS 85 >gi|54293308|ref|YP_125723.1| preprotein translocase subunit SecE [Legionella pneumophila str. Lens] gi|53753140|emb|CAH14587.1| Preprotein translocase secE subunit [Legionella pneumophila str. Lens] Length = 123 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 31/59 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 V F ++ + E K+ WP+R E + + +V++M+ ++ +D + W + + +G Sbjct: 65 VFVFAQEAKVELLKVVWPTRQETIQTTTIVMVMVGLTGFILWGVDSIMMWAIAKLTHLG 123 >gi|68249292|ref|YP_248404.1| preprotein translocase subunit SecE [Haemophilus influenzae 86-028NP] gi|145633843|ref|ZP_01789565.1| transcription antitermination protein NusG [Haemophilus influenzae 3655] gi|145635954|ref|ZP_01791639.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittAA] gi|145637967|ref|ZP_01793606.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittHH] gi|148826640|ref|YP_001291393.1| preprotein translocase subunit SecE [Haemophilus influenzae PittEE] gi|229845549|ref|ZP_04465677.1| preprotein translocase subunit SecE [Haemophilus influenzae 6P18H1] gi|229847176|ref|ZP_04467280.1| preprotein translocase subunit SecE [Haemophilus influenzae 7P49H1] gi|260581526|ref|ZP_05849334.1| transcription antitermination protein NusG [Haemophilus influenzae RdAW] gi|260583373|ref|ZP_05851144.1| transcription antitermination protein NusG [Haemophilus influenzae NT127] gi|319775443|ref|YP_004137931.1| preprotein translocase SecE [Haemophilus influenzae F3047] gi|319897849|ref|YP_004136046.1| preprotein translocase sece [Haemophilus influenzae F3031] gi|329122527|ref|ZP_08251111.1| preprotein translocase [Haemophilus aegyptius ATCC 11116] gi|68057491|gb|AAX87744.1| preprotein translocase SecE [Haemophilus influenzae 86-028NP] gi|144985285|gb|EDJ92124.1| transcription antitermination protein NusG [Haemophilus influenzae 3655] gi|145266787|gb|EDK06806.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittAA] gi|145268833|gb|EDK08797.1| ATP-dependent protease ATP-binding subunit [Haemophilus influenzae PittHH] gi|148716800|gb|ABQ99010.1| transcription antitermination protein NusG [Haemophilus influenzae PittEE] gi|229809852|gb|EEP45574.1| preprotein translocase subunit SecE [Haemophilus influenzae 7P49H1] gi|229811565|gb|EEP47266.1| preprotein translocase subunit SecE [Haemophilus influenzae 6P18H1] gi|260091824|gb|EEW75779.1| transcription antitermination protein NusG [Haemophilus influenzae RdAW] gi|260093578|gb|EEW77495.1| transcription antitermination protein NusG [Haemophilus influenzae NT127] gi|301169434|emb|CBW29034.1| preprotein translocase membrane subunit [Haemophilus influenzae 10810] gi|309751685|gb|ADO81669.1| Probable preprotein translocase SecE subunit [Haemophilus influenzae R2866] gi|317433355|emb|CBY81734.1| preprotein translocase SecE [Haemophilus influenzae F3031] gi|317450034|emb|CBY86248.1| preprotein translocase SecE [Haemophilus influenzae F3047] gi|327473156|gb|EGF18579.1| preprotein translocase [Haemophilus aegyptius ATCC 11116] Length = 138 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 35/60 (58%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF R E++K+ WP+R+E + ++VI + I+S+FF +D I +++F+ + Sbjct: 77 TKARAFFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFLTDL 136 >gi|269128552|ref|YP_003301922.1| preprotein translocase subunit SecE [Thermomonospora curvata DSM 43183] gi|268313510|gb|ACY99884.1| preprotein translocase, SecE subunit [Thermomonospora curvata DSM 43183] Length = 84 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 32/61 (52%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R + + F +Q+ E +K+ WP+RSE++ +V ++ + + F +D + + + Sbjct: 24 KRTSPVLFVRQIIAELRKVIWPTRSELINYTLVSLVFVLVMMAFVAGLDWGLQKGVFAVF 83 Query: 64 G 64 G Sbjct: 84 G 84 >gi|257095053|ref|YP_003168694.1| preprotein translocase subunit SecE [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] gi|257047577|gb|ACV36765.1| preprotein translocase, SecE subunit [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] Length = 117 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 29/49 (59%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 F K+ E+KK+ WPSR E + + +V + + ++F + D+ + W++ Sbjct: 59 FAKEASTEAKKVVWPSRKETMQTTGLVFAFVVVMALFLWLTDKGLEWVL 107 >gi|260596080|ref|YP_003208651.1| preprotein translocase subunit SecE [Cronobacter turicensis z3032] gi|260215257|emb|CBA27160.1| Preprotein translocase subunit secE [Cronobacter turicensis z3032] Length = 127 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|83749363|ref|ZP_00946359.1| Protein translocase subunit secE [Ralstonia solanacearum UW551] gi|207721924|ref|YP_002252362.1| preprotein translocase (sece subunit) [Ralstonia solanacearum MolK2] gi|83723988|gb|EAP71170.1| Protein translocase subunit secE [Ralstonia solanacearum UW551] gi|206587094|emb|CAQ17678.1| preprotein translocase (sece subunit) [Ralstonia solanacearum MolK2] Length = 126 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM-HFILG 64 L F ++ E +K+ WP+R E +V + I +VF D+ I W++ +LG Sbjct: 68 LEFARESYREVRKVVWPTRKESGQMTGLVFAFVVIMAVFLWSADKLIEWVIFSLVLG 124 >gi|254412608|ref|ZP_05026381.1| preprotein translocase, SecE subunit [Microcoleus chthonoplastes PCC 7420] gi|196180343|gb|EDX75334.1| preprotein translocase, SecE subunit [Microcoleus chthonoplastes PCC 7420] Length = 76 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 32/63 (50%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + V+ F ++ ++E K+ WPSR +++ V++M+ +S+ ++D W Sbjct: 14 KTSGFNVVTFLQETKEELSKVVWPSRQQLISESAAVLLMVVLSATLIYLVDGLFLWASQQ 73 Query: 62 ILG 64 + G Sbjct: 74 VFG 76 >gi|326793545|ref|YP_004311365.1| preprotein translocase, SecE subunit [Marinomonas mediterranea MMB-1] gi|326544309|gb|ADZ89529.1| preprotein translocase, SecE subunit [Marinomonas mediterranea MMB-1] Length = 122 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 34/62 (54%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V A K+ + E ++ WP+R E + + ++V+ ++ S+ +D ++GW++ + Sbjct: 61 VKGKAFFTLAKEAKKEIGRVVWPTRQETVQTTLIVLAVVIFMSLVLWGVDSALGWVVSAV 120 Query: 63 LG 64 +G Sbjct: 121 IG 122 >gi|163839735|ref|YP_001624140.1| preprotein translocase subunit SecE [Renibacterium salmoninarum ATCC 33209] gi|162953211|gb|ABY22726.1| protein translocase subunit [Renibacterium salmoninarum ATCC 33209] Length = 98 Score = 51.7 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 31/57 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QV E +K+ P+R E++ IVV++ + I V+D + G+ ++ G Sbjct: 35 IALFVRQVIGELRKVVTPTRKELINYTIVVLVFVIIMMAIIWVLDFAFGFGAGWLFG 91 >gi|300702759|ref|YP_003744360.1| preprotein translocase membrane subunit [Ralstonia solanacearum CFBP2957] gi|299070421|emb|CBJ41716.1| preprotein translocase membrane subunit [Ralstonia solanacearum CFBP2957] Length = 126 Score = 51.7 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM-HFILG 64 L F ++ E +K+ WP+R E +V + I +VF D+ I W++ +LG Sbjct: 68 LEFARESYREVRKVVWPTRKEAGQMTGLVFAFVVIMAVFLWSADKLIEWVIFSLVLG 124 >gi|254361448|ref|ZP_04977588.1| possible Sec family Type II general secretory pathway preprotein translocase SecE subunit [Mannheimia haemolytica PHL213] gi|261491949|ref|ZP_05988526.1| putative Sec family Type II general secretory pathway preprotein translocase SecE subunit [Mannheimia haemolytica serotype A2 str. BOVINE] gi|261496248|ref|ZP_05992653.1| putative Sec family Type II general secretory pathway preprotein translocase SecE subunit [Mannheimia haemolytica serotype A2 str. OVINE] gi|153092958|gb|EDN73984.1| possible Sec family Type II general secretory pathway preprotein translocase SecE subunit [Mannheimia haemolytica PHL213] gi|261308079|gb|EEY09377.1| putative Sec family Type II general secretory pathway preprotein translocase SecE subunit [Mannheimia haemolytica serotype A2 str. OVINE] gi|261312416|gb|EEY13542.1| putative Sec family Type II general secretory pathway preprotein translocase SecE subunit [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 137 Score = 51.7 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 79 IHFIKESRTELRKIIWPTRPEATQTTLIVLAMCVVVSLVLWGIDSIIVALITFVTSL 135 >gi|292492408|ref|YP_003527847.1| preprotein translocase subunit SecE [Nitrosococcus halophilus Nc4] gi|291581003|gb|ADE15460.1| preprotein translocase, SecE subunit [Nitrosococcus halophilus Nc4] Length = 112 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A L+F + R E +K+ WPSR E + + ++V++M+ + + + D + W++ + G Sbjct: 55 AALSFAGETRTEFRKVVWPSRQETIRTTLIVLLMVMVMASILWLFDTLLMWIVRLLTG 112 >gi|239993446|ref|ZP_04713970.1| Preprotein translocase subunit SecE [Alteromonas macleodii ATCC 27126] Length = 125 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 33/63 (52%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F K+ R E +K+ WP+R E + ++V+ I ++ +D I ++ FI Sbjct: 62 KGSTFLSFAKESRTEVRKVVWPTRQEANQTTLIVLAATLIMALILWGLDGIIVRVVGFIT 121 Query: 64 GIG 66 GIG Sbjct: 122 GIG 124 >gi|299065394|emb|CBJ36563.1| preprotein translocase membrane subunit [Ralstonia solanacearum CMR15] Length = 126 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM-HFILG 64 L F ++ E +K+ WP+R E +V + I +VF D+ I W++ +LG Sbjct: 68 LEFARESYREVRKVVWPTRKEAGQMTGLVFAFVVIMAVFLWSADKLIEWVIFSLVLG 124 >gi|319790551|ref|YP_004152184.1| preprotein translocase, SecE subunit [Thermovibrio ammonificans HB-1] gi|317115053|gb|ADU97543.1| preprotein translocase, SecE subunit [Thermovibrio ammonificans HB-1] Length = 60 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 36/59 (61%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ F K+VR+E +++ WPS+ EV+ + I VI+ ++ + +F VID + + IL Sbjct: 1 MSPFQFLKEVREELQRVTWPSKEEVVEATIAVIVFCAVIAAYFWVIDTVLTAALEVILA 59 >gi|260774685|ref|ZP_05883590.1| preprotein translocase subunit SecE [Vibrio coralliilyticus ATCC BAA-450] gi|260609404|gb|EEX35553.1| preprotein translocase subunit SecE [Vibrio coralliilyticus ATCC BAA-450] Length = 126 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 35/62 (56%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A + F K+ R E +K+ WP+R E + + ++V+ + + ++ ID + L++F+ Sbjct: 65 KGKAAIEFAKESRMEVRKVVWPTRQETVQTTLIVLAVSIVMALALWGIDGIMVRLVNFVT 124 Query: 64 GI 65 G+ Sbjct: 125 GV 126 >gi|156935822|ref|YP_001439738.1| preprotein translocase subunit SecE [Cronobacter sakazakii ATCC BAA-894] gi|156534076|gb|ABU78902.1| hypothetical protein ESA_03698 [Cronobacter sakazakii ATCC BAA-894] Length = 132 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 66 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 125 Query: 61 FILGI 65 FI G+ Sbjct: 126 FITGL 130 >gi|17547759|ref|NP_521161.1| preprotein translocase subunit SecE [Ralstonia solanacearum GMI1000] gi|17430064|emb|CAD16749.1| putative preprotein translocase (sece subunit) transmembrane [Ralstonia solanacearum GMI1000] Length = 126 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM-HFILG 64 L F ++ E +K+ WP+R E +V + I +VF D+ I W++ +LG Sbjct: 68 LEFARESYREVRKVVWPTRKEAGQMTGLVFAFVVIMAVFLWSADKLIEWVIFSLVLG 124 >gi|210623164|ref|ZP_03293614.1| hypothetical protein CLOHIR_01564 [Clostridium hiranonis DSM 13275] gi|210153777|gb|EEA84783.1| hypothetical protein CLOHIR_01564 [Clostridium hiranonis DSM 13275] Length = 72 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 32/63 (50%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + + +F++ + E K++ WP+R E+ + VV+ ++ S++ ID + + Sbjct: 10 KKEKAGLFGYFRETKAELKRVTWPTRKELFRNTGVVLAVVIFSTLAIWGIDTVLSGALAL 69 Query: 62 ILG 64 +L Sbjct: 70 LLK 72 >gi|126433558|ref|YP_001069249.1| preprotein translocase subunit SecE [Mycobacterium sp. JLS] gi|126233358|gb|ABN96758.1| protein translocase subunit secE/sec61 gamma [Mycobacterium sp. JLS] Length = 147 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V+N+ KQV E +K+ WP+R +++ VV++ L+ D + L+ + G Sbjct: 90 VVNYIKQVVAELRKVIWPNRKQMVSYTSVVLVFLAFMVALIAGFDYGMARLVGLVFG 146 >gi|148657430|ref|YP_001277635.1| preprotein translocase subunit SecE [Roseiflexus sp. RS-1] gi|148569540|gb|ABQ91685.1| protein translocase subunit secE/sec61 gamma [Roseiflexus sp. RS-1] Length = 84 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 28/57 (49%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 + + ++ ++ R E +K+ WP+R E + +VVI++ +I S D W Sbjct: 16 VRAFQQGIVQPLRESRAEMRKVVWPTREETIRLTVVVILLSAIMSAILFAADALFSW 72 >gi|325003300|ref|ZP_08124412.1| preprotein translocase subunit SecE [Pseudonocardia sp. P1] Length = 115 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++V E +K+ WP+RS+++ I V++ ++ ++D + + + G Sbjct: 58 IARFLREVVAELRKVIWPNRSQMVKYTIAVLVFVTFMVTLVFLLDSAFAEGVALLFG 114 >gi|331007101|ref|ZP_08330324.1| Preprotein translocase subunit SecE [gamma proteobacterium IMCC1989] gi|330419096|gb|EGG93539.1| Preprotein translocase subunit SecE [gamma proteobacterium IMCC1989] Length = 122 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A+ + K+ + E +K+ WPSR E + ++V+++ I ++ +D IGW+ I+G Sbjct: 65 AIWHTVKESQTEIRKVVWPSRQETNQTALIVVVLTIIMALILWGLDTFIGWIASLIIG 122 >gi|34499654|ref|NP_903869.1| preprotein translocase subunit SecE [Chromobacterium violaceum ATCC 12472] gi|34105504|gb|AAQ61859.1| preprotein translocase transmembrane,secE subunit [Chromobacterium violaceum ATCC 12472] Length = 118 Score = 51.4 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM-HFILGI 65 ++ + + E++K+ WP+R E ++V + +++ ++F ++D S+ WL ILG Sbjct: 57 GLVTYANESMVEARKVVWPTRKEATQVTLMVFVFVTVLALFMWLVDSSLSWLFYDVILGR 116 Query: 66 GR 67 GR Sbjct: 117 GR 118 >gi|332037818|gb|EGI74268.1| preprotein translocase subunit SecE [Pseudoalteromonas haloplanktis ANT/505] Length = 125 Score = 51.4 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 31/62 (50%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L F K+ R E +K+ WP+R E + ++V++ I ++ +D + + F+ Sbjct: 62 KGRNFLAFAKEARIEVRKVIWPTRQETTHTTLIVMVATVIMALILWGLDGILFRAVGFLT 121 Query: 64 GI 65 G+ Sbjct: 122 GL 123 >gi|254495697|ref|ZP_05108614.1| truncated preprotein translocase subunit SecE [Legionella drancourtii LLAP12] gi|254355076|gb|EET13694.1| truncated preprotein translocase subunit SecE [Legionella drancourtii LLAP12] Length = 74 Score = 51.4 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 32/59 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 V F ++ + E K+ WP+R E + + +VI+M++++ ID + W + I +G Sbjct: 16 VYQFAQESKIELLKVVWPTRQETIQTTTIVIVMVTLTGFILWGIDSMMMWAIAKITHLG 74 >gi|309973787|gb|ADO96988.1| Probable preprotein translocase SecE subunit [Haemophilus influenzae R2846] Length = 138 Score = 51.4 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 34/60 (56%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF R E+ K+ WP+R+E + ++VI + I+S+FF +D I +++F+ + Sbjct: 77 TKARAFFNDSRTEAHKVVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFLTDL 136 >gi|156744235|ref|YP_001434364.1| preprotein translocase subunit SecE [Roseiflexus castenholzii DSM 13941] gi|156235563|gb|ABU60346.1| preprotein translocase, SecE subunit [Roseiflexus castenholzii DSM 13941] Length = 84 Score = 51.4 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 27/51 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGW 57 A++ ++ R E +K+ WP+R E + +VVI++ ++ S D W Sbjct: 22 AIVQPLRESRAEMRKVVWPTREETIRLTVVVILLSAVMSAILFAADALFSW 72 >gi|300690139|ref|YP_003751134.1| preprotein translocase membrane subunit [Ralstonia solanacearum PSI07] gi|299077199|emb|CBJ49825.1| preprotein translocase membrane subunit [Ralstonia solanacearum PSI07] Length = 126 Score = 51.4 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM-HFILG 64 L F ++ E +K+ WP+R E +V + I ++F D+ I W++ +LG Sbjct: 68 LEFARESYREVRKVVWPTRKEAGQMTGLVFAFVVIMALFLWSADKLIEWVIFSLVLG 124 >gi|237654009|ref|YP_002890323.1| preprotein translocase subunit SecE [Thauera sp. MZ1T] gi|237625256|gb|ACR01946.1| preprotein translocase, SecE subunit [Thauera sp. MZ1T] Length = 115 Score = 51.4 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 28/49 (57%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 F ++ E+KK+ WPSR E + +V + ++F + D+S+ W++ Sbjct: 59 FARESITETKKVVWPSRKETTQTTGLVFAFAVVMALFLWLTDKSLEWVL 107 >gi|319654853|ref|ZP_08008928.1| preprotein translocase [Bacillus sp. 2_A_57_CT2] gi|317393416|gb|EFV74179.1| preprotein translocase [Bacillus sp. 2_A_57_CT2] Length = 60 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 34/56 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++NFF++V E KK+ WP R E+ + V+ ++ ++FF VID I L+ IL Sbjct: 4 IVNFFREVGREMKKVSWPKRKELTNYTVTVLATVTFFALFFAVIDLGISELIRLIL 59 >gi|209696272|ref|YP_002264202.1| preprotein translocase subunit SecE [Aliivibrio salmonicida LFI1238] gi|208010225|emb|CAQ80556.1| preprotein translocase sece subunit [Aliivibrio salmonicida LFI1238] Length = 125 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 30/63 (47%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F ++ R E +K+ WP+R E + +V+ + + ++ ID + L+ I Sbjct: 63 AKGQTAIEFARESRMEVRKVVWPTRQETTQTTFIVLAVCIVMALILWGIDGIMVRLIGLI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGV 125 >gi|152972838|ref|YP_001337984.1| preprotein translocase subunit SecE [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|206580360|ref|YP_002241082.1| preprotein translocase subunit secE [Klebsiella pneumoniae 342] gi|238892451|ref|YP_002917185.1| preprotein translocase subunit SecE [Klebsiella pneumoniae NTUH-K2044] gi|262043787|ref|ZP_06016889.1| preprotein translocase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|288937727|ref|YP_003441786.1| preprotein translocase subunit E [Klebsiella variicola At-22] gi|290513235|ref|ZP_06552596.1| preprotein translocase subunit secE [Klebsiella sp. 1_1_55] gi|330004994|ref|ZP_08305078.1| preprotein translocase, SecE subunit [Klebsiella sp. MS 92-3] gi|150957687|gb|ABR79717.1| translocase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|206569418|gb|ACI11194.1| preprotein translocase subunit secE [Klebsiella pneumoniae 342] gi|238544767|dbj|BAH61118.1| preprotein translocase membrane subunit [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] gi|259038874|gb|EEW40043.1| preprotein translocase [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|288892436|gb|ADC60754.1| preprotein translocase, SecE subunit [Klebsiella variicola At-22] gi|289774332|gb|EFD82339.1| preprotein translocase subunit secE [Klebsiella sp. 1_1_55] gi|328536458|gb|EGF62806.1| preprotein translocase, SecE subunit [Klebsiella sp. MS 92-3] Length = 127 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|260774620|ref|ZP_05883532.1| preprotein translocase subunit SecE [Vibrio metschnikovii CIP 69.14] gi|260610414|gb|EEX35621.1| preprotein translocase subunit SecE [Vibrio metschnikovii CIP 69.14] Length = 126 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 35/63 (55%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V A + F ++ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ F+ Sbjct: 64 VKGQAAIVFARESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALALWGIDGIMVRLVSFV 123 Query: 63 LGI 65 G+ Sbjct: 124 TGV 126 >gi|320185981|gb|EFW60729.1| Preprotein translocase subunit SecE [Shigella flexneri CDC 796-83] Length = 101 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 35 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 94 Query: 61 FILGI 65 FI G+ Sbjct: 95 FITGL 99 >gi|258406198|ref|YP_003198940.1| preprotein translocase, SecE subunit [Desulfohalobium retbaense DSM 5692] gi|257798425|gb|ACV69362.1| preprotein translocase, SecE subunit [Desulfohalobium retbaense DSM 5692] Length = 82 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 33/55 (60%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF++ + E KK+ WP+R E L V++ +++ ++F ++D ++ ++ +L Sbjct: 28 EFFEESQVELKKVTWPTRKETLQMSGTVLLFVAVLALFLGLVDVTLAKIIEAVLS 82 >gi|212709020|ref|ZP_03317148.1| hypothetical protein PROVALCAL_00052 [Providencia alcalifaciens DSM 30120] gi|212688309|gb|EEB47837.1| hypothetical protein PROVALCAL_00052 [Providencia alcalifaciens DSM 30120] Length = 128 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 33/62 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A L F ++ R E KK+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 64 KGKATLAFAREARIEVKKVIWPTRQEALQTTLIVAAVTAVMSLILWGLDGILVRLVSFIT 123 Query: 64 GI 65 + Sbjct: 124 SL 125 >gi|16272656|ref|NP_438874.1| preprotein translocase subunit SecE [Haemophilus influenzae Rd KW20] gi|1173415|sp|P43805|SECE_HAEIN RecName: Full=Preprotein translocase subunit secE gi|1573718|gb|AAC22373.1| preprotein translocase SecE subunit (secE) [Haemophilus influenzae Rd KW20] Length = 106 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 35/60 (58%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF R E++K+ WP+R+E + ++VI + I+S+FF +D I +++F+ + Sbjct: 45 TKARAFFNDSRTEARKVVWPTRAEARQTTLIVIGVTMIASLFFWAVDSIIVTVINFLTDL 104 >gi|319942158|ref|ZP_08016475.1| preprotein translocase SecE subunit [Sutterella wadsworthensis 3_1_45B] gi|319804293|gb|EFW01182.1| preprotein translocase SecE subunit [Sutterella wadsworthensis 3_1_45B] Length = 127 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 33/55 (60%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 LN+ +Q +E +++ WP+R E L + +V+ + I + F + D+ I W ++ +L Sbjct: 68 LNYGQQSWEELRRVVWPTRKETLNTTGLVMAFVVIIAFFLFICDKLIEWGLYDVL 122 >gi|119899719|ref|YP_934932.1| preprotein translocase subunit SecE [Azoarcus sp. BH72] gi|119672132|emb|CAL96046.1| preprotein translocase, SecE subunit [Azoarcus sp. BH72] Length = 115 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 33/55 (60%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F ++ E+KK+ WPSR E + + +V + + ++F + D+S+ W+++ ++ Sbjct: 57 AEFAREAVVETKKVVWPSRKETVQTTGMVFAFVVVMAIFLWLTDKSLEWVLYDLI 111 >gi|108797895|ref|YP_638092.1| preprotein translocase subunit SecE [Mycobacterium sp. MCS] gi|119866990|ref|YP_936942.1| preprotein translocase subunit SecE [Mycobacterium sp. KMS] gi|108768314|gb|ABG07036.1| protein translocase subunit secE/sec61 gamma [Mycobacterium sp. MCS] gi|119693079|gb|ABL90152.1| protein translocase subunit secE/sec61 gamma [Mycobacterium sp. KMS] Length = 147 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V+N+ KQV E +K+ WP+R +++ VV++ L+ D + L+ + G Sbjct: 90 VVNYIKQVVAELRKVIWPNRKQMVSYTSVVLVFLAFMVALIAGFDYGMARLVGLVFG 146 >gi|300087457|ref|YP_003757979.1| preprotein translocase subunit SecE [Dehalogenimonas lykanthroporepellens BL-DC-9] gi|299527190|gb|ADJ25658.1| preprotein translocase, SecE subunit [Dehalogenimonas lykanthroporepellens BL-DC-9] Length = 84 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF + E KK+ WP+R E+ I+V+ + + +F ID + +L+ L Sbjct: 30 FFSNIIAELKKVTWPTRPEIRKLTIMVLAVALAAGLFLGAIDYGLSFLVDTFL 82 >gi|291280161|ref|YP_003496996.1| preprotein translocase subunit E [Deferribacter desulfuricans SSM1] gi|290754863|dbj|BAI81240.1| preprotein translocase subunit E [Deferribacter desulfuricans SSM1] Length = 60 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 36/55 (65%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F ++V++E KK+ WP++ E + + IVVI+M I S F V+D ++ ++ I+G Sbjct: 6 KFIQEVKEELKKVVWPTKQETIQTTIVVIVMTLIVSAFLGVVDVALSKVIKLIVG 60 >gi|297172923|gb|ADI23884.1| preprotein translocase subunit secE [uncultured gamma proteobacterium HF4000_48J03] Length = 123 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 32/56 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + FF+ R E KK+ WP+R E L + + V + + I +FF V+D + +L + I Sbjct: 66 TLWEFFQGSRVEIKKVIWPTRQETLQTTLTVFVFVLIMGIFFWVLDFLLLFLTNSI 121 >gi|215425875|ref|ZP_03423794.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis T92] gi|215429473|ref|ZP_03427392.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis EAS054] gi|219556482|ref|ZP_03535558.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis T17] gi|260199645|ref|ZP_05767136.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis T46] gi|289442032|ref|ZP_06431776.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis T46] gi|289568577|ref|ZP_06448804.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis T17] gi|289749141|ref|ZP_06508519.1| preprotein translocase secE1 [Mycobacterium tuberculosis T92] gi|289752682|ref|ZP_06512060.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis EAS054] gi|289414951|gb|EFD12191.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis T46] gi|289542331|gb|EFD45979.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis T17] gi|289689728|gb|EFD57157.1| preprotein translocase secE1 [Mycobacterium tuberculosis T92] gi|289693269|gb|EFD60698.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis EAS054] Length = 161 Score = 51.0 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 27/57 (47%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R + L VV+ L+ D + L+ + G Sbjct: 105 VYNYLKQVVAEMRKVIWPNRKQTLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG 161 >gi|37524442|ref|NP_927786.1| preprotein translocase subunit SecE [Photorhabdus luminescens subsp. laumondii TTO1] gi|36783866|emb|CAE12728.1| Preprotein translocase SecE subunit [Photorhabdus luminescens subsp. laumondii TTO1] Length = 127 Score = 51.0 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 33/63 (52%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 63 AKGKTTLAFAREARIEMRKVIWPTRQEALHTTLIVAAVTALMSLILWGLDGILVRLVSFI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGL 125 >gi|307609125|emb|CBW98570.1| preprotein translocase secE subunit [Legionella pneumophila 130b] Length = 116 Score = 51.0 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 31/60 (51%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 V F ++ + E K+ WP+R E + + +V++M+ ++ +D + W + + +G Sbjct: 55 VFVFAQEAKVELLKVVWPTRQETIQTTTIVMVMVGLTGFILWGVDSIMMWAIAKLTHLGE 114 >gi|94266156|ref|ZP_01289868.1| SecE subunit of protein translocation complex [delta proteobacterium MLMS-1] gi|94272782|ref|ZP_01292184.1| SecE subunit of protein translocation complex [delta proteobacterium MLMS-1] gi|93450013|gb|EAT01402.1| SecE subunit of protein translocation complex [delta proteobacterium MLMS-1] gi|93453271|gb|EAT03720.1| SecE subunit of protein translocation complex [delta proteobacterium MLMS-1] Length = 83 Score = 51.0 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 33/63 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 G + F +VR E K+ WP + + ++S VV+ ++ + +++ ID +G ++ Sbjct: 20 FGAKLSRLKQFIAEVRQEFGKVVWPGKKQAIMSTTVVMALVIVVAIYLGTIDLVLGKVVG 79 Query: 61 FIL 63 IL Sbjct: 80 AIL 82 >gi|302344369|ref|YP_003808898.1| preprotein translocase, SecE subunit [Desulfarculus baarsii DSM 2075] gi|301640982|gb|ADK86304.1| preprotein translocase, SecE subunit [Desulfarculus baarsii DSM 2075] Length = 117 Score = 51.0 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 36/56 (64%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++VR E KK+ WPSR + + S VV++++ I S F ++D + ++ +++G Sbjct: 62 VQFLREVRTELKKVVWPSRKQTVASTSVVVVLVVIVSAFLGMVDYILSRIVGYVIG 117 >gi|227502614|ref|ZP_03932663.1| preprotein translocase subunit SecE [Corynebacterium accolens ATCC 49725] gi|227076654|gb|EEI14617.1| preprotein translocase subunit SecE [Corynebacterium accolens ATCC 49725] Length = 139 Score = 51.0 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 26/57 (45%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F +V E KK+ WP+R E+L ++ L + + +D G + IL Sbjct: 81 GIAAFPGEVVSEMKKVVWPTRGEMLQYTLITFAFLIVMTALVWGVDTLAGLGVEKIL 137 >gi|197336074|ref|YP_002157210.1| preprotein translocase subunit SecE [Vibrio fischeri MJ11] gi|197317564|gb|ACH67011.1| preprotein translocase subunit SecE [Vibrio fischeri MJ11] Length = 125 Score = 51.0 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 30/63 (47%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F ++ R E +K+ WP+R E + +V+ + + ++ ID + L+ I Sbjct: 63 AKGQTAIAFARESRMEVRKVVWPTRQETTQTTFIVLAVCIVMALILWGIDGIMVRLIGLI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGV 125 >gi|118602794|ref|YP_904009.1| protein translocase subunit secE/sec61 gamma [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] gi|118567733|gb|ABL02538.1| protein translocase subunit secE/sec61 gamma [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] Length = 123 Score = 51.0 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 31/54 (57%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F + + E +K+ WP+R E + + ++++ + I ++F ++D + W++ + Sbjct: 70 FLIETKIELRKVVWPTRDETIKTTGMIMVAVVIVAIFLWIVDMLLSWMVQLLTN 123 >gi|77359187|ref|YP_338762.1| preprotein translocase subunit SecE [Pseudoalteromonas haloplanktis TAC125] gi|76874098|emb|CAI85319.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Pseudoalteromonas haloplanktis TAC125] Length = 125 Score = 50.6 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 33/63 (52%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 L F K+ R E +K+ WP+R E + + ++V++ +I ++ +D + + F+ Sbjct: 61 AKGRTFLTFAKEARIEVRKVIWPTRQETIHTTLIVMVATAIMALILWGLDGILFRAVGFL 120 Query: 63 LGI 65 G+ Sbjct: 121 TGL 123 >gi|152998284|ref|YP_001343119.1| preprotein translocase subunit SecE [Marinomonas sp. MWYL1] gi|150839208|gb|ABR73184.1| preprotein translocase, SecE subunit [Marinomonas sp. MWYL1] Length = 122 Score = 50.6 bits (120), Expect = 6e-05, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 33/62 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V A K+ + E +++ WP+R E + + ++V+ ++ S+ +D +GW++ + Sbjct: 61 VKGQAFFTLAKEAKTEIRRVVWPTRQETMQTTLIVLAVVVFMSLVLWGVDSFLGWIVSSV 120 Query: 63 LG 64 + Sbjct: 121 IS 122 >gi|328953171|ref|YP_004370505.1| preprotein translocase, SecE subunit [Desulfobacca acetoxidans DSM 11109] gi|328453495|gb|AEB09324.1| preprotein translocase, SecE subunit [Desulfobacca acetoxidans DSM 11109] Length = 110 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 32/55 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F ++ E KK+ WP + E L + VVI+++ + S + ++D + L+ +I+G Sbjct: 56 QFIQEAWVELKKVTWPGQKETLGATAVVIVLVFLVSFYLGIVDLGLSRLVKYIIG 110 >gi|261344395|ref|ZP_05972039.1| preprotein translocase, SecE subunit [Providencia rustigianii DSM 4541] gi|282567668|gb|EFB73203.1| preprotein translocase, SecE subunit [Providencia rustigianii DSM 4541] Length = 128 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 33/62 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A L F ++ R E KK+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 64 KGKATLAFAREARIEVKKVIWPTRQEALQTTLIVAAVTAVMSLILWGLDGILVRLVSFIT 123 Query: 64 GI 65 + Sbjct: 124 SL 125 >gi|72163059|ref|YP_290716.1| protein translocase subunit secE/sec61 gamma [Thermobifida fusca YX] gi|71916791|gb|AAZ56693.1| protein translocase subunit secE/sec61 gamma [Thermobifida fusca YX] Length = 81 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 33/64 (51%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 R + F KQV E +K+ WP++ E+ +VVI+ + I + +++ G + + Sbjct: 13 RKRRTGPVTFTKQVVAELRKVRWPTQRELFTYTVVVIVFVLIMIGYVSLVNFGFGEGVTW 72 Query: 62 ILGI 65 + G+ Sbjct: 73 LYGL 76 >gi|150020535|ref|YP_001305889.1| preprotein translocase, SecE subunit [Thermosipho melanesiensis BI429] gi|149793056|gb|ABR30504.1| preprotein translocase, SecE subunit [Thermosipho melanesiensis BI429] Length = 62 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 32/56 (57%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF++V+ E KK WP++ E+ + VV+ +L ++ V+F V+D + + + Sbjct: 6 KFFREVKTEIKKTHWPNKKELWGATGVVLFILLVTGVYFFVLDLVFSGALSALFKL 61 >gi|91774622|ref|YP_544378.1| protein translocase subunit secE/sec61 gamma [Methylobacillus flagellatus KT] gi|91708609|gb|ABE48537.1| protein translocase subunit secE/sec61 gamma [Methylobacillus flagellatus KT] Length = 115 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 33/60 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 ++F ++ E++K+ WP+R E + + V ++ I ++F ++D W + ++G G Sbjct: 55 NAISFAREAVLETRKVVWPTRKETIQTTAAVFGLVIIMAIFLWIVDVGFMWAVKQLMGRG 114 >gi|319639536|ref|ZP_07994283.1| preprotein translocase subunit SecE [Neisseria mucosa C102] gi|317399107|gb|EFV79781.1| preprotein translocase subunit SecE [Neisseria mucosa C102] Length = 91 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 29/55 (52%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 + + +FK E KK+ WPSR E + + VII ++I + F V D I WL Sbjct: 27 KKEGLFAYFKSSWTEFKKVVWPSRDEAVKMTVFVIIFVAILAAFIYVADTIISWL 81 >gi|317494919|ref|ZP_07953329.1| preprotein translocase [Enterobacteriaceae bacterium 9_2_54FAA] gi|316917107|gb|EFV38456.1| preprotein translocase [Enterobacteriaceae bacterium 9_2_54FAA] Length = 127 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 67 ATVAFAREARTEMRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 125 >gi|303228895|ref|ZP_07315706.1| preprotein translocase, SecE subunit [Veillonella atypica ACS-134-V-Col7a] gi|303231167|ref|ZP_07317905.1| preprotein translocase, SecE subunit [Veillonella atypica ACS-049-V-Sch6] gi|302514074|gb|EFL56078.1| preprotein translocase, SecE subunit [Veillonella atypica ACS-049-V-Sch6] gi|302516421|gb|EFL58352.1| preprotein translocase, SecE subunit [Veillonella atypica ACS-134-V-Col7a] Length = 73 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 19/62 (30%), Positives = 32/62 (51%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R FF+ V+ E KK+ WP+R E++ IVV ++ ++ V D L++ +L Sbjct: 10 QRGGFGKFFRGVKAELKKVVWPTRKELINYTIVVFLVTIFIALLIYVFDAIFAQLINMLL 69 Query: 64 GI 65 I Sbjct: 70 RI 71 >gi|308272992|emb|CBX29596.1| hypothetical protein N47_J05770 [uncultured Desulfobacterium sp.] Length = 132 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 37/57 (64%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F ++V+ E KKI WP+R + + S +VVII++ I S+F V+D + L+H IL Sbjct: 75 KISQFLREVKIELKKITWPTRKQTIGSTVVVIILVLIVSLFLSVVDMGLQSLVHIIL 131 >gi|322434555|ref|YP_004216767.1| preprotein translocase, SecE subunit [Acidobacterium sp. MP5ACTX9] gi|321162282|gb|ADW67987.1| preprotein translocase, SecE subunit [Acidobacterium sp. MP5ACTX9] Length = 85 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F VR E KK+ PSR EV + IVVII + I + +F ++D ++G + + Sbjct: 27 EFLHDVRSEMKKVITPSRDEVQSTTIVVIITVFIFAAYFALVDFAVGHTIDVLFK 81 >gi|225076427|ref|ZP_03719626.1| hypothetical protein NEIFLAOT_01473 [Neisseria flavescens NRL30031/H210] gi|224952227|gb|EEG33436.1| hypothetical protein NEIFLAOT_01473 [Neisseria flavescens NRL30031/H210] Length = 91 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 28/55 (50%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 + + +FK E KK+ WPSR E + + VII +++ + F D I WL Sbjct: 27 KKEGLFAYFKSSWTEFKKVVWPSRDEAVKMTVFVIIFVAVLAAFIYAADTIISWL 81 >gi|323498409|ref|ZP_08103406.1| preprotein translocase subunit SecE [Vibrio sinaloensis DSM 21326] gi|323316551|gb|EGA69565.1| preprotein translocase subunit SecE [Vibrio sinaloensis DSM 21326] Length = 126 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A ++F K+ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ Sbjct: 65 KGKAAIDFAKESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALVLWGIDGIMVRLVALAT 124 Query: 64 GI 65 G+ Sbjct: 125 GV 126 >gi|226951780|ref|ZP_03822244.1| preprotein translocase subunit SecE [Acinetobacter sp. ATCC 27244] gi|294649028|ref|ZP_06726474.1| preprotein translocase subunit SecE [Acinetobacter haemolyticus ATCC 19194] gi|226837320|gb|EEH69703.1| preprotein translocase subunit SecE [Acinetobacter sp. ATCC 27244] gi|292825059|gb|EFF83816.1| preprotein translocase subunit SecE [Acinetobacter haemolyticus ATCC 19194] Length = 146 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 30/56 (53%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + R E +++ WP++ E + + V++++ ++++ D +GW + I+G Sbjct: 91 VRLLLDARIELRRVAWPTKQETMTTSWQVLVVVIVTAIVLWCFDYGLGWFIKLIIG 146 >gi|78064910|ref|YP_367679.1| preprotein translocase subunit SecE [Burkholderia sp. 383] gi|134294429|ref|YP_001118164.1| preprotein translocase subunit SecE [Burkholderia vietnamiensis G4] gi|206558627|ref|YP_002229387.1| preprotein translocase subunit SecE [Burkholderia cenocepacia J2315] gi|77965655|gb|ABB07035.1| protein translocase subunit secE/sec61 gamma [Burkholderia sp. 383] gi|134137586|gb|ABO53329.1| protein translocase subunit secE/sec61 gamma [Burkholderia vietnamiensis G4] gi|198034664|emb|CAR50531.1| preprotein translocase SecE subunit [Burkholderia cenocepacia J2315] Length = 126 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 32/59 (54%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M +++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 60 MSAPGKSLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 118 >gi|325294361|ref|YP_004280875.1| preprotein translocase, SecE subunit [Desulfurobacterium thermolithotrophum DSM 11699] gi|325064809|gb|ADY72816.1| preprotein translocase, SecE subunit [Desulfurobacterium thermolithotrophum DSM 11699] Length = 60 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 34/58 (58%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ + F K+VR+E ++ WPS+ EV+ + ++I + +V+F +D L+ I+ Sbjct: 1 MSPITFLKEVREELSRVTWPSKEEVIEATAGIVIFCIVVAVYFWALDFVFSELLKLII 58 >gi|298490350|ref|YP_003720527.1| preprotein translocase subunit SecE ['Nostoc azollae' 0708] gi|298232268|gb|ADI63404.1| preprotein translocase, SecE subunit ['Nostoc azollae' 0708] Length = 73 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 34/60 (56%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 N ++ NFF+ ++E +K+ WPSR +++ V++M+++S+ ++D W + Sbjct: 14 NGFSLNNFFQGTKEELEKVVWPSRKQLVSESAAVLLMVTLSASLIYLVDGLFAWAAKQVF 73 >gi|229542220|ref|ZP_04431280.1| preprotein translocase, SecE subunit [Bacillus coagulans 36D1] gi|229326640|gb|EEN92315.1| preprotein translocase, SecE subunit [Bacillus coagulans 36D1] Length = 61 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 36/56 (64%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 +++ NFF+ V E +K+ WP R E++ I V++ ++ ++FF+VID I ++ + Sbjct: 1 MSITNFFRNVASEMRKVSWPGRKELVKYTITVLVTVAFLTLFFIVIDLGISAVIRW 56 >gi|323182078|gb|EFZ67488.1| preprotein translocase, SecE subunit [Escherichia coli 1357] gi|332091166|gb|EGI96256.1| preprotein translocase, SecE subunit [Shigella dysenteriae 155-74] gi|332092331|gb|EGI97406.1| preprotein translocase, SecE subunit [Shigella boydii 3594-74] Length = 106 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 40 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 99 Query: 61 FILGI 65 FI G+ Sbjct: 100 FITGL 104 >gi|295401935|ref|ZP_06811898.1| preprotein translocase, SecE subunit [Geobacillus thermoglucosidasius C56-YS93] gi|312109246|ref|YP_003987562.1| preprotein translocase subunit SecE [Geobacillus sp. Y4.1MC1] gi|294976065|gb|EFG51680.1| preprotein translocase, SecE subunit [Geobacillus thermoglucosidasius C56-YS93] gi|311214347|gb|ADP72951.1| preprotein translocase, SecE subunit [Geobacillus sp. Y4.1MC1] Length = 60 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 34/55 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +NFFK V E KK+ WPSR E++ ++V+ ++ +VFF V+D I L+ + Sbjct: 5 INFFKDVAREMKKVSWPSRKELVNYTVIVLATVAFFTVFFAVVDLGISELIRLVF 59 >gi|297172379|gb|ADI23354.1| preprotein translocase subunit secE [uncultured Oceanospirillales bacterium HF0770_27O18] gi|297181154|gb|ADI17351.1| preprotein translocase subunit sece [uncultured Oceanospirillales bacterium HF0070_21F08] Length = 125 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 28/52 (53%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K E +K+ WP+R E L + +V++ + I ++ V+D + + ++G Sbjct: 74 KDSMVELRKVVWPTRQETLQTTAIVLVFVLIVALLLFVLDWVLNGAISMLIG 125 >gi|261364712|ref|ZP_05977595.1| preprotein translocase, SecE subunit [Neisseria mucosa ATCC 25996] gi|288567008|gb|EFC88568.1| preprotein translocase, SecE subunit [Neisseria mucosa ATCC 25996] Length = 90 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 32/55 (58%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 R +L++F+ E KK+ WP+R + + I V+I +SI +VF D +I WL Sbjct: 27 KREGLLSYFRNSWSEFKKVVWPARDDAVKMTIFVVIFVSILAVFIYAADSAISWL 81 >gi|51894227|ref|YP_076918.1| hypothetical protein STH3092 [Symbiobacterium thermophilum IAM 14863] gi|51857916|dbj|BAD42074.1| conserved domain protein [Symbiobacterium thermophilum IAM 14863] Length = 123 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 33/58 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + ++V E +K+ WPSR V+ + +V+ M+++ + F + D IG LM +L Sbjct: 66 GIRTYLREVVGELRKVVWPSRERVIKATGIVVAMVALVAGFLYLWDLGIGALMELLLA 123 >gi|124514456|gb|EAY55969.1| Preprotein translocase (SecE) [Leptospirillum rubarum] Length = 69 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NF+ +V E +K +PSR E + + VV +++ + S++ ++D + M IL Sbjct: 15 NFYHEVLAEVRKTSFPSRQETMGATGVVFVLVILLSLYLALVDMLLSRGMTLILS 69 >gi|89095351|ref|ZP_01168268.1| translocase [Oceanospirillum sp. MED92] gi|89080393|gb|EAR59648.1| translocase [Oceanospirillum sp. MED92] Length = 174 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 31/62 (50%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A FK+ + E +K+ WP+R E + +V++++ I + +D + WL+ Sbjct: 113 AKGKAFFTLFKEAKQEIRKVVWPTRQETAQTTAIVVVVVLIVGLMLWGLDSLLSWLVSGA 172 Query: 63 LG 64 +G Sbjct: 173 IG 174 >gi|255324701|ref|ZP_05365815.1| preprotein translocase subunit SecE [Corynebacterium tuberculostearicum SK141] gi|255298176|gb|EET77479.1| preprotein translocase subunit SecE [Corynebacterium tuberculostearicum SK141] Length = 110 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 26/58 (44%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V F +V E KK+ WP+ E+L ++ L + ++ +D G + +L Sbjct: 52 GVAAFPGEVVSEMKKVVWPTAKEMLQYTLITFAFLIVLTILVWGVDTLAGLGVEQVLS 109 >gi|261254084|ref|ZP_05946657.1| preprotein translocase subunit SecE [Vibrio orientalis CIP 102891] gi|260937475|gb|EEX93464.1| preprotein translocase subunit SecE [Vibrio orientalis CIP 102891] Length = 126 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 32/62 (51%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A + F K+ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ Sbjct: 65 KGKAAIEFAKESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALVLWGIDGIMVRLVALAT 124 Query: 64 GI 65 G+ Sbjct: 125 GV 126 >gi|241760446|ref|ZP_04758540.1| preprotein translocase subunit SecE [Neisseria flavescens SK114] gi|241319115|gb|EER55608.1| preprotein translocase subunit SecE [Neisseria flavescens SK114] Length = 91 Score = 50.2 bits (119), Expect = 8e-05, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 28/55 (50%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 + + +FK E KK+ WPSR E + + VII +++ + F D I WL Sbjct: 27 KKEGLFAYFKSSWTEFKKVVWPSRDEAVKMTVFVIIFVAVLAAFIYAADTIISWL 81 >gi|145225694|ref|YP_001136372.1| preprotein translocase subunit SecE [Mycobacterium gilvum PYR-GCK] gi|145218180|gb|ABP47584.1| protein translocase subunit secE/sec61 gamma [Mycobacterium gilvum PYR-GCK] Length = 151 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 28/57 (49%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V+N+ K+V E +K+ WP+R E++ V+ L +D + L+ +I Sbjct: 95 VINYLKEVLGELRKVIWPNRKEMIAYTTTVLFFLIFMVAMIGGVDLGLARLITWIFA 151 >gi|107024317|ref|YP_622644.1| preprotein translocase subunit SecE [Burkholderia cenocepacia AU 1054] gi|116688358|ref|YP_833981.1| preprotein translocase subunit SecE [Burkholderia cenocepacia HI2424] gi|170731668|ref|YP_001763615.1| preprotein translocase subunit SecE [Burkholderia cenocepacia MC0-3] gi|254246608|ref|ZP_04939929.1| SecE subunit of protein translocation complex [Burkholderia cenocepacia PC184] gi|105894506|gb|ABF77671.1| protein translocase subunit secE/sec61 gamma [Burkholderia cenocepacia AU 1054] gi|116646447|gb|ABK07088.1| protein translocase subunit secE/sec61 gamma [Burkholderia cenocepacia HI2424] gi|124871384|gb|EAY63100.1| SecE subunit of protein translocation complex [Burkholderia cenocepacia PC184] gi|169814910|gb|ACA89493.1| preprotein translocase, SecE subunit [Burkholderia cenocepacia MC0-3] Length = 126 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 32/59 (54%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M +++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 60 MSAPGKSLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 118 >gi|282896128|ref|ZP_06304154.1| SecE subunit of protein translocation complex [Raphidiopsis brookii D9] gi|281199046|gb|EFA73921.1| SecE subunit of protein translocation complex [Raphidiopsis brookii D9] Length = 73 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 30/54 (55%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NFF+ ++E K+ WPSR +++ V++M+++S+ ++D W + Sbjct: 20 NFFQGTKEELDKVVWPSRKQLVSESAAVLLMVTLSASLIYLVDGLFSWAAKQVF 73 >gi|161523415|ref|YP_001578427.1| preprotein translocase subunit SecE [Burkholderia multivorans ATCC 17616] gi|189351812|ref|YP_001947440.1| preprotein translocase subunit SecE [Burkholderia multivorans ATCC 17616] gi|221201551|ref|ZP_03574589.1| preprotein translocase, SecE subunit [Burkholderia multivorans CGD2M] gi|221207374|ref|ZP_03580384.1| preprotein translocase, SecE subunit [Burkholderia multivorans CGD2] gi|221213512|ref|ZP_03586487.1| preprotein translocase, SecE subunit [Burkholderia multivorans CGD1] gi|160340844|gb|ABX13930.1| preprotein translocase, SecE subunit [Burkholderia multivorans ATCC 17616] gi|189335834|dbj|BAG44904.1| preprotein translocase SecE subunit [Burkholderia multivorans ATCC 17616] gi|221166964|gb|EED99435.1| preprotein translocase, SecE subunit [Burkholderia multivorans CGD1] gi|221172962|gb|EEE05399.1| preprotein translocase, SecE subunit [Burkholderia multivorans CGD2] gi|221178367|gb|EEE10776.1| preprotein translocase, SecE subunit [Burkholderia multivorans CGD2M] Length = 126 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 32/59 (54%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M +++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 60 MSAPGKSLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 118 >gi|119468181|ref|ZP_01611307.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Alteromonadales bacterium TW-7] gi|119448174|gb|EAW29438.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Alteromonadales bacterium TW-7] Length = 125 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 31/57 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F K+ R E +K+ WP+R E + ++V++ I ++ +D + + F+ G+ Sbjct: 67 LAFAKEARIEVRKVIWPTRQETTHTTLIVMVATVIMALILWGLDGILFRAVGFLTGL 123 >gi|82701886|ref|YP_411452.1| preprotein translocase subunit SecE [Nitrosospira multiformis ATCC 25196] gi|82409951|gb|ABB74060.1| protein translocase subunit secE/sec61 gamma [Nitrosospira multiformis ATCC 25196] Length = 114 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F ++ +E+KK+ WP+R E + + +V + + ++F +ID + + +++G Sbjct: 56 YAFSRESWEETKKVVWPNRKETVQTTGIVFAFVLVMAMFLWMIDAGLLLAVKYLMG 111 >gi|302877788|ref|YP_003846352.1| preprotein translocase, SecE subunit [Gallionella capsiferriformans ES-2] gi|302580577|gb|ADL54588.1| preprotein translocase, SecE subunit [Gallionella capsiferriformans ES-2] Length = 115 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 33/56 (58%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F + E+K++ WP+R E L + VVI+ ++F ++D S+ +++ ++G Sbjct: 57 IAFGRDSIAEAKRVVWPTRKETLQTTGVVILFAITMALFLWLVDASLMTMVNKLMG 112 >gi|323492148|ref|ZP_08097309.1| preprotein translocase subunit SecE [Vibrio brasiliensis LMG 20546] gi|323313599|gb|EGA66702.1| preprotein translocase subunit SecE [Vibrio brasiliensis LMG 20546] Length = 126 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 32/62 (51%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A + F K+ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ Sbjct: 65 KGKAAIEFAKESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALVLWGIDGIMVRLVALAT 124 Query: 64 GI 65 G+ Sbjct: 125 GV 126 >gi|171319352|ref|ZP_02908462.1| preprotein translocase, SecE subunit [Burkholderia ambifaria MEX-5] gi|171095423|gb|EDT40395.1| preprotein translocase, SecE subunit [Burkholderia ambifaria MEX-5] Length = 126 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M ++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 60 MSAPGKGLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 118 >gi|115350308|ref|YP_772147.1| preprotein translocase subunit SecE [Burkholderia ambifaria AMMD] gi|170701414|ref|ZP_02892372.1| preprotein translocase, SecE subunit [Burkholderia ambifaria IOP40-10] gi|172059327|ref|YP_001806979.1| preprotein translocase subunit SecE [Burkholderia ambifaria MC40-6] gi|115280296|gb|ABI85813.1| protein translocase subunit secE/sec61 gamma [Burkholderia ambifaria AMMD] gi|170133666|gb|EDT02036.1| preprotein translocase, SecE subunit [Burkholderia ambifaria IOP40-10] gi|171991844|gb|ACB62763.1| preprotein translocase, SecE subunit [Burkholderia ambifaria MC40-6] Length = 126 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M ++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 60 MSAPGKGLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 118 >gi|306835181|ref|ZP_07468217.1| preprotein translocase subunit SecE [Corynebacterium accolens ATCC 49726] gi|304568936|gb|EFM44465.1| preprotein translocase subunit SecE [Corynebacterium accolens ATCC 49726] Length = 158 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 26/57 (45%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F +V E KK+ WP+R E+L ++ L + + +D G + IL Sbjct: 100 GIAAFPGEVVSEMKKVVWPTRGEMLQYTLITFAFLIVMTALVWGVDTLAGLGVEKIL 156 >gi|253987826|ref|YP_003039182.1| preprotein translocase subunit SecE [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] gi|253779276|emb|CAQ82437.1| inner membrane preprotein translocase [Photorhabdus asymbiotica] Length = 127 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 33/63 (52%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 L F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI Sbjct: 63 AKGKTTLAFAREARIEMRKVIWPTRQEALHTTLIVAAVTALMSLILWGLDGILVRLVSFI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGL 125 >gi|241664555|ref|YP_002982915.1| preprotein translocase subunit SecE [Ralstonia pickettii 12D] gi|240866582|gb|ACS64243.1| preprotein translocase, SecE subunit [Ralstonia pickettii 12D] Length = 126 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 13/51 (25%), Positives = 26/51 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + F ++ E +K+ WP+R E +V + I ++F D+ I W++ Sbjct: 68 IEFARESYREVRKVVWPTRKEAGQMTGLVFAFVVIMALFLWSADKLIEWVI 118 >gi|254253529|ref|ZP_04946847.1| SecE subunit of protein translocation complex [Burkholderia dolosa AUO158] gi|124896138|gb|EAY70018.1| SecE subunit of protein translocation complex [Burkholderia dolosa AUO158] Length = 126 Score = 50.2 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 31/53 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 +++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 66 SLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 118 >gi|309782811|ref|ZP_07677531.1| preprotein translocase, SecE subunit [Ralstonia sp. 5_7_47FAA] gi|308918235|gb|EFP63912.1| preprotein translocase, SecE subunit [Ralstonia sp. 5_7_47FAA] Length = 126 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 27/53 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + + F ++ E +K+ WP+R E +V + I ++F D+ I W++ Sbjct: 66 SFIEFARESYREVRKVVWPTRKEAGQMTGLVFAFVVIMALFLWSADKLIEWVI 118 >gi|192360407|ref|YP_001981195.1| preprotein translocase subunit SecE [Cellvibrio japonicus Ueda107] gi|190686572|gb|ACE84250.1| preprotein translocase, SecE subunit [Cellvibrio japonicus Ueda107] Length = 122 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 35/62 (56%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A+++ + E +K+ WP+R E + ++V+ ++ ++S+ ++D +G++ I Sbjct: 61 AKGSAIVDVIRGAFVELRKVVWPTRQETNQTTLIVVALVIVTSIILWLLDTLLGFIASSI 120 Query: 63 LG 64 +G Sbjct: 121 IG 122 >gi|187930387|ref|YP_001900874.1| preprotein translocase subunit SecE [Ralstonia pickettii 12J] gi|187727277|gb|ACD28442.1| preprotein translocase, SecE subunit [Ralstonia pickettii 12J] Length = 126 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 27/53 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + + F ++ E +K+ WP+R E +V + I ++F D+ I W++ Sbjct: 66 SFIEFARESYREVRKVVWPTRKEAGQMTGLVFAFVVIMALFLWSADKLIEWVI 118 >gi|226939173|ref|YP_002794244.1| preprotein translocase subunit SecE [Laribacter hongkongensis HLHK9] gi|226714097|gb|ACO73235.1| SecE [Laribacter hongkongensis HLHK9] Length = 117 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM- 59 + + + + + E+KK+ WP+R E +V + + + ++F ++D + WL Sbjct: 51 LSAPGKSFVTYAQDSVGEAKKVVWPTRKEATQLTGLVFLFVLVLALFMWLVDSGLSWLFY 110 Query: 60 HFILGIG 66 ILG G Sbjct: 111 DLILGRG 117 >gi|15612680|ref|NP_240983.1| preprotein translocase subunit [Bacillus halodurans C-125] gi|14548261|sp|Q9KGE8|SECE_BACHD RecName: Full=Preprotein translocase subunit secE gi|10172729|dbj|BAB03836.1| preprotein translocase subunit [Bacillus halodurans C-125] Length = 64 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF V E K++ WP+R E+ +VV+ ++ +VFF V+D I L+ ++ Sbjct: 7 GIGKFFGDVVAEMKRVSWPTRKELTRYTLVVLGTVAFITVFFAVVDYGISALVRGLI 63 >gi|311739243|ref|ZP_07713080.1| preprotein translocase subunit SecE [Corynebacterium pseudogenitalium ATCC 33035] gi|311305669|gb|EFQ81735.1| preprotein translocase subunit SecE [Corynebacterium pseudogenitalium ATCC 33035] Length = 128 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 26/58 (44%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V F +V E KK+ WP+ E+L ++ L + ++ +D G + +L Sbjct: 70 GVAAFPGEVVSEMKKVVWPTAKEMLQYTLITFAFLIVLTILVWGVDTLAGLGVEQVLS 127 >gi|291541515|emb|CBL14625.1| preprotein translocase, SecE subunit, bacterial [Ruminococcus bromii L2-63] Length = 85 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 28/57 (49%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + + E KKI WP+ + + +VI M++I VF +DQ + L+ + Sbjct: 26 LAKYLGSCKSEIKKITWPTAKQTTKNFGIVIAMVAIVGVFIFALDQGLYALVGLFMN 82 >gi|254468982|ref|ZP_05082388.1| SecE subunit of protein translocation complex [beta proteobacterium KB13] gi|207087792|gb|EDZ65075.1| SecE subunit of protein translocation complex [beta proteobacterium KB13] Length = 113 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 34/62 (54%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F V E+KK+ WP+R E + +VV +++ + ++F ++D ++++ + Sbjct: 51 AKGNELFTFLNSVVLEAKKVVWPTRKETVQMTLVVFVVVVLMAIFLALVDIGFTYIVNLV 110 Query: 63 LG 64 LG Sbjct: 111 LG 112 >gi|257054434|ref|YP_003132266.1| preprotein translocase, SecE subunit [Saccharomonospora viridis DSM 43017] gi|256584306|gb|ACU95439.1| preprotein translocase, SecE subunit [Saccharomonospora viridis DSM 43017] Length = 151 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 26/57 (45%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++V E +K+ WP+R +++ VV++ L +D + + G Sbjct: 94 IGRFIREVWGELRKVIWPTRKQMVTYTTVVLLFLVFMVALVAGLDFVFLEGVDVVFG 150 >gi|239618208|ref|YP_002941530.1| preprotein translocase, SecE subunit [Kosmotoga olearia TBF 19.5.1] gi|239507039|gb|ACR80526.1| preprotein translocase, SecE subunit [Kosmotoga olearia TBF 19.5.1] Length = 68 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 33/58 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +VR E+KK+ WP+R ++L + V+++L + +F ++D ++ +L Sbjct: 5 SFWRFITEVRQETKKVTWPNRKQLLSTTGAVMVVLLVCGIFLGLLDIIFTNVIGDLLK 62 >gi|284047640|ref|YP_003397979.1| preprotein translocase, SecE subunit [Acidaminococcus fermentans DSM 20731] gi|283951861|gb|ADB46664.1| preprotein translocase, SecE subunit [Acidaminococcus fermentans DSM 20731] Length = 74 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 30/55 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++V+ E KK+ WP++ E++ + VI+ ++ ID + L ++G+ Sbjct: 19 FLREVKTEMKKVTWPTKRELIGYTVTVILSSLFAAFLIWAIDAILSVLFRLVMGV 73 >gi|149910418|ref|ZP_01899060.1| preprotein translocase, membrane component, transport across innermembrane (General Secretory Pathway) [Moritella sp. PE36] gi|149806566|gb|EDM66535.1| preprotein translocase, membrane component, transport across innermembrane (General Secretory Pathway) [Moritella sp. PE36] Length = 121 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 32/59 (54%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 L F + R E +K+ WP+R E + + ++V+++ +I ++ +D + ++ FI Sbjct: 62 KGRNALEFASESRTEVRKVVWPTRQEAIQTTLIVLVVTAIMALVLWGLDGILVRVVAFI 120 >gi|220935505|ref|YP_002514404.1| preprotein translocase subunit SecE [Thioalkalivibrio sp. HL-EbGR7] gi|219996815|gb|ACL73417.1| preprotein translocase subunit SecE [Thioalkalivibrio sp. HL-EbGR7] Length = 125 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 36/60 (60%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 ++ F K+ R E +K+ WP+R+E + ++VI+++ + +F ++D + W + +G G Sbjct: 65 SLAGFLKESRTEVRKMVWPTRAEATQTTLIVIVVVILVGIFLWLLDMLLAWGVRMFIGTG 124 >gi|213585781|ref|ZP_03367607.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. E98-0664] Length = 87 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ Sbjct: 21 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 80 Query: 61 FILGI 65 FI G+ Sbjct: 81 FITGL 85 >gi|331699211|ref|YP_004335450.1| preprotein translocase subunit SecE [Pseudonocardia dioxanivorans CB1190] gi|326953900|gb|AEA27597.1| preprotein translocase, SecE subunit [Pseudonocardia dioxanivorans CB1190] Length = 114 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++V E +K+ WP+R++++ IVV++ +S +D G + + G Sbjct: 57 LARFLREVVAELRKVIWPTRNQMVTYTIVVLVFVSFMVALVAGLDFVFGQAIGAVFG 113 >gi|261854937|ref|YP_003262220.1| preprotein translocase, SecE subunit [Halothiobacillus neapolitanus c2] gi|261835406|gb|ACX95173.1| preprotein translocase, SecE subunit [Halothiobacillus neapolitanus c2] Length = 124 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 33/58 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ F R E +K+ WP+R E + +VV++++ + S+F +D + W++ I G Sbjct: 67 SIWRFAFDSRVEVRKMVWPTRQETTQTTLVVVLLIVVISLFLWGVDSLLAWIVRSIAG 124 >gi|315446045|ref|YP_004078924.1| protein translocase subunit secE/sec61 gamma [Mycobacterium sp. Spyr1] gi|315264348|gb|ADU01090.1| protein translocase subunit secE/sec61 gamma [Mycobacterium sp. Spyr1] Length = 151 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 28/57 (49%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V+N+ K+V E +K+ WP+R E++ V+ L +D + L+ +I Sbjct: 95 VINYLKEVLGELRKVIWPNRKEMIAYTTTVLFFLIFMVAMIGGVDIGLARLITWIFA 151 >gi|209520976|ref|ZP_03269712.1| preprotein translocase, SecE subunit [Burkholderia sp. H160] gi|209498578|gb|EDZ98697.1| preprotein translocase, SecE subunit [Burkholderia sp. H160] Length = 126 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 28/51 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + F K E +K+ WP+R E + +VV + + ++F V D+SI W + Sbjct: 68 IAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVVVMAIFLWVCDKSIEWAI 118 >gi|323700794|ref|ZP_08112706.1| preprotein translocase, SecE subunit [Desulfovibrio sp. ND132] gi|323460726|gb|EGB16591.1| preprotein translocase, SecE subunit [Desulfovibrio desulfuricans ND132] Length = 85 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 35/56 (62%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FF++ + E KK+ WP+R E + + I V+++ + +++ V+D ++ ++ IL Sbjct: 30 IEFFEESKVEIKKVVWPTRKETVTTCIAVLVVSVVIALYLGVVDLALSKIVEAILS 85 >gi|189424397|ref|YP_001951574.1| preprotein translocase subunit SecE [Geobacter lovleyi SZ] gi|189420656|gb|ACD95054.1| preprotein translocase, SecE subunit [Geobacter lovleyi SZ] Length = 60 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V FF+ V+ E K+ WP+R E + + VVI+++ + S++ + D + LM +LG Sbjct: 3 NVKTFFESVKLELSKVTWPTRKETVATTGVVIMIVFMVSIYLGLCDVVLSKLMRLVLG 60 >gi|315125335|ref|YP_004067338.1| preprotein translocase subunit SecE [Pseudoalteromonas sp. SM9913] gi|315013848|gb|ADT67186.1| preprotein translocase subunit SecE [Pseudoalteromonas sp. SM9913] Length = 125 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 31/57 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F K+ R E +K+ WP+R E + ++V++ I ++ +D + + F+ G+ Sbjct: 67 LAFAKEARIEVRKVIWPTRQETTHTTLIVMVATVIMALILWGLDGILFRAVGFLTGL 123 >gi|299137912|ref|ZP_07031092.1| preprotein translocase, SecE subunit [Acidobacterium sp. MP5ACTX8] gi|298599842|gb|EFI56000.1| preprotein translocase, SecE subunit [Acidobacterium sp. MP5ACTX8] Length = 87 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 32/53 (60%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K VR+E +K+ P+R+EV + IVVI + I + +F ++D +G + + Sbjct: 29 FLKDVREEMRKVVTPTRAEVQSTTIVVIATVFIFAAYFEIVDLILGRGVDQLF 81 >gi|256390117|ref|YP_003111681.1| preprotein translocase subunit SecE [Catenulispora acidiphila DSM 44928] gi|256356343|gb|ACU69840.1| preprotein translocase, SecE subunit [Catenulispora acidiphila DSM 44928] Length = 89 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+E+ VVI+ ++I +D L+ ++ G Sbjct: 36 FYRQIIAELRKVVWPTRNELTTYTTVVIVFVAIMVGIVATLDYGFSKLVEWVFG 89 >gi|297624699|ref|YP_003706133.1| preprotein translocase subunitSecE [Truepera radiovictrix DSM 17093] gi|297165879|gb|ADI15590.1| preprotein translocase, SecE subunit [Truepera radiovictrix DSM 17093] Length = 59 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +L + + R E ++ WP+R EV+ S +I + I+S+F L D +G L++ L Sbjct: 3 GLLRYLRNSRAELGRVTWPTRQEVVQSTQATLIFVLITSLFLLATDTVLGNLINLFL 59 >gi|260655341|ref|ZP_05860829.1| preprotein translocase, SecE subunit [Jonquetella anthropi E3_33 E1] gi|260629789|gb|EEX47983.1| preprotein translocase, SecE subunit [Jonquetella anthropi E3_33 E1] Length = 59 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 31/54 (57%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F ++ R E KKI WP+R +V S +VVI + + S + ++D + + ILG Sbjct: 6 FIRESRAEFKKITWPTRKQVWYSTLVVIAVTLLLSAYLGILDLILTGVFSKILG 59 >gi|238025918|ref|YP_002910149.1| preprotein translocase subunit SecE [Burkholderia glumae BGR1] gi|330815226|ref|YP_004358931.1| Translocase [Burkholderia gladioli BSR3] gi|237875112|gb|ACR27445.1| Translocase [Burkholderia glumae BGR1] gi|327367619|gb|AEA58975.1| Translocase [Burkholderia gladioli BSR3] Length = 126 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 32/59 (54%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M + + + F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 60 MSLPGKSFIAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWLSDKSIEWVI 118 >gi|269103671|ref|ZP_06156368.1| preprotein translocase subunit SecE [Photobacterium damselae subsp. damselae CIP 102761] gi|268163569|gb|EEZ42065.1| preprotein translocase subunit SecE [Photobacterium damselae subsp. damselae CIP 102761] Length = 127 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 31/63 (49%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A + F ++ R E +K+ WP+R E + +V+ + + ++ ID + L+ + Sbjct: 65 AKGKAAITFAREARMEVRKVVWPTRQEATQTTFIVLAVTVVMALALWGIDGIMVRLVRLV 124 Query: 63 LGI 65 G+ Sbjct: 125 TGV 127 >gi|225175688|ref|ZP_03729682.1| preprotein translocase, SecE subunit [Dethiobacter alkaliphilus AHT 1] gi|225169017|gb|EEG77817.1| preprotein translocase, SecE subunit [Dethiobacter alkaliphilus AHT 1] Length = 64 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 33/63 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M N + K V+ E KK+ WPSR EV + +V++ + + VFF ++D ++ Sbjct: 1 MAANVKVLTKHIKDVKQELKKVHWPSRREVTLFTSIVLMAILVIGVFFWILDTGFTGMLQ 60 Query: 61 FIL 63 IL Sbjct: 61 LIL 63 >gi|293391592|ref|ZP_06635926.1| preprotein translocase subunit SecE [Aggregatibacter actinomycetemcomitans D7S-1] gi|290952126|gb|EFE02245.1| preprotein translocase subunit SecE [Aggregatibacter actinomycetemcomitans D7S-1] Length = 136 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 28/52 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FFK R E +KI WP+R E + ++V+ + S+ +D I ++ F+ Sbjct: 80 FFKDARTELRKIVWPTRPEATQTTLMVVGVTVFVSLILWGLDSIIVSIITFL 131 >gi|148244884|ref|YP_001219578.1| preprotein translocase SecE subunit [Candidatus Vesicomyosocius okutanii HA] gi|146326711|dbj|BAF61854.1| preprotein translocase SecE subunit [Candidatus Vesicomyosocius okutanii HA] Length = 123 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 31/54 (57%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F + + E +K+ WP+R E + + ++++ + I ++F +ID W++H + Sbjct: 70 FLIETKIELRKVVWPTRDETIKTTGMIMVAVVIVAIFLWIIDALFSWMVHLLTN 123 >gi|261866777|ref|YP_003254699.1| preprotein translocase subunit SecE [Aggregatibacter actinomycetemcomitans D11S-1] gi|261412109|gb|ACX81480.1| preprotein translocase subunit SecE [Aggregatibacter actinomycetemcomitans D11S-1] Length = 136 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 28/52 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FFK R E +KI WP+R E + ++V+ + S+ +D I ++ F+ Sbjct: 80 FFKDARTELRKIVWPTRPEATQTTLMVVGVTVFVSLILWGLDSIIVSIITFL 131 >gi|39997960|ref|NP_953911.1| preprotein translocase subunit SecE [Geobacter sulfurreducens PCA] gi|39984905|gb|AAR36261.1| preprotein translocase, SecE subunit, putative [Geobacter sulfurreducens PCA] Length = 66 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F +V+ E K+ WP+R E + + VV+ ++ + SV+ V D + LM ILG Sbjct: 12 EFLTEVKAELDKVTWPTRKETVSTTWVVVAIVLLISVYLGVCDVVLAKLMRIILG 66 >gi|282899202|ref|ZP_06307176.1| SecE subunit of protein translocation complex [Cylindrospermopsis raciborskii CS-505] gi|281195885|gb|EFA70808.1| SecE subunit of protein translocation complex [Cylindrospermopsis raciborskii CS-505] Length = 73 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 31/54 (57%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NFF+ ++E +K+ WPSR +++ V++M+++S+ ++D W + Sbjct: 20 NFFQGTKEELEKVVWPSRKQLVSESAAVLLMVTLSASLIYLVDGLFAWAAKQVF 73 >gi|170718774|ref|YP_001783417.1| preprotein translocase subunit SecE [Haemophilus somnus 2336] gi|168826903|gb|ACA32274.1| preprotein translocase, SecE subunit [Haemophilus somnus 2336] Length = 135 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 30/56 (53%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF R E ++I WP+R E + + ++V + I+S+ +D I L+ F+ + Sbjct: 78 RFFSDSRIELRRITWPTRPEAMQTTLIVFAVTVIASLILWGLDSVIVSLITFLTDL 133 >gi|89100742|ref|ZP_01173597.1| transcription antitermination protein NusG [Bacillus sp. NRRL B-14911] gi|89084559|gb|EAR63705.1| transcription antitermination protein NusG [Bacillus sp. NRRL B-14911] Length = 56 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 33/55 (60%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +NFF+ + E +K+ WP R E+ I V++ ++ ++FF V+D I L+ IL Sbjct: 1 MNFFRDIGREMRKVSWPKRKELTSYTITVLVTVTFFALFFAVLDLGISELIRLIL 55 >gi|300865661|ref|ZP_07110432.1| preprotein translocase subunit SecE [Oscillatoria sp. PCC 6506] gi|300336339|emb|CBN55582.1| preprotein translocase subunit SecE [Oscillatoria sp. PCC 6506] Length = 76 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 31/58 (53%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +FFK+ ++E +K+ WPSR +++ V++M+ +S+ ++D W + Sbjct: 18 NPTSFFKETKEELEKVVWPSRQQLVSESFAVVLMVILSASLIYLVDNFFNWAAAQVFA 75 >gi|89893199|ref|YP_516686.1| preprotein translocase subunit SecE [Desulfitobacterium hafniense Y51] gi|89332647|dbj|BAE82242.1| hypothetical protein [Desulfitobacterium hafniense Y51] Length = 72 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +FK V E KK+ WP R ++L VV+ ++I +V V+D + LM ILG Sbjct: 18 EYFKGVWSELKKVHWPDRKQLLTYTGVVLTAVAIVAVMLWVVDSGLSILMTKILG 72 >gi|297564022|ref|YP_003682995.1| preprotein translocase, SecE subunit [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] gi|296848471|gb|ADH70489.1| preprotein translocase, SecE subunit [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] Length = 84 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 33/61 (54%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R + F KQV E +K+ WP+R E++ IVV++ + + + ++D G + ++ Sbjct: 16 RRTGPVTFTKQVAGELRKVRWPTRRELVTYTIVVLVFVLVVLGYVSLVDWGFGEAVTWLY 75 Query: 64 G 64 G Sbjct: 76 G 76 >gi|261381380|ref|ZP_05985953.1| preprotein translocase, SecE subunit [Neisseria subflava NJ9703] gi|284795627|gb|EFC50974.1| preprotein translocase, SecE subunit [Neisseria subflava NJ9703] Length = 91 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 28/55 (50%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 + + +FK E KK+ WPSR E + + VII +++ + F D I WL Sbjct: 27 KKEGLFAYFKSSWTEFKKVVWPSRDEAVKMTVFVIIFVAVLAAFIYTADTIISWL 81 >gi|294634228|ref|ZP_06712773.1| preprotein translocase, SecE subunit [Edwardsiella tarda ATCC 23685] gi|291092353|gb|EFE24914.1| preprotein translocase, SecE subunit [Edwardsiella tarda ATCC 23685] Length = 127 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ ++ +D + L+ Sbjct: 61 MTTQGKATVAFAREARTEMRKVIWPTRQEALHTTLIVAAVTAVMALILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|323141143|ref|ZP_08076046.1| preprotein translocase, SecE subunit [Phascolarctobacterium sp. YIT 12067] gi|322414409|gb|EFY05225.1| preprotein translocase, SecE subunit [Phascolarctobacterium sp. YIT 12067] Length = 72 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 31/60 (51%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ F + + E KK+ WP++ E++ + IVVII + + + +ID L IL Sbjct: 12 KGFSITTFLSETKVELKKVTWPTKQELIANTIVVIIAVVLCAALIWIIDSIFSMLFRMIL 71 >gi|289806725|ref|ZP_06537354.1| preprotein translocase subunit SecE [Salmonella enterica subsp. enterica serovar Typhi str. AG3] Length = 93 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 29/55 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 + A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + Sbjct: 29 LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGIL 83 >gi|255654148|ref|ZP_05399557.1| preprotein translocase SecE subunit [Clostridium difficile QCD-23m63] gi|296449813|ref|ZP_06891581.1| preprotein translocase [Clostridium difficile NAP08] gi|296877877|ref|ZP_06901898.1| preprotein translocase [Clostridium difficile NAP07] gi|296261357|gb|EFH08184.1| preprotein translocase [Clostridium difficile NAP08] gi|296431131|gb|EFH16957.1| preprotein translocase [Clostridium difficile NAP07] Length = 73 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/61 (18%), Positives = 31/61 (50%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R ++ + K+ + E K++ WP++ E+ + +V+ ++ ++ ID + + +L Sbjct: 13 KRFSLFGYLKETKQELKRVTWPTKKELFKNTGIVLTVVISCTILVWGIDTILSGALALLL 72 Query: 64 G 64 Sbjct: 73 K 73 >gi|224827265|ref|ZP_03700359.1| preprotein translocase, SecE subunit [Lutiella nitroferrum 2002] gi|224600554|gb|EEG06743.1| preprotein translocase, SecE subunit [Lutiella nitroferrum 2002] Length = 117 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 30/53 (56%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ E +K+ WP+R E L +V + + I ++F ++D + WL + +L Sbjct: 61 YAQESVAEGRKVVWPTRKEALQMTGLVFVFVLILALFMWLVDSGLSWLFYDVL 113 >gi|167626052|ref|YP_001676346.1| preprotein translocase subunit SecE [Shewanella halifaxensis HAW-EB4] gi|167356074|gb|ABZ78687.1| preprotein translocase, SecE subunit [Shewanella halifaxensis HAW-EB4] Length = 123 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 32/57 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F ++ + E +K+ WP+R E L + +V+ ++ + +D + +++FI G+ Sbjct: 67 LTFARESQIEVRKVVWPTRQEALNTTFIVLAATAVLGLILWGLDAVLLRIVNFITGV 123 >gi|113968531|ref|YP_732324.1| preprotein translocase subunit SecE [Shewanella sp. MR-4] gi|114045694|ref|YP_736244.1| preprotein translocase subunit SecE [Shewanella sp. MR-7] gi|117918644|ref|YP_867836.1| preprotein translocase subunit SecE [Shewanella sp. ANA-3] gi|113883215|gb|ABI37267.1| protein translocase subunit secE/sec61 gamma [Shewanella sp. MR-4] gi|113887136|gb|ABI41187.1| protein translocase subunit secE/sec61 gamma [Shewanella sp. MR-7] gi|117610976|gb|ABK46430.1| protein translocase subunit secE/sec61 gamma [Shewanella sp. ANA-3] Length = 123 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 32/62 (51%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L F ++ + E +K+ WP+R E L + +V+ I ++ +D + +++FI Sbjct: 62 KGKKALAFARESQIEVRKVVWPTRQEALNTTFIVLAATGILALVLWGLDAVLMHIVNFIT 121 Query: 64 GI 65 G+ Sbjct: 122 GV 123 >gi|222099195|ref|YP_002533763.1| Preprotein translocase subunit secE [Thermotoga neapolitana DSM 4359] gi|221571585|gb|ACM22397.1| Preprotein translocase subunit secE [Thermotoga neapolitana DSM 4359] Length = 65 Score = 49.4 bits (117), Expect = 1e-04, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 35/55 (63%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF++V E+KKI WPSR E+L S VV+++L ++ ++F V+D ++ I Sbjct: 6 RFFREVIAEAKKISWPSRKELLTSFSVVLVILIVTGLYFFVLDFIFSGVVSAIFK 60 >gi|329296855|ref|ZP_08254191.1| preprotein translocase subunit SecE [Plautia stali symbiont] Length = 127 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 34/65 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + A + F ++ R E +K+ WP+ E L + ++V + ++ S+ +D + L+ Sbjct: 61 LTTKGKATVAFVREARTEMRKVIWPTCQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS 120 Query: 61 FILGI 65 FI G+ Sbjct: 121 FITGL 125 >gi|239825678|ref|YP_002948302.1| preprotein translocase subunit SecE [Geobacillus sp. WCH70] gi|239805971|gb|ACS23036.1| preprotein translocase, SecE subunit [Geobacillus sp. WCH70] Length = 60 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 34/56 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++NFFK+V E KK+ WPSR E++ +V+ + +VFF ++D I L+ + Sbjct: 4 IMNFFKEVAREMKKVSWPSRKELVNYTAIVLATVVFFTVFFAIVDLGISKLIRLVF 59 >gi|296168427|ref|ZP_06850307.1| preprotein translocase SecE subunit [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295896721|gb|EFG76356.1| preprotein translocase SecE subunit [Mycobacterium parascrofulaceum ATCC BAA-614] Length = 151 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R ++L VV+ L+ + D + L+ + G Sbjct: 95 VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLTKLVLLVFG 151 >gi|296105865|ref|YP_003617565.1| preprotein translocase SecE subunit [Legionella pneumophila 2300/99 Alcoy] gi|295647766|gb|ADG23613.1| preprotein translocase SecE subunit [Legionella pneumophila 2300/99 Alcoy] Length = 109 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 31/59 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 V F ++ + E K+ WP+R E + + +V++M+ ++ +D + W + + +G Sbjct: 51 VFVFAQEAKVELLKVVWPTRQETIQTTTIVMVMVGLTGFILWGVDSIMMWAIAKLTHLG 109 >gi|262401585|ref|ZP_06078152.1| preprotein translocase subunit SecE [Vibrio sp. RC586] gi|262352300|gb|EEZ01429.1| preprotein translocase subunit SecE [Vibrio sp. RC586] Length = 126 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 31/55 (56%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++ R E +K+ WP+R E + + ++V+ + + S+ ID + L+ F G+ Sbjct: 72 FARESRMEVRKVVWPTRQETMQTTLIVLAVSIVMSLALWGIDGIMVRLVAFATGV 126 >gi|88799205|ref|ZP_01114784.1| translocase [Reinekea sp. MED297] gi|88777964|gb|EAR09160.1| translocase [Reinekea sp. MED297] Length = 122 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 31/52 (59%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ E +K+ WP+R E + + +VVI + + ++ +D +GWL+ ++G Sbjct: 71 KEAWVEVRKVVWPTRQETVQTTLVVIGFVLVVALILWAVDSLLGWLVSLVIG 122 >gi|254422067|ref|ZP_05035785.1| preprotein translocase, SecE subunit, putative [Synechococcus sp. PCC 7335] gi|196189556|gb|EDX84520.1| preprotein translocase, SecE subunit, putative [Synechococcus sp. PCC 7335] Length = 85 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F + R+E K+ WP+R +++ VI+M+ +S+ +D+ GW I Sbjct: 33 FAQGTREELTKVIWPTRQQLISESAAVILMVGLSATLIYFVDKLFGWASRQIF 85 >gi|53720835|ref|YP_109821.1| preprotein translocase subunit SecE [Burkholderia pseudomallei K96243] gi|52211249|emb|CAH37238.1| preprotein translocase SecE subunit [Burkholderia pseudomallei K96243] Length = 126 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M + + + F K E +K+ WP+R E + +VV + + ++F + D+SI W + Sbjct: 60 MSLPGKSFIAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEWAI 118 >gi|227825214|ref|ZP_03990046.1| predicted protein [Acidaminococcus sp. D21] gi|226905713|gb|EEH91631.1| predicted protein [Acidaminococcus sp. D21] Length = 74 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 29/55 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF+ V++E KK+ WP+R E+ VI+ SS+ ID L ++G+ Sbjct: 19 FFRDVKNEMKKVAWPNRRELGGYTATVIVAAITSSLLIWAIDAVFSVLFRLVMGV 73 >gi|52424259|ref|YP_087396.1| preprotein translocase subunit SecE [Mannheimia succiniciproducens MBEL55E] gi|52306311|gb|AAU36811.1| SecE protein [Mannheimia succiniciproducens MBEL55E] Length = 137 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 33/57 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L FF + R E ++I WP+R E + + ++VI + ++S+ D I +++F+ + Sbjct: 79 LAFFGESRTELRRIVWPTRPEAMQTTLIVIGVTVLTSLILWGFDSIIVSIINFLTDL 135 >gi|253682129|ref|ZP_04862926.1| preprotein translocase, SecE subunit [Clostridium botulinum D str. 1873] gi|331268399|ref|YP_004394891.1| Preprotein translocase secE subunit [Clostridium botulinum BKT015925] gi|253561841|gb|EES91293.1| preprotein translocase, SecE subunit [Clostridium botulinum D str. 1873] gi|329124949|gb|AEB74894.1| Preprotein translocase secE subunit [Clostridium botulinum BKT015925] Length = 73 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 31/58 (53%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ F K+++ E+K+I WP + + S I+V+ ++S++ ++D L I Sbjct: 16 GIVKFLKELKAETKRITWPPKEQTKKSTIIVLFFCAVSAIIIGLMDSGFSSLYKIIFK 73 >gi|94312271|ref|YP_585481.1| preprotein translocase subunit SecE [Cupriavidus metallidurans CH34] gi|93356123|gb|ABF10212.1| preprotein translocase membrane subunit [Cupriavidus metallidurans CH34] Length = 126 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 26/49 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 F ++ E +K+ WP+R E +V + + I ++F D+ I W++ Sbjct: 70 FARESYREVRKVVWPTRKEAGQMTGLVFVFVVIMALFLWSADKLIEWVI 118 >gi|206602631|gb|EDZ39112.1| Preprotein translocase (SecE) [Leptospirillum sp. Group II '5-way CG'] Length = 69 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F+ +V E +K +PSR E + + VV +++ + S++ ++D + M IL Sbjct: 16 FYHEVLAEVRKTSFPSRQETMGATGVVFVLVILLSLYLALVDMLLSRGMTLILS 69 >gi|310659521|ref|YP_003937242.1| preprotein translocase subunit [Clostridium sticklandii DSM 519] gi|308826299|emb|CBH22337.1| preprotein translocase subunit [Clostridium sticklandii] Length = 68 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 33/61 (54%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + ++ R E KK+ WPSR E+ +VI + I S+ +ID +G+++ ++ Sbjct: 8 KKGIGTSLRETRTELKKVHWPSRKELTNYTWIVIFSVFIVSLIIYLIDSGLGFIIEKVIS 67 Query: 65 I 65 + Sbjct: 68 L 68 >gi|31791822|ref|NP_854315.1| preprotein translocase subunit SecE [Mycobacterium bovis AF2122/97] gi|57116765|ref|YP_177743.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis H37Rv] gi|121636559|ref|YP_976782.1| preprotein translocase subunit SecE [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|148660412|ref|YP_001281935.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis H37Ra] gi|148821842|ref|YP_001286596.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis F11] gi|161350077|ref|NP_335078.2| preprotein translocase subunit SecE [Mycobacterium tuberculosis CDC1551] gi|167969068|ref|ZP_02551345.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis H37Ra] gi|215402413|ref|ZP_03414594.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis 02_1987] gi|215410185|ref|ZP_03418993.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis 94_M4241A] gi|215444757|ref|ZP_03431509.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis T85] gi|224989031|ref|YP_002643718.1| preprotein translocase subunit SecE [Mycobacterium bovis BCG str. Tokyo 172] gi|253797578|ref|YP_003030579.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis KZN 1435] gi|254230969|ref|ZP_04924296.1| preprotein translocase secE1 [Mycobacterium tuberculosis C] gi|254363592|ref|ZP_04979638.1| preprotein translocase secE1 [Mycobacterium tuberculosis str. Haarlem] gi|260185519|ref|ZP_05762993.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis CPHL_A] gi|289446195|ref|ZP_06435939.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis CPHL_A] gi|289552892|ref|ZP_06442102.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis KZN 605] gi|289744356|ref|ZP_06503734.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis 02_1987] gi|289756722|ref|ZP_06516100.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis T85] gi|294996156|ref|ZP_06801847.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis 210] gi|297633136|ref|ZP_06950916.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis KZN 4207] gi|297730116|ref|ZP_06959234.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis KZN R506] gi|298524130|ref|ZP_07011539.1| translocase [Mycobacterium tuberculosis 94_M4241A] gi|306787655|ref|ZP_07425977.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu004] gi|306796391|ref|ZP_07434693.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu006] gi|306970852|ref|ZP_07483513.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu010] gi|307083141|ref|ZP_07492254.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu012] gi|313657443|ref|ZP_07814323.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis KZN V2475] gi|61242582|sp|P0A5Z0|SECE_MYCTU RecName: Full=Probable preprotein translocase subunit secE gi|61242587|sp|P0A5Z1|SECE_MYCBO RecName: Full=Probable preprotein translocase subunit secE gi|31617409|emb|CAD93519.1| PROBABLE PREPROTEIN TRANSLOCASE SECE1 [Mycobacterium bovis AF2122/97] gi|38490217|emb|CAE55308.1| PROBABLE PREPROTEIN TRANSLOCASE SECE1 [Mycobacterium tuberculosis H37Rv] gi|121492206|emb|CAL70673.1| Probable preprotein translocase secE1 [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|124600028|gb|EAY59038.1| preprotein translocase secE1 [Mycobacterium tuberculosis C] gi|134149106|gb|EBA41151.1| preprotein translocase secE1 [Mycobacterium tuberculosis str. Haarlem] gi|148504564|gb|ABQ72373.1| translocase [Mycobacterium tuberculosis H37Ra] gi|148720369|gb|ABR04994.1| preprotein translocase secE1 subunit [Mycobacterium tuberculosis F11] gi|224772144|dbj|BAH24950.1| preprotein translocase subunit SecE [Mycobacterium bovis BCG str. Tokyo 172] gi|253319081|gb|ACT23684.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis KZN 1435] gi|289419153|gb|EFD16354.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis CPHL_A] gi|289437524|gb|EFD20017.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis KZN 605] gi|289684884|gb|EFD52372.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis 02_1987] gi|289712286|gb|EFD76298.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis T85] gi|298493924|gb|EFI29218.1| translocase [Mycobacterium tuberculosis 94_M4241A] gi|308335732|gb|EFP24583.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu004] gi|308343168|gb|EFP32019.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu006] gi|308359637|gb|EFP48488.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu010] gi|308367147|gb|EFP55998.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu012] gi|323720995|gb|EGB30060.1| preprotein translocase secE1 [Mycobacterium tuberculosis CDC1551A] gi|326905139|gb|EGE52072.1| preprotein translocase secE1 [Mycobacterium tuberculosis W-148] gi|328457359|gb|AEB02782.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis KZN 4207] Length = 161 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 28/57 (49%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R ++L VV+ L+ D + L+ + G Sbjct: 105 VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG 161 >gi|307297341|ref|ZP_07577147.1| preprotein translocase, SecE subunit [Thermotogales bacterium mesG1.Ag.4.2] gi|306916601|gb|EFN46983.1| preprotein translocase, SecE subunit [Thermotogales bacterium mesG1.Ag.4.2] Length = 68 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 30/60 (50%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +V++E KK+ WP+R +++ S V+++L F ++D + +L Sbjct: 3 KAKFWKFLSEVKNEVKKVTWPNREQMISSTGAVLVILIAVGAFLALLDVLFTNAIGSLLN 62 >gi|41410208|ref|NP_963044.1| preprotein translocase subunit SecE [Mycobacterium avium subsp. paratuberculosis K-10] gi|41399042|gb|AAS06660.1| SecE [Mycobacterium avium subsp. paratuberculosis K-10] Length = 147 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R ++L VV+ L+ + D + L+ + G Sbjct: 91 VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLTKLVLLVFG 147 >gi|88861454|ref|ZP_01136081.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Pseudoalteromonas tunicata D2] gi|88816536|gb|EAR26364.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Pseudoalteromonas tunicata D2] Length = 125 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 33/57 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F K+ R E +K+ WP+R E L + +V+I + ++ +D ++ ++ F+ G+ Sbjct: 67 IAFAKEARIEVRKVVWPTRQETLHTTFIVMIATVVMALILWGLDGALFRIVGFLTGL 123 >gi|258620709|ref|ZP_05715744.1| translocase [Vibrio mimicus VM573] gi|258624494|ref|ZP_05719440.1| translocase [Vibrio mimicus VM603] gi|262163616|ref|ZP_06031359.1| preprotein translocase subunit SecE [Vibrio mimicus VM223] gi|262172580|ref|ZP_06040258.1| preprotein translocase subunit SecE [Vibrio mimicus MB-451] gi|258583243|gb|EEW08046.1| translocase [Vibrio mimicus VM603] gi|258586907|gb|EEW11621.1| translocase [Vibrio mimicus VM573] gi|261893656|gb|EEY39642.1| preprotein translocase subunit SecE [Vibrio mimicus MB-451] gi|262027983|gb|EEY46645.1| preprotein translocase subunit SecE [Vibrio mimicus VM223] Length = 126 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 32/55 (58%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ F+ G+ Sbjct: 72 FARESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALALWGIDGIMVRLVAFVTGV 126 >gi|113460340|ref|YP_718401.1| preprotein translocase subunit SecE [Haemophilus somnus 129PT] gi|112822383|gb|ABI24472.1| protein translocase subunit secE/sec61 gamma [Haemophilus somnus 129PT] Length = 135 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 30/56 (53%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF R E ++I WP+R E + + ++V + I+S+ +D I L+ F+ + Sbjct: 78 RFFSDSRIELRRITWPTRPEAMQTTLIVFAVTVIASLILWGLDSVIVSLITFLTDL 133 >gi|118466490|ref|YP_883657.1| preprotein translocase subunit SecE [Mycobacterium avium 104] gi|254776959|ref|ZP_05218475.1| preprotein translocase subunit SecE [Mycobacterium avium subsp. avium ATCC 25291] gi|118167777|gb|ABK68674.1| translocase [Mycobacterium avium 104] Length = 147 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R ++L VV+ L+ + D + L+ + G Sbjct: 91 VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLTKLVLLVFG 147 >gi|113869450|ref|YP_727939.1| preprotein translocase subunit SecE [Ralstonia eutropha H16] gi|113528226|emb|CAJ94571.1| preprotein translocase subunit SecE [Ralstonia eutropha H16] Length = 126 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 26/49 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 F K+ E +K+ WP+R E +V + + I ++F D+ I W++ Sbjct: 70 FAKESYREVRKVVWPTRKEAGQMTGLVFVFVVIMALFLWSADKLIEWVV 118 >gi|218752286|ref|ZP_03531082.1| preprotein translocase subunit SecE [Mycobacterium tuberculosis GM 1503] gi|254549598|ref|ZP_05140045.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] gi|289760763|ref|ZP_06520141.1| preprotein translocase secE1 [Mycobacterium tuberculosis GM 1503] gi|289708269|gb|EFD72285.1| preprotein translocase secE1 [Mycobacterium tuberculosis GM 1503] Length = 161 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 28/57 (49%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R ++L VV+ L+ D + L+ + G Sbjct: 105 VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG 161 >gi|212696287|ref|ZP_03304415.1| hypothetical protein ANHYDRO_00824 [Anaerococcus hydrogenalis DSM 7454] gi|325846707|ref|ZP_08169622.1| preprotein translocase, SecE subunit [Anaerococcus hydrogenalis ACS-025-V-Sch4] gi|212676916|gb|EEB36523.1| hypothetical protein ANHYDRO_00824 [Anaerococcus hydrogenalis DSM 7454] gi|325481465|gb|EGC84506.1| preprotein translocase, SecE subunit [Anaerococcus hydrogenalis ACS-025-V-Sch4] Length = 60 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 34/53 (64%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK +R E KKI WP+++E L ++VII+ I+ + ++D G ++ F++ Sbjct: 8 FFKSIRREFKKITWPTKNETLNYSLLVIIVSVITGLLIWLLDIVFGNMLGFLM 60 >gi|325529723|gb|EGD06580.1| preprotein translocase subunit SecE [Burkholderia sp. TJI49] Length = 110 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 32/59 (54%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M +++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 44 MSAPGKSLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 102 >gi|291286299|ref|YP_003503115.1| preprotein translocase, SecE subunit [Denitrovibrio acetiphilus DSM 12809] gi|290883459|gb|ADD67159.1| preprotein translocase, SecE subunit [Denitrovibrio acetiphilus DSM 12809] Length = 59 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 31/53 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F+ +V++E KK+ WP++ + + VVI + + ++F V+D + + FI Sbjct: 6 KFYNEVKEELKKVVWPTKESTIGTTGVVIAICIVCAIFMGVVDFGLAKITQFI 58 >gi|159028398|emb|CAO89840.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 78 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 28/54 (51%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F + ++E K+ WPSR ++L V++M+++ + +ID+ W + Sbjct: 24 EFVNETKEELAKVVWPSRQQLLSESAAVMLMVTLVATLIYLIDKFFAWGAGKVF 77 >gi|114561323|ref|YP_748836.1| preprotein translocase subunit SecE [Shewanella frigidimarina NCIMB 400] gi|114332616|gb|ABI69998.1| protein translocase subunit secE/sec61 gamma [Shewanella frigidimarina NCIMB 400] Length = 123 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 30/55 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++ E +K+ WP+R E L + +V+ ++ ++ +D + +++ I G+ Sbjct: 69 FAREAHIEVRKVVWPTRQEALNTTFIVLAATAVMALILWGLDAILLRVVNLITGV 123 >gi|194291041|ref|YP_002006948.1| preprotein translocase subunit SecE [Cupriavidus taiwanensis LMG 19424] gi|193224876|emb|CAQ70887.1| preprotein translocase membrane subunit [Cupriavidus taiwanensis LMG 19424] Length = 126 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 26/49 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 F K+ E +K+ WP+R E +V + + + ++F D+ I W++ Sbjct: 70 FAKESYREVRKVVWPTRKEAGQMTGLVFVFVVVMALFLWSADKLIEWVV 118 >gi|134103301|ref|YP_001108962.1| protein translocation complex preprotein translocase subunit [Saccharopolyspora erythraea NRRL 2338] gi|291004480|ref|ZP_06562453.1| protein translocation complex preprotein translocase subunit [Saccharopolyspora erythraea NRRL 2338] gi|133915924|emb|CAM06037.1| probable protein translocation complex preprotein translocase subunit [Saccharopolyspora erythraea NRRL 2338] Length = 133 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++V E +K+ WP+R ++ +VV++ +S+ F +D + ++ G Sbjct: 75 KIGRFLREVVAELRKVIWPTRKALVTYTLVVLVFVSVMVAFIAGVDILFAKGVDWLFG 132 >gi|54310504|ref|YP_131524.1| preprotein translocase subunit SecE [Photobacterium profundum SS9] gi|46914947|emb|CAG21722.1| putative preprotein translocase subunit SecE [Photobacterium profundum SS9] Length = 125 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 30/63 (47%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F ++ R E +K+ WP+R E + +V+ + + ++ ID + L+ + Sbjct: 63 AKGKTAITFARESRMEVRKVVWPTRQEATQTTFIVLAVTVVMALALWGIDGIMVRLVRLV 122 Query: 63 LGI 65 G+ Sbjct: 123 TGV 125 >gi|167587785|ref|ZP_02380173.1| preprotein translocase subunit SecE [Burkholderia ubonensis Bu] Length = 110 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 32/59 (54%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M +++ F K E +K+ WP+R E + +VV + + ++F + D+SI W++ Sbjct: 44 MSAPGKSLIAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVLVMAIFLWLSDKSIEWVI 102 >gi|307731269|ref|YP_003908493.1| preprotein translocase, SecE subunit [Burkholderia sp. CCGE1003] gi|323527616|ref|YP_004229769.1| preprotein translocase subunit SecE [Burkholderia sp. CCGE1001] gi|307585804|gb|ADN59202.1| preprotein translocase, SecE subunit [Burkholderia sp. CCGE1003] gi|323384618|gb|ADX56709.1| preprotein translocase, SecE subunit [Burkholderia sp. CCGE1001] Length = 126 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 28/51 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + F K E +K+ WP+R E + +VV + I ++F V D+SI W + Sbjct: 68 IAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVFIMAIFLWVSDKSIEWAI 118 >gi|255747123|ref|ZP_05421066.1| preprotein translocase subunit SecE [Vibrio cholera CIRS 101] gi|14548262|sp|Q9KV36|SECE_VIBCH RecName: Full=Preprotein translocase subunit secE gi|255735172|gb|EET90574.1| preprotein translocase subunit SecE [Vibrio cholera CIRS 101] gi|327483188|gb|AEA77595.1| Preprotein translocase subunit SecE [Vibrio cholerae LMA3894-4] Length = 126 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 31/55 (56%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ F G+ Sbjct: 72 FARESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALALWGIDGIMVRLVAFATGV 126 >gi|76811237|ref|YP_335156.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 1710b] gi|254190290|ref|ZP_04896798.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei Pasteur 52237] gi|254261793|ref|ZP_04952847.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1710a] gi|76580690|gb|ABA50165.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1710b] gi|157937966|gb|EDO93636.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei Pasteur 52237] gi|254220482|gb|EET09866.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1710a] Length = 126 Score = 48.7 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M + + + F K E +K+ WP+R E + +VV + + ++F + D+SI W + Sbjct: 60 MSLPGKSFIAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEWAI 118 >gi|198282624|ref|YP_002218945.1| preprotein translocase subunit SecE [Acidithiobacillus ferrooxidans ATCC 53993] gi|218665561|ref|YP_002424816.1| preprotein translocase, SecE subunit [Acidithiobacillus ferrooxidans ATCC 23270] gi|198247145|gb|ACH82738.1| preprotein translocase, SecE subunit [Acidithiobacillus ferrooxidans ATCC 53993] gi|218517774|gb|ACK78360.1| preprotein translocase, SecE subunit [Acidithiobacillus ferrooxidans ATCC 23270] Length = 116 Score = 48.7 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 39/61 (63%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 N A+L FF++ E K+ WP+R EV+ S ++I ++++ ++F ++D ++ ++ +L Sbjct: 53 NGKALLVFFREAYVELLKVVWPTRPEVVRSTAIIIGLIAVIAIFLWLVDMALLGIVRLLL 112 Query: 64 G 64 G Sbjct: 113 G 113 >gi|330814212|ref|YP_004358451.1| protein secE/sec61-gamma protein [Candidatus Pelagibacter sp. IMCC9063] gi|327487307|gb|AEA81712.1| protein secE/sec61-gamma protein [Candidatus Pelagibacter sp. IMCC9063] Length = 61 Score = 48.7 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 37/58 (63%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 LNF + V+ E KI WP+ E L+ ++VI M ++S+FFL++DQ +++++G Sbjct: 3 NPLNFLRSVKQEIFKITWPTSKEALMGTVMVIAMAVVASLFFLLLDQFFKVGLNYLIG 60 >gi|53723868|ref|YP_104180.1| preprotein translocase subunit SecE [Burkholderia mallei ATCC 23344] gi|121598229|ref|YP_994471.1| preprotein translocase subunit SecE [Burkholderia mallei SAVP1] gi|124384308|ref|YP_001027879.1| preprotein translocase subunit SecE [Burkholderia mallei NCTC 10229] gi|126440191|ref|YP_001060764.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 668] gi|126448578|ref|YP_001082975.1| preprotein translocase subunit SecE [Burkholderia mallei NCTC 10247] gi|126455126|ref|YP_001068052.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 1106a] gi|167721590|ref|ZP_02404826.1| preprotein translocase subunit SecE [Burkholderia pseudomallei DM98] gi|167740564|ref|ZP_02413338.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 14] gi|167847678|ref|ZP_02473186.1| preprotein translocase subunit SecE [Burkholderia pseudomallei B7210] gi|167896250|ref|ZP_02483652.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 7894] gi|167904632|ref|ZP_02491837.1| preprotein translocase subunit SecE [Burkholderia pseudomallei NCTC 13177] gi|217424832|ref|ZP_03456329.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 576] gi|237814162|ref|YP_002898613.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei MSHR346] gi|238563290|ref|ZP_00439116.2| preprotein translocase, SecE subunit [Burkholderia mallei GB8 horse 4] gi|242317494|ref|ZP_04816510.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1106b] gi|254174667|ref|ZP_04881328.1| preprotein translocase, SecE subunit [Burkholderia mallei ATCC 10399] gi|254180329|ref|ZP_04886927.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1655] gi|254198546|ref|ZP_04904967.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei S13] gi|254201251|ref|ZP_04907615.1| preprotein translocase, SecE subunit [Burkholderia mallei FMH] gi|254206592|ref|ZP_04912943.1| preprotein translocase, SecE subunit [Burkholderia mallei JHU] gi|254357133|ref|ZP_04973407.1| preprotein translocase, SecE subunit [Burkholderia mallei 2002721280] gi|52427291|gb|AAU47884.1| preprotein translocase, SecE subunit [Burkholderia mallei ATCC 23344] gi|121227039|gb|ABM49557.1| preprotein translocase, SecE subunit [Burkholderia mallei SAVP1] gi|124292328|gb|ABN01597.1| preprotein translocase, SecE subunit [Burkholderia mallei NCTC 10229] gi|126219684|gb|ABN83190.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 668] gi|126228768|gb|ABN92308.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1106a] gi|126241448|gb|ABO04541.1| preprotein translocase, SecE subunit [Burkholderia mallei NCTC 10247] gi|147747145|gb|EDK54221.1| preprotein translocase, SecE subunit [Burkholderia mallei FMH] gi|147752134|gb|EDK59200.1| preprotein translocase, SecE subunit [Burkholderia mallei JHU] gi|148026197|gb|EDK84282.1| preprotein translocase, SecE subunit [Burkholderia mallei 2002721280] gi|160695712|gb|EDP85682.1| preprotein translocase, SecE subunit [Burkholderia mallei ATCC 10399] gi|169655286|gb|EDS87979.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei S13] gi|184210868|gb|EDU07911.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1655] gi|217392288|gb|EEC32313.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 576] gi|237503833|gb|ACQ96151.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei MSHR346] gi|238520998|gb|EEP84453.1| preprotein translocase, SecE subunit [Burkholderia mallei GB8 horse 4] gi|242140733|gb|EES27135.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 1106b] Length = 126 Score = 48.7 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M + + + F K E +K+ WP+R E + +VV + + ++F + D+SI W + Sbjct: 60 MSLPGKSFIAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEWAI 118 >gi|317123110|ref|YP_004103113.1| preprotein translocase, SecE subunit [Thermaerobacter marianensis DSM 12885] gi|315593090|gb|ADU52386.1| preprotein translocase, SecE subunit [Thermaerobacter marianensis DSM 12885] Length = 97 Score = 48.7 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 28/55 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF+Q E +++ WP+R + + VV+ ++ + V+D I ++ +L Sbjct: 41 ARFFRQTVAELRRVVWPNRQQTVTYTAVVLGTVAFLAALIWVVDFVIRKVLELVL 95 >gi|306820719|ref|ZP_07454346.1| preprotein translocase subunit SecE [Eubacterium yurii subsp. margaretiae ATCC 43715] gi|304551218|gb|EFM39182.1| preprotein translocase subunit SecE [Eubacterium yurii subsp. margaretiae ATCC 43715] Length = 82 Score = 48.7 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 32/60 (53%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + ++ + R E KK+ WP + E+ IV ++ ++ SV +ID +G+++ ++ Sbjct: 23 KKSIGQAISETRKELKKVQWPKKEELQKYTIVTLMTVAFFSVAIYIIDSGLGFVISKLVN 82 >gi|323143687|ref|ZP_08078358.1| preprotein translocase, SecE subunit [Succinatimonas hippei YIT 12066] gi|322416520|gb|EFY07183.1| preprotein translocase, SecE subunit [Succinatimonas hippei YIT 12066] Length = 160 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 31/59 (52%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A+L F ++ E +K+ WP+R E + + I+V + + + S+F + D ++ I Sbjct: 100 KGHALLTFAREAYVELRKVVWPTRQEAVQTTIIVFVGVCVVSLFLYLCDLVFLQVVKAI 158 >gi|126659913|ref|ZP_01731037.1| SecE subunit of protein translocation complex [Cyanothece sp. CCY0110] gi|172035144|ref|YP_001801645.1| preprotein translocase subunit SecE [Cyanothece sp. ATCC 51142] gi|126618777|gb|EAZ89522.1| SecE subunit of protein translocation complex [Cyanothece sp. CCY0110] gi|171696598|gb|ACB49579.1| preprotein translocase SecE subunit [Cyanothece sp. ATCC 51142] Length = 75 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 28/59 (47%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NF + ++E K+ WPSR ++L VI+M+S+ + ++D W + Sbjct: 17 ETKASNFVVETKEELAKVVWPSRQQLLSESAAVILMVSLVATVIYLVDNLFSWGSGKVF 75 >gi|295111110|emb|CBL27860.1| preprotein translocase, SecE subunit, bacterial [Synergistetes bacterium SGP1] Length = 67 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 35/63 (55%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 VN + + F ++VR E KK+ WP++ +V ++VI+ S++ +ID + W Sbjct: 5 AVNSIPGVAFLREVRAELKKVTWPTKKQVWYWTLIVIVFTLGVSLYLGLIDFLLTWAFSG 64 Query: 62 ILG 64 +LG Sbjct: 65 MLG 67 >gi|30260286|ref|NP_842663.1| preprotein translocase subunit SecE [Bacillus anthracis str. Ames] gi|42779176|ref|NP_976423.1| preprotein translocase subunit SecE [Bacillus cereus ATCC 10987] gi|47525349|ref|YP_016698.1| preprotein translocase subunit SecE [Bacillus anthracis str. 'Ames Ancestor'] gi|49183129|ref|YP_026381.1| preprotein translocase subunit SecE [Bacillus anthracis str. Sterne] gi|52145297|ref|YP_081706.1| preprotein translocase subunit SecE [Bacillus cereus E33L] gi|65317555|ref|ZP_00390514.1| COG0690: Preprotein translocase subunit SecE [Bacillus anthracis str. A2012] gi|170689562|ref|ZP_02880748.1| preprotein translocase, SecE subunit [Bacillus anthracis str. A0465] gi|177655599|ref|ZP_02936980.1| preprotein translocase, SecE subunit [Bacillus anthracis str. A0174] gi|217957670|ref|YP_002336214.1| preprotein translocase subunit SecE [Bacillus cereus AH187] gi|218901297|ref|YP_002449131.1| preprotein translocase, SecE subunit [Bacillus cereus AH820] gi|222093865|ref|YP_002527915.1| preprotein translocase subunit sece [Bacillus cereus Q1] gi|227812768|ref|YP_002812777.1| preprotein translocase, SecE subunit [Bacillus anthracis str. CDC 684] gi|228912834|ref|ZP_04076481.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] gi|228925348|ref|ZP_04088444.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] gi|228931597|ref|ZP_04094503.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] gi|228943901|ref|ZP_04106286.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228983350|ref|ZP_04143563.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] gi|229015497|ref|ZP_04172495.1| preprotein translocase subunit SecE [Bacillus cereus AH1273] gi|229021706|ref|ZP_04178288.1| preprotein translocase subunit SecE [Bacillus cereus AH1272] gi|229027943|ref|ZP_04184096.1| preprotein translocase subunit SecE [Bacillus cereus AH1271] gi|229074156|ref|ZP_04207202.1| preprotein translocase subunit SecE [Bacillus cereus Rock4-18] gi|229083415|ref|ZP_04215763.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-44] gi|229089226|ref|ZP_04220507.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-42] gi|229094817|ref|ZP_04225822.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-29] gi|229100894|ref|ZP_04231698.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-28] gi|229113771|ref|ZP_04243206.1| preprotein translocase subunit SecE [Bacillus cereus Rock1-3] gi|229119757|ref|ZP_04249018.1| preprotein translocase subunit SecE [Bacillus cereus 95/8201] gi|229136941|ref|ZP_04265568.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-ST26] gi|229153873|ref|ZP_04282003.1| preprotein translocase subunit SecE [Bacillus cereus ATCC 4342] gi|229159268|ref|ZP_04287292.1| preprotein translocase subunit SecE [Bacillus cereus R309803] gi|229170946|ref|ZP_04298547.1| preprotein translocase subunit SecE [Bacillus cereus MM3] gi|229182489|ref|ZP_04309740.1| preprotein translocase subunit SecE [Bacillus cereus BGSC 6E1] gi|229194485|ref|ZP_04321288.1| preprotein translocase subunit SecE [Bacillus cereus m1293] gi|229604883|ref|YP_002864746.1| preprotein translocase, SecE subunit [Bacillus anthracis str. A0248] gi|254684401|ref|ZP_05148261.1| preprotein translocase subunit SecE [Bacillus anthracis str. CNEVA-9066] gi|254724236|ref|ZP_05186021.1| preprotein translocase subunit SecE [Bacillus anthracis str. A1055] gi|254733750|ref|ZP_05191465.1| preprotein translocase subunit SecE [Bacillus anthracis str. Western North America USA6153] gi|254739419|ref|ZP_05197119.1| preprotein translocase subunit SecE [Bacillus anthracis str. Kruger B] gi|254751208|ref|ZP_05203246.1| preprotein translocase subunit SecE [Bacillus anthracis str. Vollum] gi|254756807|ref|ZP_05208835.1| preprotein translocase subunit SecE [Bacillus anthracis str. Australia 94] gi|300119594|ref|ZP_07057138.1| preprotein translocase subunit SecE [Bacillus cereus SJ1] gi|301051832|ref|YP_003790043.1| preprotein translocase subunit SecE [Bacillus anthracis CI] gi|30253607|gb|AAP24149.1| preprotein translocase, SecE subunit [Bacillus anthracis str. Ames] gi|42735091|gb|AAS39031.1| preprotein translocase, SecE subunit [Bacillus cereus ATCC 10987] gi|47500497|gb|AAT29173.1| preprotein translocase, SecE subunit [Bacillus anthracis str. 'Ames Ancestor'] gi|49177056|gb|AAT52432.1| preprotein translocase, SecE subunit [Bacillus anthracis str. Sterne] gi|51978766|gb|AAU20316.1| preprotein translocase secE subunit [Bacillus cereus E33L] gi|170666475|gb|EDT17252.1| preprotein translocase, SecE subunit [Bacillus anthracis str. A0465] gi|172080063|gb|EDT65161.1| preprotein translocase, SecE subunit [Bacillus anthracis str. A0174] gi|217067682|gb|ACJ81932.1| preprotein translocase, SecE subunit [Bacillus cereus AH187] gi|218536009|gb|ACK88407.1| preprotein translocase, SecE subunit [Bacillus cereus AH820] gi|221237913|gb|ACM10623.1| preprotein translocase secE subunit [Bacillus cereus Q1] gi|227002464|gb|ACP12207.1| preprotein translocase, SecE subunit [Bacillus anthracis str. CDC 684] gi|228588951|gb|EEK46966.1| preprotein translocase subunit SecE [Bacillus cereus m1293] gi|228600944|gb|EEK58513.1| preprotein translocase subunit SecE [Bacillus cereus BGSC 6E1] gi|228612486|gb|EEK69707.1| preprotein translocase subunit SecE [Bacillus cereus MM3] gi|228624160|gb|EEK80962.1| preprotein translocase subunit SecE [Bacillus cereus R309803] gi|228629554|gb|EEK86251.1| preprotein translocase subunit SecE [Bacillus cereus ATCC 4342] gi|228646479|gb|EEL02686.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-ST26] gi|228663658|gb|EEL19237.1| preprotein translocase subunit SecE [Bacillus cereus 95/8201] gi|228669642|gb|EEL25049.1| preprotein translocase subunit SecE [Bacillus cereus Rock1-3] gi|228682473|gb|EEL36546.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-28] gi|228688560|gb|EEL42433.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-29] gi|228694065|gb|EEL47747.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-42] gi|228699848|gb|EEL52485.1| preprotein translocase subunit SecE [Bacillus cereus Rock3-44] gi|228708926|gb|EEL61053.1| preprotein translocase subunit SecE [Bacillus cereus Rock4-18] gi|228733331|gb|EEL84160.1| preprotein translocase subunit SecE [Bacillus cereus AH1271] gi|228739574|gb|EEL89988.1| preprotein translocase subunit SecE [Bacillus cereus AH1272] gi|228745784|gb|EEL95788.1| preprotein translocase subunit SecE [Bacillus cereus AH1273] gi|228776340|gb|EEM24693.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] gi|228815734|gb|EEM61970.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228828025|gb|EEM73753.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] gi|228834270|gb|EEM79811.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] gi|228846770|gb|EEM91775.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] gi|229269291|gb|ACQ50928.1| preprotein translocase, SecE subunit [Bacillus anthracis str. A0248] gi|298723066|gb|EFI63964.1| preprotein translocase subunit SecE [Bacillus cereus SJ1] gi|300374001|gb|ADK02905.1| preprotein translocase, SecE subunit [Bacillus cereus biovar anthracis str. CI] gi|324324085|gb|ADY19345.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar finitimus YBT-020] Length = 59 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 33/59 (55%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + NFF V E KK+ WP + E+L S VI + ++FF V+D I L+ ILG Sbjct: 1 MRLTNFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAIFFAVVDMGISSLIRLILG 59 >gi|258512685|ref|YP_003186119.1| preprotein translocase, SecE subunit [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] gi|257479411|gb|ACV59730.1| preprotein translocase, SecE subunit [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] Length = 85 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 28/60 (46%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 R ++ FFK+ E K++ WP R EV+V +++ +I V D + M I Sbjct: 23 AKRTGIVAFFKESFRELKRVRWPKRREVIVYTAACLLVCAILGVLIWAFDIGVSAAMSAI 82 >gi|186477602|ref|YP_001859072.1| preprotein translocase subunit SecE [Burkholderia phymatum STM815] gi|184194061|gb|ACC72026.1| preprotein translocase, SecE subunit [Burkholderia phymatum STM815] Length = 126 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 28/51 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + F K E +K+ WP+R E + +VV + I +VF + D+SI W + Sbjct: 68 IAFAKDSYKEVRKVVWPTRKEASQTTLVVFGFVLIMAVFLWICDKSIEWAI 118 >gi|229917373|ref|YP_002886019.1| preprotein translocase, SecE subunit [Exiguobacterium sp. AT1b] gi|229468802|gb|ACQ70574.1| preprotein translocase, SecE subunit [Exiguobacterium sp. AT1b] Length = 56 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 30/56 (53%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +NF + V E KK WP+R E+ I VI + + +F +D + +L++ ++ Sbjct: 1 MNFLRDVWKELKKTSWPTRKELTKYTITVIATVVVIGLFVFGVDTGVSYLVNLLIN 56 >gi|73542879|ref|YP_297399.1| preprotein translocase subunit SecE [Ralstonia eutropha JMP134] gi|72120292|gb|AAZ62555.1| protein translocase subunit secE/sec61 gamma [Ralstonia eutropha JMP134] Length = 126 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 25/49 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 F K+ E +K+ WP+R E +V + I ++F D+ I W++ Sbjct: 70 FAKESYREVRKVVWPTRKEAGQMTGLVFAFVVIMALFLWSADKLIEWVI 118 >gi|183597451|ref|ZP_02958944.1| hypothetical protein PROSTU_00724 [Providencia stuartii ATCC 25827] gi|188023200|gb|EDU61240.1| hypothetical protein PROSTU_00724 [Providencia stuartii ATCC 25827] Length = 128 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 33/63 (52%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V L+F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ I Sbjct: 63 VKGKQALSFAREARIEMRKVIWPTRQEALQTTLIVAAVTAVMSLILWGLDGILVRLVSII 122 Query: 63 LGI 65 + Sbjct: 123 TSL 125 >gi|166366401|ref|YP_001658674.1| preprotein translocase SecE subunit [Microcystis aeruginosa NIES-843] gi|166088774|dbj|BAG03482.1| preprotein translocase SecE subunit [Microcystis aeruginosa NIES-843] Length = 78 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 28/54 (51%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F + ++E K+ WPSR ++L V++M+++ + +ID+ W + Sbjct: 24 EFVNESKEELAKVVWPSRQQLLSESAAVMLMVTLVATLIYLIDKFFAWGAGKVF 77 >gi|126697626|ref|YP_001086523.1| preprotein translocase SecE subunit [Clostridium difficile 630] gi|254973717|ref|ZP_05270189.1| preprotein translocase SecE subunit [Clostridium difficile QCD-66c26] gi|255091107|ref|ZP_05320585.1| preprotein translocase SecE subunit [Clostridium difficile CIP 107932] gi|255099219|ref|ZP_05328196.1| preprotein translocase SecE subunit [Clostridium difficile QCD-63q42] gi|255305001|ref|ZP_05349173.1| preprotein translocase SecE subunit [Clostridium difficile ATCC 43255] gi|255312761|ref|ZP_05354344.1| preprotein translocase SecE subunit [Clostridium difficile QCD-76w55] gi|255515521|ref|ZP_05383197.1| preprotein translocase SecE subunit [Clostridium difficile QCD-97b34] gi|255648615|ref|ZP_05395517.1| preprotein translocase SecE subunit [Clostridium difficile QCD-37x79] gi|260681832|ref|YP_003213117.1| preprotein translocase SecE subunit [Clostridium difficile CD196] gi|260685430|ref|YP_003216563.1| preprotein translocase SecE subunit [Clostridium difficile R20291] gi|306518738|ref|ZP_07405085.1| preprotein translocase SecE subunit [Clostridium difficile QCD-32g58] gi|115249063|emb|CAJ66874.1| Preprotein translocase SecE subunit [Clostridium difficile] gi|260207995|emb|CBA60160.1| preprotein translocase SecE subunit [Clostridium difficile CD196] gi|260211446|emb|CBE01555.1| preprotein translocase SecE subunit [Clostridium difficile R20291] Length = 73 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 11/61 (18%), Positives = 31/61 (50%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R ++ + K+ + E K++ WP++ E+ + +V+ ++ ++ ID + + +L Sbjct: 13 KRFSLFGYLKETKQELKRVTWPTKKELFKNTSIVLTVVISCTILVWGIDTILSGALALLL 72 Query: 64 G 64 Sbjct: 73 K 73 >gi|187476521|ref|YP_784545.1| preprotein translocase subunit SecE [Bordetella avium 197N] gi|115421107|emb|CAJ47591.1| preprotein translocase SecE subunit [Bordetella avium 197N] Length = 126 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 35/56 (62%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++++ ++ +E K++ WP+R E + +V +++ +F V+D+ I W+++ +L Sbjct: 67 LISYAQESYNEVKRVSWPTRKETVQMTGIVFAFVAVMGIFMWVLDKGIEWILYGLL 122 >gi|15640349|ref|NP_229976.1| preprotein translocase subunit SecE [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121730819|ref|ZP_01682891.1| preprotein translocase, SecE subunit [Vibrio cholerae V52] gi|147673835|ref|YP_001218590.1| preprotein translocase subunit SecE [Vibrio cholerae O395] gi|153827144|ref|ZP_01979811.1| preprotein translocase, SecE subunit [Vibrio cholerae MZO-2] gi|227080534|ref|YP_002809085.1| preprotein translocase, SecE subunit [Vibrio cholerae M66-2] gi|229506883|ref|ZP_04396391.1| preprotein translocase subunit SecE [Vibrio cholerae BX 330286] gi|229508688|ref|ZP_04398182.1| preprotein translocase subunit SecE [Vibrio cholerae B33] gi|229516070|ref|ZP_04405521.1| preprotein translocase subunit SecE [Vibrio cholerae RC9] gi|229519860|ref|ZP_04409293.1| preprotein translocase subunit SecE [Vibrio cholerae TM 11079-80] gi|229527017|ref|ZP_04416413.1| preprotein translocase subunit SecE [Vibrio cholerae 12129(1)] gi|229606397|ref|YP_002877045.1| preprotein translocase subunit SecE [Vibrio cholerae MJ-1236] gi|254292281|ref|ZP_04963027.1| preprotein translocase, SecE subunit [Vibrio cholerae AM-19226] gi|254851631|ref|ZP_05240981.1| preprotein translocase subunit SecE [Vibrio cholerae MO10] gi|298501283|ref|ZP_07011080.1| preprotein translocase subunit SecE [Vibrio cholerae MAK 757] gi|9654735|gb|AAF93495.1| preprotein translocase, SecE subunit [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121627604|gb|EAX60294.1| preprotein translocase, SecE subunit [Vibrio cholerae V52] gi|146315718|gb|ABQ20257.1| preprotein translocase, SecE subunit [Vibrio cholerae O395] gi|149738972|gb|EDM53288.1| preprotein translocase, SecE subunit [Vibrio cholerae MZO-2] gi|150421803|gb|EDN13804.1| preprotein translocase, SecE subunit [Vibrio cholerae AM-19226] gi|227008422|gb|ACP04634.1| preprotein translocase, SecE subunit [Vibrio cholerae M66-2] gi|227012178|gb|ACP08388.1| preprotein translocase, SecE subunit [Vibrio cholerae O395] gi|229335540|gb|EEO01021.1| preprotein translocase subunit SecE [Vibrio cholerae 12129(1)] gi|229343101|gb|EEO08086.1| preprotein translocase subunit SecE [Vibrio cholerae TM 11079-80] gi|229346973|gb|EEO11940.1| preprotein translocase subunit SecE [Vibrio cholerae RC9] gi|229354323|gb|EEO19252.1| preprotein translocase subunit SecE [Vibrio cholerae B33] gi|229355988|gb|EEO20907.1| preprotein translocase subunit SecE [Vibrio cholerae BX 330286] gi|229369052|gb|ACQ59475.1| preprotein translocase subunit SecE [Vibrio cholerae MJ-1236] gi|254847336|gb|EET25750.1| preprotein translocase subunit SecE [Vibrio cholerae MO10] gi|297539974|gb|EFH76038.1| preprotein translocase subunit SecE [Vibrio cholerae MAK 757] Length = 131 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 31/55 (56%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ F G+ Sbjct: 77 FARESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALALWGIDGIMVRLVAFATGV 131 >gi|317401590|gb|EFV82217.1| SecE protein [Achromobacter xylosoxidans C54] Length = 126 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 32/56 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F + +E K++ WP+R E +V +++ +F V+D+ I W+++ +L Sbjct: 67 TLSFASESYNEVKRVSWPTRKETTQMTGIVFAFVAVMGIFMWVLDKGIEWILYGLL 122 >gi|78187810|ref|YP_375853.1| preprotein translocase subunit SecE [Chlorobium luteolum DSM 273] gi|78167712|gb|ABB24810.1| protein translocase subunit secE/sec61 gamma [Chlorobium luteolum DSM 273] Length = 63 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 32/54 (59%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +++ V E +K+ WPS+ E+ +VV+ + + ++F ++D I ++M +L Sbjct: 10 QYYRDVVAEMRKVVWPSKEELKDLTVVVLTVSGLLALFTFLVDWVINFVMGKLL 63 >gi|56961917|ref|YP_173639.1| preprotein translocase subunit E [Bacillus clausii KSM-K16] gi|56908151|dbj|BAD62678.1| preprotein translocase subunit E [Bacillus clausii KSM-K16] Length = 62 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 29/62 (46%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M + F + V E K++ WP++ E+ +VV+ L FF ++D I L+ Sbjct: 1 MADENKGPVTFLRNVGREMKRVTWPTKKELTRYTLVVLTTLIFMVAFFYLVDLGISTLLR 60 Query: 61 FI 62 + Sbjct: 61 ML 62 >gi|302559021|ref|ZP_07311363.1| preprotein translocase subunit SecE [Streptomyces griseoflavus Tu4000] gi|302476639|gb|EFL39732.1| preprotein translocase subunit SecE [Streptomyces griseoflavus Tu4000] Length = 95 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+++ VI+ + + +ID + ++ G Sbjct: 42 FYRQIIAELRKVVWPTRNQLTSYTTAVIVFVVLMIGLITLIDYGLSHAAKYVFG 95 >gi|212634815|ref|YP_002311340.1| preprotein translocase subunit SecE [Shewanella piezotolerans WP3] gi|212556299|gb|ACJ28753.1| SecE subunit of protein translocation complex [Shewanella piezotolerans WP3] Length = 123 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 32/57 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F ++ + E +K+ WP+R E L + +V+ ++ + +D + +++FI G+ Sbjct: 67 LTFAREAQIEVRKVVWPTRQEALNTTFIVLAATAVLGLILWGLDAVLLRIVNFITGV 123 >gi|27364610|ref|NP_760138.1| preprotein translocase subunit SecE [Vibrio vulnificus CMCP6] gi|37681349|ref|NP_935958.1| preprotein translocase subunit SecE [Vibrio vulnificus YJ016] gi|320155004|ref|YP_004187383.1| preprotein translocase subunit SecE [Vibrio vulnificus MO6-24/O] gi|27360729|gb|AAO09665.1| preprotein translocase, SecE subunit [Vibrio vulnificus CMCP6] gi|37200100|dbj|BAC95929.1| preprotein translocase subunit SecE [Vibrio vulnificus YJ016] gi|319930316|gb|ADV85180.1| preprotein translocase subunit SecE [Vibrio vulnificus MO6-24/O] Length = 126 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 31/55 (56%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K+ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ F G+ Sbjct: 72 FAKESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALVLWGIDGIMVRLIAFATGV 126 >gi|154500408|ref|ZP_02038446.1| hypothetical protein BACCAP_04075 [Bacteroides capillosus ATCC 29799] gi|150270913|gb|EDM98196.1| hypothetical protein BACCAP_04075 [Bacteroides capillosus ATCC 29799] Length = 103 Score = 48.7 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 30/58 (51%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 V +FK+++ E KK+ WP +V + +VI + + +F V D ++ +L + Sbjct: 41 VAKWFKEMKSELKKVQWPGWKQVAKNTGIVIACVIVVGIFIWVFDALANAIVQALLNL 98 >gi|298506901|gb|ADI85624.1| preprotein translocase, SecE subunit [Geobacter sulfurreducens KN400] Length = 61 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F +V+ E K+ WP+R E + + VV+ ++ + SV+ V D + LM ILG Sbjct: 7 EFLTEVKAELDKVTWPTRKETVSTTWVVVAIVLLISVYLGVCDVVLAKLMRIILG 61 >gi|172039952|ref|YP_001799666.1| preprotein translocase subunit SecE [Corynebacterium urealyticum DSM 7109] gi|171851256|emb|CAQ04232.1| preprotein translocase SecE subunit [Corynebacterium urealyticum DSM 7109] Length = 95 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 32/60 (53%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A+ ++ + V E +K+ WP+ E++ +VV++ L + + +D G + ++ G+ Sbjct: 36 TAIADYLRGVISEMRKVIWPTGREMVTYSLVVLVFLILMTALVAGVDYVTGLGVRWVFGV 95 >gi|212637939|ref|YP_002314459.1| preprotein translocase subunit SecE [Anoxybacillus flavithermus WK1] gi|212559419|gb|ACJ32474.1| Preprotein translocase subunit SecE [Anoxybacillus flavithermus WK1] Length = 60 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 22/54 (40%), Positives = 33/54 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF++V E KK+ WP R E++ I V+ ++ +VFF V+D I L+ FIL Sbjct: 6 KFFREVVREMKKVSWPKRKELVNYTITVLATVAFFTVFFAVVDLGISELVRFIL 59 >gi|46143567|ref|ZP_00204513.1| COG0690: Preprotein translocase subunit SecE [Actinobacillus pleuropneumoniae serovar 1 str. 4074] Length = 89 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 30/55 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K+ R E +KI WP+R E + ++V+ M + S+ ID I L+ F+ + Sbjct: 33 FIKESRTELRKIIWPTRPEATQTTLIVLAMCVVVSLVLWGIDSIIVTLVTFLTNL 87 >gi|118444061|ref|YP_877184.1| preprotein translocase subunit SecE [Clostridium novyi NT] gi|118134517|gb|ABK61561.1| Preprotein translocase secE subunit [Clostridium novyi NT] Length = 73 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 32/63 (50%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + + + F K+++ E+K+I WP + EV S I+V+ ++S+ ++D L Sbjct: 11 KQSSVGIGKFLKELKAETKRITWPPKEEVKKSTIIVLFFCAVSAFIIGLMDSGFNGLYKI 70 Query: 62 ILG 64 I Sbjct: 71 IFK 73 >gi|94500509|ref|ZP_01307040.1| translocase [Oceanobacter sp. RED65] gi|94427299|gb|EAT12278.1| translocase [Oceanobacter sp. RED65] Length = 122 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 32/62 (51%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A L K+ E +K+ WP+R E + ++VI ++ + ++ +D + W++ + Sbjct: 61 AKGKAFLVLLKEANIERRKVVWPTRQETTQTTLIVIAVVILVAILLWGLDSLLAWMVSSV 120 Query: 63 LG 64 +G Sbjct: 121 IG 122 >gi|17232790|ref|NP_489338.1| preprotein translocase subunit SecE [Nostoc sp. PCC 7120] gi|75908764|ref|YP_323060.1| preprotein translocase subunit SecE [Anabaena variabilis ATCC 29413] gi|17134437|dbj|BAB76997.1| secretory protein [Nostoc sp. PCC 7120] gi|75702489|gb|ABA22165.1| protein translocase subunit secE/sec61 gamma [Anabaena variabilis ATCC 29413] Length = 73 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 32/54 (59%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NFF+ ++E +K+ WPSR +++ V++M+++S+ ++D W+ + Sbjct: 20 NFFQGTKEELEKVVWPSRKQLISESAAVLLMVTLSASLIYLVDGLFAWVAKQVF 73 >gi|68536955|ref|YP_251660.1| preprotein translocase subunit SecE [Corynebacterium jeikeium K411] gi|260579299|ref|ZP_05847182.1| preprotein translocase SecE subunit [Corynebacterium jeikeium ATCC 43734] gi|68264554|emb|CAI38042.1| preprotein translocase SecE subunit [Corynebacterium jeikeium K411] gi|258602598|gb|EEW15892.1| preprotein translocase SecE subunit [Corynebacterium jeikeium ATCC 43734] Length = 114 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 28/57 (49%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A++++ + V E K+ WP+ E++ ++V++ L D + W + I+ Sbjct: 57 AIVDYIRGVISEMGKVIWPTGREMVNYTVIVLLFLIFVCALVAGTDWAASWGLRQIM 113 >gi|311109631|ref|YP_003982484.1| preprotein translocase, SecE subunit [Achromobacter xylosoxidans A8] gi|310764320|gb|ADP19769.1| preprotein translocase, SecE subunit [Achromobacter xylosoxidans A8] Length = 126 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 32/56 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F + +E K++ WP+R E +V +++ +F V+D+ I W+++ +L Sbjct: 67 TLSFASESYNEVKRVSWPTRKETTQMTGIVFAFVAVMGLFMWVLDKGIEWILYGLL 122 >gi|121609217|ref|YP_997024.1| preprotein translocase subunit SecE [Verminephrobacter eiseniae EF01-2] gi|121553857|gb|ABM58006.1| protein translocase subunit secE/sec61 gamma [Verminephrobacter eiseniae EF01-2] Length = 144 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM-HFILG 64 L F + E K+ WP+R E L V + + ++F + D+++ W++ ILG Sbjct: 84 LAFARDAWHEVGKVVWPTRKEALQMTAYVFAFVVVMALFLWLTDKTLEWVLYDLILG 140 >gi|114567856|ref|YP_755010.1| preprotein translocase subunit SecE [Syntrophomonas wolfei subsp. wolfei str. Goettingen] gi|114338791|gb|ABI69639.1| protein translocase subunit secE/sec61 gamma [Syntrophomonas wolfei subsp. wolfei str. Goettingen] Length = 80 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 30/54 (55%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF V E KK+ WP+R +++ VV+I +++ +V + D + +L+ + Sbjct: 23 QFFLNVYSELKKVHWPNRQQMIAYTGVVLIAVTLVAVIIWLFDSGLSFLLAKLF 76 >gi|228475255|ref|ZP_04059980.1| preprotein translocase, SecE subunit [Staphylococcus hominis SK119] gi|314937160|ref|ZP_07844507.1| preprotein translocase, SecE subunit [Staphylococcus hominis subsp. hominis C80] gi|228270720|gb|EEK12129.1| preprotein translocase, SecE subunit [Staphylococcus hominis SK119] gi|313655779|gb|EFS19524.1| preprotein translocase, SecE subunit [Staphylococcus hominis subsp. hominis C80] Length = 66 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 29/51 (56%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 FF+ V+ E +K WP++ E+ ++V+ + VFF V+D IG L+ Sbjct: 14 FFQGVKSEMEKTSWPTKEELFKYTVIVVATVIFFMVFFWVLDVGIGNLIQL 64 >gi|91785479|ref|YP_560685.1| preprotein translocase subunit SecE [Burkholderia xenovorans LB400] gi|91689433|gb|ABE32633.1| protein translocase subunit secE/sec61 gamma [Burkholderia xenovorans LB400] Length = 126 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 28/51 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + F K E +K+ WP+R E + +VV + + ++F V D+SI W + Sbjct: 68 IAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVFVMAIFLWVSDKSIEWAI 118 >gi|194337667|ref|YP_002019461.1| preprotein translocase, SecE subunit [Pelodictyon phaeoclathratiforme BU-1] gi|194310144|gb|ACF44844.1| preprotein translocase, SecE subunit [Pelodictyon phaeoclathratiforme BU-1] Length = 63 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 32/54 (59%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +++ V E +K+ WPS+ E+ IVV+ + I ++F ++D I ++M +L Sbjct: 10 QYYRDVISEMRKVIWPSKEEIKDLTIVVLTVSGILALFTFLVDWVINFVMGKLL 63 >gi|302543381|ref|ZP_07295723.1| preprotein translocase, SecE subunit [Streptomyces hygroscopicus ATCC 53653] gi|302460999|gb|EFL24092.1| preprotein translocase, SecE subunit [Streptomyces himastatinicus ATCC 53653] Length = 97 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+RS++ VVI+ + I VID + ++ G Sbjct: 44 FYRQIIAELRKVVWPTRSQLSTYTSVVIVFVLIMIGIVTVIDYGFNNAIKYVFG 97 >gi|30018365|ref|NP_829996.1| preprotein translocase subunit SecE [Bacillus cereus ATCC 14579] gi|218230921|ref|YP_002364944.1| preprotein translocase subunit SecE [Bacillus cereus B4264] gi|218895230|ref|YP_002443641.1| preprotein translocase, SecE subunit [Bacillus cereus G9842] gi|228898848|ref|ZP_04063130.1| preprotein translocase subunit SecE [Bacillus thuringiensis IBL 4222] gi|228905892|ref|ZP_04069789.1| preprotein translocase subunit SecE [Bacillus thuringiensis IBL 200] gi|228919045|ref|ZP_04082424.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] gi|228937397|ref|ZP_04100043.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar berliner ATCC 10792] gi|228950643|ref|ZP_04112777.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar kurstaki str. T03a001] gi|228956536|ref|ZP_04118332.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar pakistani str. T13001] gi|228963195|ref|ZP_04124364.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar sotto str. T04001] gi|228970283|ref|ZP_04130942.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar thuringiensis str. T01001] gi|228976853|ref|ZP_04137265.1| preprotein translocase subunit SecE [Bacillus thuringiensis Bt407] gi|229041000|ref|ZP_04189763.1| preprotein translocase subunit SecE [Bacillus cereus AH676] gi|229067860|ref|ZP_04201177.1| preprotein translocase subunit SecE [Bacillus cereus F65185] gi|229077390|ref|ZP_04210050.1| preprotein translocase subunit SecE [Bacillus cereus Rock4-2] gi|229107781|ref|ZP_04237417.1| preprotein translocase subunit SecE [Bacillus cereus Rock1-15] gi|229125612|ref|ZP_04254644.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-Cer4] gi|229142901|ref|ZP_04271342.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-ST24] gi|229148504|ref|ZP_04276760.1| preprotein translocase subunit SecE [Bacillus cereus m1550] gi|229176695|ref|ZP_04304099.1| preprotein translocase subunit SecE [Bacillus cereus 172560W] gi|229188380|ref|ZP_04315428.1| preprotein translocase subunit SecE [Bacillus cereus ATCC 10876] gi|296500929|ref|YP_003662629.1| preprotein translocase subunit SecE [Bacillus thuringiensis BMB171] gi|29893905|gb|AAP07197.1| Protein translocase subunit SecE [Bacillus cereus ATCC 14579] gi|218158878|gb|ACK58870.1| preprotein translocase, SecE subunit [Bacillus cereus B4264] gi|218544141|gb|ACK96535.1| preprotein translocase, SecE subunit [Bacillus cereus G9842] gi|228595054|gb|EEK52825.1| preprotein translocase subunit SecE [Bacillus cereus ATCC 10876] gi|228606738|gb|EEK64155.1| preprotein translocase subunit SecE [Bacillus cereus 172560W] gi|228634920|gb|EEK91493.1| preprotein translocase subunit SecE [Bacillus cereus m1550] gi|228640522|gb|EEK96911.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-ST24] gi|228657804|gb|EEL13610.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-Cer4] gi|228675630|gb|EEL30838.1| preprotein translocase subunit SecE [Bacillus cereus Rock1-15] gi|228705924|gb|EEL58250.1| preprotein translocase subunit SecE [Bacillus cereus Rock4-2] gi|228715219|gb|EEL67078.1| preprotein translocase subunit SecE [Bacillus cereus F65185] gi|228727297|gb|EEL78491.1| preprotein translocase subunit SecE [Bacillus cereus AH676] gi|228782823|gb|EEM30989.1| preprotein translocase subunit SecE [Bacillus thuringiensis Bt407] gi|228789392|gb|EEM37312.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar thuringiensis str. T01001] gi|228796453|gb|EEM43892.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar sotto str. T04001] gi|228803101|gb|EEM49923.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar pakistani str. T13001] gi|228808994|gb|EEM55479.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar kurstaki str. T03a001] gi|228822230|gb|EEM68212.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar berliner ATCC 10792] gi|228840570|gb|EEM85832.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] gi|228853707|gb|EEM98467.1| preprotein translocase subunit SecE [Bacillus thuringiensis IBL 200] gi|228860748|gb|EEN05126.1| preprotein translocase subunit SecE [Bacillus thuringiensis IBL 4222] gi|296321981|gb|ADH04909.1| preprotein translocase subunit SecE [Bacillus thuringiensis BMB171] gi|326937889|gb|AEA13785.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar chinensis CT-43] Length = 59 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 33/59 (55%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + NFF V E KK+ WP + E+L S V+ + ++FF V+D I L+ ILG Sbjct: 1 MRLTNFFGDVGREMKKVSWPKKDELLRSTATVVATVVFFAIFFAVVDMGISSLIRLILG 59 >gi|253995705|ref|YP_003047769.1| preprotein translocase subunit SecE [Methylotenera mobilis JLW8] gi|253982384|gb|ACT47242.1| preprotein translocase, SecE subunit [Methylotenera mobilis JLW8] Length = 115 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 34/56 (60%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F + ES+K+ WP+R E + + +VV +++ + + F ++D +++ ++LG G Sbjct: 59 FIGEAVAESRKVVWPTRKETIQTTLVVFVLVVVMAAFLALVDIGFAFMVKWLLGRG 114 >gi|172056125|ref|YP_001812585.1| preprotein translocase, SecE subunit [Exiguobacterium sibiricum 255-15] gi|171988646|gb|ACB59568.1| preprotein translocase, SecE subunit [Exiguobacterium sibiricum 255-15] Length = 56 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 27/56 (48%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F + V +E KK WP R E+ + VI M+ VF +D + M +++ Sbjct: 1 MKFLRDVWNELKKTSWPKRKELTKYTLTVIGMVIFMGVFIFGVDSGLSAFMSWLIK 56 >gi|163938103|ref|YP_001642987.1| preprotein translocase subunit SecE [Bacillus weihenstephanensis KBAB4] gi|229009604|ref|ZP_04166830.1| preprotein translocase subunit SecE [Bacillus mycoides DSM 2048] gi|229053941|ref|ZP_04195375.1| preprotein translocase subunit SecE [Bacillus cereus AH603] gi|229131102|ref|ZP_04260014.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-ST196] gi|229165083|ref|ZP_04292878.1| preprotein translocase subunit SecE [Bacillus cereus AH621] gi|163860300|gb|ABY41359.1| preprotein translocase, SecE subunit [Bacillus weihenstephanensis KBAB4] gi|228618346|gb|EEK75376.1| preprotein translocase subunit SecE [Bacillus cereus AH621] gi|228652315|gb|EEL08240.1| preprotein translocase subunit SecE [Bacillus cereus BDRD-ST196] gi|228721359|gb|EEL72880.1| preprotein translocase subunit SecE [Bacillus cereus AH603] gi|228751626|gb|EEM01426.1| preprotein translocase subunit SecE [Bacillus mycoides DSM 2048] Length = 59 Score = 48.3 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 23/59 (38%), Positives = 33/59 (55%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + NFF V E KK+ WP + E+L S VI + ++FF V+D I L+ ILG Sbjct: 1 MRLTNFFGDVGREMKKVSWPKKDELLRSTTTVIATVVFFAIFFAVVDMGISSLIRLILG 59 >gi|195952630|ref|YP_002120920.1| preprotein translocase, SecE subunit [Hydrogenobaculum sp. Y04AAS1] gi|195932242|gb|ACG56942.1| preprotein translocase, SecE subunit [Hydrogenobaculum sp. Y04AAS1] Length = 66 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 +LNF K+V+ E +K+ WP + V+ + + VII ++ ++D S ++ FI GI Sbjct: 3 KILNFLKEVKQELRKVSWPDKKLVIRATVSVIIFSLFFGIYLWIVDLSFTKILSFIFGI 61 >gi|119773341|ref|YP_926081.1| preprotein translocase subunit SecE [Shewanella amazonensis SB2B] gi|119765841|gb|ABL98411.1| protein translocase subunit secE/sec61 gamma [Shewanella amazonensis SB2B] Length = 123 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 32/63 (50%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V L F ++ E KK+ WP+R E L + +V+ ++ ++ +D + +++ I Sbjct: 61 VKGKQALAFARESHIEVKKVVWPTRQEALNTTFIVLAATAVLALILWGLDALLLKIVNLI 120 Query: 63 LGI 65 G+ Sbjct: 121 TGV 123 >gi|319944818|ref|ZP_08019081.1| preprotein translocase subunit SecE [Lautropia mirabilis ATCC 51599] gi|319741932|gb|EFV94356.1| preprotein translocase subunit SecE [Lautropia mirabilis ATCC 51599] Length = 128 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 9/51 (17%), Positives = 29/51 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 L F ++ E++++ WP++ E + V + + + ++F ++D + +++ Sbjct: 69 LAFLRESWQETRRVVWPTKKETWSVTLYVFLFVVVMAIFLWLVDSGLQFVL 119 >gi|291437862|ref|ZP_06577252.1| LOW QUALITY PROTEIN: preprotein translocase subunit SecE [Streptomyces ghanaensis ATCC 14672] gi|291340757|gb|EFE67713.1| LOW QUALITY PROTEIN: preprotein translocase subunit SecE [Streptomyces ghanaensis ATCC 14672] Length = 97 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+++ VII + I + D +G ++ G Sbjct: 44 FYRQIVAELRKVVWPTRNQLTSYTTAVIIFVVIMIGLVTLFDYGLGHAAKYVFG 97 >gi|325267344|ref|ZP_08134005.1| preprotein translocase [Kingella denitrificans ATCC 33394] gi|324981139|gb|EGC16790.1| preprotein translocase [Kingella denitrificans ATCC 33394] Length = 72 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 32/56 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + +FK+ E KK+ WP RS+ + V++ ++I ++F +D + L++ IL Sbjct: 15 LFRYFKESIAEFKKVVWPKRSDAVRMTGFVLVFVTIFAIFIYGVDSIMSLLINLIL 70 >gi|239929536|ref|ZP_04686489.1| preprotein translocase subunit SecE [Streptomyces ghanaensis ATCC 14672] Length = 95 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+++ VII + I + D +G ++ G Sbjct: 42 FYRQIVAELRKVVWPTRNQLTSYTTAVIIFVVIMIGLVTLFDYGLGHAAKYVFG 95 >gi|319778784|ref|YP_004129697.1| Preprotein translocase subunit SecE [Taylorella equigenitalis MCE9] gi|317108808|gb|ADU91554.1| Preprotein translocase subunit SecE [Taylorella equigenitalis MCE9] Length = 128 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 27/56 (48%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + L F +E K++ WP+R E +V ++ ++ +ID+ + W++ Sbjct: 65 KGKSTLAFANDAYNELKRVTWPTRKETFQMTGIVFAFAALMAILLWIIDKLLVWII 120 >gi|49476712|ref|YP_034447.1| preprotein translocase subunit SecE [Bacillus thuringiensis serovar konkukian str. 97-27] gi|49328268|gb|AAT58914.1| preprotein translocase secE subunit [Bacillus thuringiensis serovar konkukian str. 97-27] Length = 63 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 34/60 (56%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + + NFF V E KK+ WP + E+L S VI + ++FF V+D I L+ ILG+ Sbjct: 1 MRLTNFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAIFFAVVDMGISSLIRVILGL 60 >gi|323490599|ref|ZP_08095804.1| preprotein translocase subunit [Planococcus donghaensis MPA1U2] gi|323395691|gb|EGA88532.1| preprotein translocase subunit [Planococcus donghaensis MPA1U2] Length = 61 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 31/59 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + +FFK V E +K+ WP R E+ IVV+ ++FF V+D I L + + + Sbjct: 3 NIGSFFKNVVSEMRKVSWPKRKELTRYTIVVLATCIFMALFFTVVDAGISKLFRWFIAL 61 >gi|256545059|ref|ZP_05472426.1| preprotein translocase, SecE subunit [Anaerococcus vaginalis ATCC 51170] gi|256399262|gb|EEU12872.1| preprotein translocase, SecE subunit [Anaerococcus vaginalis ATCC 51170] Length = 60 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 33/53 (62%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK V E KKI WP+++E L ++VII+ I+ + ++D G ++ F++ Sbjct: 8 FFKSVSREFKKITWPTKNETLNYSLLVIIVSVITGLLIWLLDIVFGNMLGFLM 60 >gi|22297837|ref|NP_681084.1| preprotein translocase subunit SecE [Thermosynechococcus elongatus BP-1] gi|22294014|dbj|BAC07846.1| preprotein translocase SecE subunit [Thermosynechococcus elongatus BP-1] Length = 71 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 31/60 (51%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF++ ++E K+ WP R ++ VI+++S+S+ ++D+ WL I Sbjct: 12 RGFNLTEFFRETKEELNKVVWPDRQRLIGESAAVILIVSLSAAVIYLVDELFRWLATLIF 71 >gi|213965027|ref|ZP_03393226.1| preprotein translocase subunit SecE [Corynebacterium amycolatum SK46] gi|213952563|gb|EEB63946.1| preprotein translocase subunit SecE [Corynebacterium amycolatum SK46] Length = 102 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 29/58 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F KQV DE +K+ WP+ +++ I+VI+ L +D G + +LG Sbjct: 44 NPVVFIKQVVDELRKVIWPTGRQMVTYSIIVILFLIAMIALVWGVDTLAGLGVRSVLG 101 >gi|90417548|ref|ZP_01225469.1| secretion protein SecE [marine gamma proteobacterium HTCC2207] gi|90330640|gb|EAS45930.1| secretion protein SecE [marine gamma proteobacterium HTCC2207] Length = 122 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 27/49 (55%) Query: 16 RDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R E +K+ WP++ E + ++V+ ++ + S+ ID + W I+G Sbjct: 74 RTELRKVVWPTKQERNQTTLIVVAVILLMSLILWGIDSLLSWGAAQIMG 122 >gi|317126841|ref|YP_004093123.1| preprotein translocase, SecE subunit [Bacillus cellulosilyticus DSM 2522] gi|315471789|gb|ADU28392.1| preprotein translocase, SecE subunit [Bacillus cellulosilyticus DSM 2522] Length = 59 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 30/59 (50%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F K V E K++ WP R E++ VVI ++ +V+F + D I L+ IL Sbjct: 1 MGATKFLKDVSTEMKRVSWPKRKELVRYTGVVIATVAFVAVYFAITDFGISELIRAILN 59 >gi|293602654|ref|ZP_06685096.1| preprotein translocase [Achromobacter piechaudii ATCC 43553] gi|292818964|gb|EFF78003.1| preprotein translocase [Achromobacter piechaudii ATCC 43553] Length = 126 Score = 48.3 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 32/56 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F + +E K++ WP+R E +V +++ +F V+D+ I W+++ +L Sbjct: 67 TLSFASESYNEVKRVAWPTRKETTQMTGIVFAFVAVMGIFMWVLDKGIEWILYGLL 122 >gi|251793504|ref|YP_003008233.1| preprotein translocase subunit SecE [Aggregatibacter aphrophilus NJ8700] gi|247534900|gb|ACS98146.1| preprotein translocase subunit SecE [Aggregatibacter aphrophilus NJ8700] Length = 136 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 27/52 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FFK R E +KI WP+R E + +V+ + S+ +D I ++ F+ Sbjct: 80 FFKDSRTELRKIVWPTRPEATQTTFMVVGVTVFVSLILWGLDSIIVRIITFL 131 >gi|157960001|ref|YP_001500035.1| preprotein translocase subunit SecE [Shewanella pealeana ATCC 700345] gi|157845001|gb|ABV85500.1| preprotein translocase, SecE subunit [Shewanella pealeana ATCC 700345] Length = 123 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 32/57 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F ++ + E +K+ WP+R E L + +V+ ++ + +D + +++FI G+ Sbjct: 67 LTFARESQIEVRKVVWPTRQEALNTTFIVLAATAVLGLILWGLDAVLLRIVNFITGV 123 >gi|300779869|ref|ZP_07089725.1| preprotein translocase subunit SecE [Corynebacterium genitalium ATCC 33030] gi|300533979|gb|EFK55038.1| preprotein translocase subunit SecE [Corynebacterium genitalium ATCC 33030] Length = 107 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 29/57 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L F +V E +K+ WP+ S+++ ++V L + + +DQ W++ IL Sbjct: 49 GPLAFPGEVVGEMRKVVWPTGSQMVNYTLIVFGFLIVLTALVWGVDQGAAWVVERIL 105 >gi|313679511|ref|YP_004057250.1| protein translocase subunit sece/sec61 gamma [Oceanithermus profundus DSM 14977] gi|313152226|gb|ADR36077.1| protein translocase subunit secE/sec61 gamma [Oceanithermus profundus DSM 14977] Length = 60 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ +F++ R E ++ WPSR E++ S V++ S F + D + G +M IL Sbjct: 3 KIITYFREARAELARVSWPSRDEIIQSTEAVLLFTLFSMTIFWIYDMAFGAVMQRIL 59 >gi|291565934|dbj|BAI88206.1| putative preprotein translocase, SecE subunit [Arthrospira platensis NIES-39] Length = 74 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 30/61 (49%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +V F K ++E K+ WP+R ++L V++M+ +S+ +ID W + Sbjct: 14 KGFSVGGFLKGTKEELDKVVWPTRQQLLSESAGVLLMVMLSATLIYLIDNFFRWSSGQVF 73 Query: 64 G 64 G Sbjct: 74 G 74 >gi|187925630|ref|YP_001897272.1| preprotein translocase subunit SecE [Burkholderia phytofirmans PsJN] gi|187716824|gb|ACD18048.1| preprotein translocase, SecE subunit [Burkholderia phytofirmans PsJN] Length = 126 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 28/51 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + F K E +K+ WP+R E + +VV + + ++F + D+SI W + Sbjct: 68 IAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVFVMAIFLWIGDKSIEWAI 118 >gi|88704397|ref|ZP_01102111.1| Preprotein translocase secE subunit [Congregibacter litoralis KT71] gi|88701448|gb|EAQ98553.1| Preprotein translocase secE subunit [Congregibacter litoralis KT71] Length = 120 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 33/62 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + + K R E +K+ WP+R E + + ++V+ + + ++ +D +GWL+ + Sbjct: 59 AKGASFWSLVKGSRTEIRKVVWPTRQETVQTTMIVVAFVLVVALILWGLDSFLGWLVSLV 118 Query: 63 LG 64 +G Sbjct: 119 IG 120 >gi|145588229|ref|YP_001154826.1| preprotein translocase, SecE subunit [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] gi|145046635|gb|ABP33262.1| protein translocase subunit secE/sec61 gamma [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] Length = 125 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 29/55 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + K E KK+ WP+R E +VV + I S+F + D+ I WL+ +L Sbjct: 67 IAYAKDSWYEVKKVVWPTRKETTQMTLVVFGFVLIMSLFLWIADKLIEWLVFSVL 121 >gi|90581319|ref|ZP_01237116.1| translocase [Vibrio angustum S14] gi|330444935|ref|ZP_08308589.1| preprotein translocase, SecE subunit [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] gi|90437558|gb|EAS62752.1| translocase [Vibrio angustum S14] gi|328493053|dbj|GAA03086.1| preprotein translocase, SecE subunit [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] Length = 125 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 30/63 (47%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A + F + R E +K+ WP+R E + +V+ + + ++ ID + L+ + Sbjct: 63 AKGKAAIRFASESRMEVRKVVWPTRQEATQTTFIVLAVTVVMALALWGIDGIMVRLVRLV 122 Query: 63 LGI 65 G+ Sbjct: 123 TGV 125 >gi|313892994|ref|ZP_07826571.1| preprotein translocase, SecE subunit [Veillonella sp. oral taxon 158 str. F0412] gi|313442347|gb|EFR60762.1| preprotein translocase, SecE subunit [Veillonella sp. oral taxon 158 str. F0412] Length = 73 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 31/60 (51%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R FF+ V+ E KK+ WP++ E++ IVV ++ ++ V+D L + +L Sbjct: 10 QRGGFGKFFRGVKAELKKVVWPTKKELINYTIVVFLVTIFIALVIAVLDGLFAQLFNTLL 69 >gi|291295567|ref|YP_003506965.1| preprotein translocase subunit SecE [Meiothermus ruber DSM 1279] gi|290470526|gb|ADD27945.1| preprotein translocase, SecE subunit [Meiothermus ruber DSM 1279] Length = 72 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 31/51 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 ++N+F++ R E ++ WPSR EV+ S V+++ ++ V +ID ++ Sbjct: 17 IINYFREARAELTRVTWPSRQEVIESTQVILVFAVVAMVVLGLIDTIFRFI 67 >gi|269798567|ref|YP_003312467.1| preprotein translocase subunit SecE [Veillonella parvula DSM 2008] gi|282849077|ref|ZP_06258465.1| preprotein translocase, SecE subunit [Veillonella parvula ATCC 17745] gi|269095196|gb|ACZ25187.1| preprotein translocase, SecE subunit [Veillonella parvula DSM 2008] gi|282581195|gb|EFB86590.1| preprotein translocase, SecE subunit [Veillonella parvula ATCC 17745] Length = 73 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 31/60 (51%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R FF+ V+ E KK+ WP++ E++ IVV ++ ++ V+D L + +L Sbjct: 10 QRGGFGKFFRGVKAELKKVVWPTKKELINYTIVVFLVTIFIALIISVLDGLFAQLFNTLL 69 >gi|188584821|ref|YP_001916366.1| preprotein translocase, SecE subunit [Natranaerobius thermophilus JW/NM-WN-LF] gi|179349508|gb|ACB83778.1| preprotein translocase, SecE subunit [Natranaerobius thermophilus JW/NM-WN-LF] Length = 63 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 34/55 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L F ++ + E KK+ WP+R +++ VV++ ++I V+F ++D + ++ ++ Sbjct: 8 LKFLRETKIELKKVNWPNRQQLITYTGVVLMTVAIVGVYFWILDTAFIGIIQLMI 62 >gi|125975200|ref|YP_001039110.1| preprotein translocase, SecE subunit [Clostridium thermocellum ATCC 27405] gi|256003138|ref|ZP_05428130.1| preprotein translocase, SecE subunit [Clostridium thermocellum DSM 2360] gi|281419561|ref|ZP_06250572.1| preprotein translocase, SecE subunit [Clostridium thermocellum JW20] gi|125715425|gb|ABN53917.1| preprotein translocase, SecE subunit [Clostridium thermocellum ATCC 27405] gi|255992829|gb|EEU02919.1| preprotein translocase, SecE subunit [Clostridium thermocellum DSM 2360] gi|281406783|gb|EFB37050.1| preprotein translocase, SecE subunit [Clostridium thermocellum JW20] gi|316939364|gb|ADU73398.1| preprotein translocase, SecE subunit [Clostridium thermocellum DSM 1313] Length = 80 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 31/53 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +FK V++E K++ WP+RS+++ + I V+I+ I V + D G L I Sbjct: 27 KYFKDVKNELKRVIWPTRSQLINNTITVLILCFIVGVLIWLFDLGFGALSSLI 79 >gi|269137528|ref|YP_003294228.1| preprotein translocase subunit SecE [Edwardsiella tarda EIB202] gi|267983188|gb|ACY83017.1| preprotein translocase subunit SecE [Edwardsiella tarda EIB202] gi|304557601|gb|ADM40265.1| Preprotein translocase subunit SecE [Edwardsiella tarda FL6-60] Length = 111 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ ++ +D + L+ Sbjct: 45 MTAQGKATVAFAREARTEMRKVIWPTRQEALHTTLIVAAVTAVMALILWGLDGILVRLVS 104 Query: 61 FILGI 65 FI G+ Sbjct: 105 FITGL 109 >gi|158336004|ref|YP_001517178.1| hypothetical protein AM1_2863 [Acaryochloris marina MBIC11017] gi|158306245|gb|ABW27862.1| conserved domain protein [Acaryochloris marina MBIC11017] Length = 90 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F + ++E +K+ WP R +++ I V +M+S+S+ F ID W+ + G Sbjct: 37 FLQGTKEELEKVVWPDRQQLISESIAVFLMVSLSAFIFSFIDNLFRWVSTLVFG 90 >gi|329897157|ref|ZP_08271898.1| Preprotein translocase subunit SecE (TC 3.A.5.1.1) [gamma proteobacterium IMCC3088] gi|328921374|gb|EGG28767.1| Preprotein translocase subunit SecE (TC 3.A.5.1.1) [gamma proteobacterium IMCC3088] Length = 120 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 12/61 (19%), Positives = 32/61 (52%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + + R E +K+ WP+R E + + ++V+ + + ++ +D +GWL+ ++ Sbjct: 60 KGHSAWSLIRGARTEIRKVVWPTRQETVQTTLIVVAFVLVVALILWGLDSLLGWLVSLVI 119 Query: 64 G 64 Sbjct: 120 A 120 >gi|24371816|ref|NP_715858.1| preprotein translocase subunit SecE [Shewanella oneidensis MR-1] gi|24345621|gb|AAN53303.1|AE015471_8 preprotein translocase, SecE subunit [Shewanella oneidensis MR-1] Length = 123 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 32/62 (51%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L F ++ + E +K+ WP+R E L + +V+ I ++ +D + +++FI Sbjct: 62 KGKKALAFARESQIEVRKVVWPTRQEALNTTFIVLAATGILALILWGMDAVLMRIVNFIT 121 Query: 64 GI 65 G+ Sbjct: 122 GV 123 >gi|126090326|ref|YP_001041769.1| preprotein translocase subunit SecE [Shewanella baltica OS155] gi|152998736|ref|YP_001364417.1| preprotein translocase subunit SecE [Shewanella baltica OS185] gi|160873313|ref|YP_001552629.1| preprotein translocase subunit SecE [Shewanella baltica OS195] gi|217975214|ref|YP_002359965.1| preprotein translocase subunit SecE [Shewanella baltica OS223] gi|304412752|ref|ZP_07394354.1| preprotein translocase, SecE subunit [Shewanella baltica OS183] gi|307307416|ref|ZP_07587151.1| preprotein translocase, SecE subunit [Shewanella baltica BA175] gi|125999946|gb|ABN64014.1| preprotein translocase, SecE subunit [Shewanella baltica OS155] gi|151363354|gb|ABS06354.1| preprotein translocase, SecE subunit [Shewanella baltica OS185] gi|160858835|gb|ABX47369.1| preprotein translocase, SecE subunit [Shewanella baltica OS195] gi|217500349|gb|ACK48542.1| preprotein translocase, SecE subunit [Shewanella baltica OS223] gi|304348832|gb|EFM13248.1| preprotein translocase, SecE subunit [Shewanella baltica OS183] gi|306910204|gb|EFN40637.1| preprotein translocase, SecE subunit [Shewanella baltica BA175] gi|315265540|gb|ADT92393.1| preprotein translocase, SecE subunit [Shewanella baltica OS678] Length = 123 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 32/63 (50%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V L F ++ E +K+ WP+R E L + +V+ I ++ +D + +++FI Sbjct: 61 VKGKKALAFAREAHIEVRKVVWPTRQEALNTTFIVLAATGILALILWGMDAVLMRIVNFI 120 Query: 63 LGI 65 G+ Sbjct: 121 TGV 123 >gi|16330013|ref|NP_440741.1| secretory protein SecE [Synechocystis sp. PCC 6803] gi|585980|sp|P38382|SECE_SYNY3 RecName: Full=Preprotein translocase subunit secE gi|1652500|dbj|BAA17421.1| secretory protein; SecE [Synechocystis sp. PCC 6803] Length = 81 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 29/57 (50%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 NF +DE K+ WPSR +++ + VI+M+ + S +DQ GW+ G Sbjct: 25 NFIAATKDELAKVVWPSRQQLISESVAVILMVILVSTVIYFVDQIFGWITKQPFLFG 81 >gi|311029033|ref|ZP_07707123.1| preprotein translocase subunit SecE [Bacillus sp. m3-13] Length = 60 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 30/55 (54%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF+ V E KK+ WP R E+ I V+ + +VFF VID I L+ ++ Sbjct: 6 NFFRDVAREMKKVSWPKRQELTRYTITVVTTVLFVAVFFWVIDLGISELIRALIN 60 >gi|269926930|ref|YP_003323553.1| preprotein translocase, SecE subunit [Thermobaculum terrenum ATCC BAA-798] gi|269790590|gb|ACZ42731.1| preprotein translocase, SecE subunit [Thermobaculum terrenum ATCC BAA-798] Length = 76 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFF-LVIDQSIGWLMHFIL 63 R + F++ R E +K+ WP+R EV+ IVVI++ ++F +++D WL I Sbjct: 15 RSNLSKFYEDTRAEIRKVSWPTRDEVIRLSIVVIVLSVSMAIFLGVIVDGIFLWLYRLIG 74 Query: 64 GI 65 GI Sbjct: 75 GI 76 >gi|168187828|ref|ZP_02622463.1| preprotein translocase, SecE subunit [Clostridium botulinum C str. Eklund] gi|169294355|gb|EDS76488.1| preprotein translocase, SecE subunit [Clostridium botulinum C str. Eklund] Length = 73 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 31/63 (49%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + + + F K+++ E+K+I WP + EV S I+V+ +S+ ++D L Sbjct: 11 KQSSVGIGKFLKELKAETKRITWPPKEEVKKSTIIVLFFCVVSAFIIGLMDSGFNGLYKI 70 Query: 62 ILG 64 I Sbjct: 71 IFK 73 >gi|260203808|ref|ZP_05771299.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis K85] gi|289573242|ref|ZP_06453469.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis K85] gi|289537673|gb|EFD42251.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis K85] Length = 161 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 27/57 (47%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R ++L VV+ L D + L+ + G Sbjct: 105 VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLPFMVALVAGADLGLTKLVMLVFG 161 >gi|212702090|ref|ZP_03310218.1| hypothetical protein DESPIG_00097 [Desulfovibrio piger ATCC 29098] gi|212674495|gb|EEB34978.1| hypothetical protein DESPIG_00097 [Desulfovibrio piger ATCC 29098] Length = 78 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 28/57 (49%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + + R E +K+ WP+ E + V+ +++ ++ ++D + ++ IL Sbjct: 22 LAQYIEDSRGELRKVTWPTLKETRKATFAVLGFVAVMAIVLGLVDLGLSAIIKSILS 78 >gi|257069527|ref|YP_003155782.1| preprotein translocase, SecE subunit [Brachybacterium faecium DSM 4810] gi|256560345|gb|ACU86192.1| preprotein translocase, SecE subunit [Brachybacterium faecium DSM 4810] Length = 88 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 30/60 (50%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 LA+ F +QV E +K+ P+R E+++ I V++ + + +D + WL + Sbjct: 26 LAIGLFIRQVIAELRKVVVPTRRELVLYSITVLLFVVFMILLIFGLDAAFSWLSRIAFTV 85 >gi|116671542|ref|YP_832475.1| preprotein translocase subunit SecE [Arthrobacter sp. FB24] gi|116611651|gb|ABK04375.1| protein translocase subunit secE/sec61 gamma [Arthrobacter sp. FB24] Length = 107 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 32/57 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QV E KK+ P+R E++ +VV++ + I + V+D + G + ++ G Sbjct: 44 IALFIRQVIGELKKVVAPTRKELINYTLVVLVFVIIMMLIVTVLDLAFGTGVSWVFG 100 >gi|254823018|ref|ZP_05228019.1| preprotein translocase subunit SecE [Mycobacterium intracellulare ATCC 13950] Length = 151 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R ++L VV+ L+ + D + L+ + G Sbjct: 95 VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLTKLVLLVFG 151 >gi|261417592|ref|YP_003251274.1| preprotein translocase subunit SecE [Geobacillus sp. Y412MC61] gi|297528467|ref|YP_003669742.1| preprotein translocase, SecE subunit [Geobacillus sp. C56-T3] gi|319765250|ref|YP_004130751.1| preprotein translocase, SecE subunit [Geobacillus sp. Y412MC52] gi|261374049|gb|ACX76792.1| preprotein translocase, SecE subunit [Geobacillus sp. Y412MC61] gi|297251719|gb|ADI25165.1| preprotein translocase, SecE subunit [Geobacillus sp. C56-T3] gi|317110116|gb|ADU92608.1| preprotein translocase, SecE subunit [Geobacillus sp. Y412MC52] Length = 60 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 34/56 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V+NF K+V E KK+ WP+R E++ VV+ ++ +VFF V+D I L+ + Sbjct: 4 VINFLKEVVRELKKVSWPNRKELVNYTAVVLATVAFFTVFFAVVDLGISELIRLVF 59 >gi|319761180|ref|YP_004125117.1| preprotein translocase, sece subunit [Alicycliphilus denitrificans BC] gi|330823040|ref|YP_004386343.1| preprotein translocase subunit SecE [Alicycliphilus denitrificans K601] gi|317115741|gb|ADU98229.1| preprotein translocase, SecE subunit [Alicycliphilus denitrificans BC] gi|329308412|gb|AEB82827.1| preprotein translocase, SecE subunit [Alicycliphilus denitrificans K601] Length = 127 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 26/49 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 F + E KK+ WP+R E L V + + ++F + D+++ W++ Sbjct: 70 FSRDAWREVKKVVWPTRKETLQMTGYVFAFVVLMALFLWLTDKTLEWVL 118 >gi|225024699|ref|ZP_03713891.1| hypothetical protein EIKCOROL_01585 [Eikenella corrodens ATCC 23834] gi|224942525|gb|EEG23734.1| hypothetical protein EIKCOROL_01585 [Eikenella corrodens ATCC 23834] Length = 148 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 29/56 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + K E KK+ WP ++E + V+I ++ ++F ++D + WL I Sbjct: 91 GLIRYIKDSVVEIKKVVWPPKNEAWRNTFFVLIFTAVLTLFLWLVDSFLVWLFTKI 146 >gi|90407971|ref|ZP_01216144.1| Preprotein translocase subunit SecE [Psychromonas sp. CNPT3] gi|90310909|gb|EAS39021.1| Preprotein translocase subunit SecE [Psychromonas sp. CNPT3] Length = 126 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 12/62 (19%), Positives = 29/62 (46%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M + F R E +K+ WP+R E + + ++++ + +I + +D ++ Sbjct: 61 MTEKGKTFIEFATDARSEVRKVVWPTRQETVQTTLIILAVSTIVGLILWGLDGIFVRVIE 120 Query: 61 FI 62 +I Sbjct: 121 YI 122 >gi|167817769|ref|ZP_02449449.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 91] Length = 110 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M + + + F K E +K+ WP+R E + +VV + + ++F + D+SI W + Sbjct: 44 MSLPGKSFIAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEWAI 102 >gi|163859292|ref|YP_001633590.1| preprotein translocase subunit SecE [Bordetella petrii DSM 12804] gi|163263020|emb|CAP45323.1| secE [Bordetella petrii] Length = 126 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 32/56 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F + +E+K++ WP+R E +V ++I + V+D+ I W+++ +L Sbjct: 67 TLSFANESYNEAKRVSWPTRKETTQMTGIVFAFVAIMGLLMWVLDKGIEWILYGLL 122 >gi|71278783|ref|YP_271422.1| preprotein translocase subunit SecE [Colwellia psychrerythraea 34H] gi|71144523|gb|AAZ24996.1| preprotein translocase, SecE subunit [Colwellia psychrerythraea 34H] Length = 126 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 32/55 (58%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K+ R E +K+ WP+R E + + +V+++ + S+ +D + WL+ + G+ Sbjct: 70 FAKEARTEVRKVVWPTRQEAVQTTGIVLVVTLLMSLLLWGLDSVLFWLVGLVTGM 124 >gi|291544033|emb|CBL17142.1| preprotein translocase, SecE subunit, bacterial [Ruminococcus sp. 18P13] Length = 80 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 32/57 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + +F+ ++ E KK+ WP+R V + +VV++ + ++++F +D + L L Sbjct: 22 GIAKWFRDLKSEFKKVSWPTRKTVFDNTVVVLVTMLLTALFVGGLDAGLLKLFELAL 78 >gi|312795755|ref|YP_004028677.1| protein translocase subunit secE [Burkholderia rhizoxinica HKI 454] gi|312167530|emb|CBW74533.1| Protein translocase subunit secE [Burkholderia rhizoxinica HKI 454] Length = 126 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM-HFILG 64 + F K E +K+ WP+R E + +VV + + +++ V D++I W++ ILG Sbjct: 68 IAFAKDSYREVRKVVWPTRKEAGQTTLVVFGFVLVMAIYLWVSDKTIEWVIFSLILG 124 >gi|295677946|ref|YP_003606470.1| preprotein translocase, SecE subunit [Burkholderia sp. CCGE1002] gi|295437789|gb|ADG16959.1| preprotein translocase, SecE subunit [Burkholderia sp. CCGE1002] Length = 111 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 28/51 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + F K E +K+ WP+R E + +VV + + ++F V D+SI W + Sbjct: 53 IAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVVVMAIFLWVCDKSIEWAI 103 >gi|120613170|ref|YP_972848.1| preprotein translocase subunit SecE [Acidovorax citrulli AAC00-1] gi|120591634|gb|ABM35074.1| protein translocase subunit secE/sec61 gamma [Acidovorax citrulli AAC00-1] Length = 128 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K E KK+ WP+R E L V + + ++F D+++ W+++ ++ Sbjct: 71 FAKDAWKEVKKVVWPTRKETLQMTAYVFAFVLVMALFLWFTDKTLEWVLYDLI 123 >gi|268316662|ref|YP_003290381.1| preprotein translocase, SecE subunit [Rhodothermus marinus DSM 4252] gi|262334196|gb|ACY47993.1| preprotein translocase, SecE subunit [Rhodothermus marinus DSM 4252] Length = 62 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 35/56 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ ++V E +K+ WPSR E++ + I+ ++ ++ ++F + D+ I ++ FI + Sbjct: 7 DYLQEVYREMQKVSWPSRQELINNTILTLVASTVLALFIFLADRVIATVLEFIYSL 62 >gi|193213528|ref|YP_001999481.1| preprotein translocase subunit SecE [Chlorobaculum parvum NCIB 8327] gi|193087005|gb|ACF12281.1| preprotein translocase, SecE subunit [Chlorobaculum parvum NCIB 8327] Length = 63 Score = 47.5 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 30/54 (55%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +++ V E +K+ WP+R EV +VV+ + I ++F +D I +M IL Sbjct: 10 KYYRDVVSEMRKVSWPTRDEVKDMTVVVLTVSGILALFTFSVDWVISTVMGKIL 63 >gi|307691691|ref|ZP_07633928.1| preprotein translocase, SecE subunit [Ruminococcaceae bacterium D16] Length = 99 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 32/58 (55%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + +F++++ E KK+ WP+ + L + ++VI + VF + D G L+ ++ + Sbjct: 39 IGRWFRELKVELKKVVWPTGKQTLNNTLIVIACVVFVGVFIWIFDAVAGGLIQALIHL 96 >gi|83814677|ref|YP_445882.1| preprotein translocase, SecE subunit, putative [Salinibacter ruber DSM 13855] gi|83756071|gb|ABC44184.1| preprotein translocase, SecE subunit, putative [Salinibacter ruber DSM 13855] Length = 100 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 30/60 (50%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + + + V E +K+ WP R E++ S ++ I+ I S F + DQ I ++ + + Sbjct: 41 TWIREYLENVVAEMEKVNWPGRDELISSTLITIVATLIVSGFIFLADQVIQRILEILYRV 100 >gi|1711363|sp|P52853|SECE_STRGB RecName: Full=Preprotein translocase subunit secE gi|1213237|emb|CAA65164.1| membrane translocase [Streptomyces galbus] Length = 94 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F++Q+ E +K+ WP+R+++ VVI ++I VID + ++ G Sbjct: 38 LATFYRQIIAELRKVVWPTRNQLTSYTTVVIFFVAIMIRLVTVIDYGLNHAAKYVFG 94 >gi|145596450|ref|YP_001160747.1| preprotein translocase, SecE subunit [Salinispora tropica CNB-440] gi|145305787|gb|ABP56369.1| preprotein translocase, SecE subunit [Salinispora tropica CNB-440] Length = 126 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 12/48 (25%), Positives = 25/48 (52%) Query: 17 DESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 E +K+ WP+R E+L VVI+ +++ +D + + ++ G Sbjct: 76 AELRKVIWPTRKELLTYASVVIVFVAVMLAIVAGLDLAFAEGVLWVFG 123 >gi|70727473|ref|YP_254389.1| preprotein translocase subunit SecE [Staphylococcus haemolyticus JCSC1435] gi|68448199|dbj|BAE05783.1| preprotein translocase subunit SecE [Staphylococcus haemolyticus JCSC1435] Length = 66 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 29/51 (56%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 FF+ V+ E +K WP++ E+ ++V+ + VFF V+D IG L+ Sbjct: 14 FFQGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFMVFFWVLDIGIGNLIEL 64 >gi|320108602|ref|YP_004184192.1| preprotein translocase subunit SecE [Terriglobus saanensis SP1PR4] gi|319927123|gb|ADV84198.1| preprotein translocase, SecE subunit [Terriglobus saanensis SP1PR4] Length = 86 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 32/54 (59%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F + VR+E+KK+ P+ +EV + IVV++ + + + +F V+D + +L Sbjct: 27 TFLEDVRNETKKLSTPTGAEVKSTTIVVLVTVFVFAAYFAVVDYIASHTVGALL 80 >gi|218290030|ref|ZP_03494197.1| preprotein translocase, SecE subunit [Alicyclobacillus acidocaldarius LAA1] gi|218239864|gb|EED07052.1| preprotein translocase, SecE subunit [Alicyclobacillus acidocaldarius LAA1] Length = 77 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 28/60 (46%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 R ++ FFK+ E K++ WP R EV+V +++ +I V D + M I Sbjct: 15 AKRTGIVAFFKESFRELKRVRWPKRREVIVYTAACLLVCAILGVLIWAFDIGVSAAMSAI 74 >gi|152973942|ref|YP_001373459.1| preprotein translocase subunit SecE [Bacillus cereus subsp. cytotoxis NVH 391-98] gi|152022694|gb|ABS20464.1| preprotein translocase, SecE subunit [Bacillus cytotoxicus NVH 391-98] Length = 59 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 32/58 (55%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + NFF V E KK+ WP + E+L S VI + ++FF V+D I L+ IL Sbjct: 1 MRLTNFFGDVSREMKKVSWPKKDELLRSTATVIATVIFFAIFFAVVDMGISSLIRLIL 58 >gi|95930699|ref|ZP_01313432.1| SecE subunit of protein translocation complex [Desulfuromonas acetoxidans DSM 684] gi|95133179|gb|EAT14845.1| SecE subunit of protein translocation complex [Desulfuromonas acetoxidans DSM 684] Length = 61 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F V+ E K+ WP+R + S +VVI + + +VF +D + L+ +L Sbjct: 8 FLGNVKSELIKVTWPTRKDTYASTVVVIAFVLLVAVFLWGVDNILSVLVKNLLS 61 >gi|56418626|ref|YP_145944.1| preprotein translocase subunit SecE [Geobacillus kaustophilus HTA426] gi|56378468|dbj|BAD74376.1| preprotein translocase subunit [Geobacillus kaustophilus HTA426] Length = 61 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 34/56 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V+NF K+V E KK+ WP+R E++ VV+ ++ +VFF V+D I L+ + Sbjct: 5 VINFLKEVVRELKKVSWPNRKELVNYTAVVLATVAFFTVFFAVVDLGISELIRLVF 60 >gi|169333757|ref|ZP_02860950.1| hypothetical protein ANASTE_00141 [Anaerofustis stercorihominis DSM 17244] gi|169259606|gb|EDS73572.1| hypothetical protein ANASTE_00141 [Anaerofustis stercorihominis DSM 17244] Length = 79 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 34/55 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 +V NFF+ V E KK+ WP++ E++ IVV+++ ++ ++F +D +G L Sbjct: 24 SVSNFFRGVSVELKKVTWPTKDELIQYTIVVVVICAVLTLFIWGLDTVLGLLKGL 78 >gi|187251896|ref|YP_001876378.1| preprotein translocase subunit SecE [Elusimicrobium minutum Pei191] gi|186972056|gb|ACC99041.1| preprotein translocase, SecE subunit [Elusimicrobium minutum Pei191] Length = 63 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 32/60 (53%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 ++ F + E KK W SR EV+ S I+V I++ +++++ ID + + ++ G Sbjct: 3 KIIKFSHEAYAELKKSKWLSRQEVVQSTILVGIVVFLAAIYVFAIDWGLAKAIGALVNRG 62 >gi|138893770|ref|YP_001124223.1| preprotein translocase subunit SecE [Geobacillus thermodenitrificans NG80-2] gi|196251120|ref|ZP_03149799.1| preprotein translocase, SecE subunit [Geobacillus sp. G11MC16] gi|134265283|gb|ABO65478.1| Preprotein translocase SecE subunit [Geobacillus thermodenitrificans NG80-2] gi|196209361|gb|EDY04141.1| preprotein translocase, SecE subunit [Geobacillus sp. G11MC16] Length = 60 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 22/54 (40%), Positives = 33/54 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NFFK+V E KK+ WP+R E++ VV+ ++ +VFF VID I L+ + Sbjct: 6 NFFKEVVRELKKVSWPNRKELVNYTAVVLATVAFFTVFFAVIDLGISQLIRLVF 59 >gi|300857720|ref|YP_003782703.1| preprotein translocase subunit [Corynebacterium pseudotuberculosis FRC41] gi|300685174|gb|ADK28096.1| preprotein translocase subunit [Corynebacterium pseudotuberculosis FRC41] gi|302205462|gb|ADL09804.1| Preprotein translocase subunit SecE [Corynebacterium pseudotuberculosis C231] gi|302330015|gb|ADL20209.1| Preprotein translocase subunit SecE [Corynebacterium pseudotuberculosis 1002] gi|308275698|gb|ADO25597.1| Preprotein translocase subunit SecE [Corynebacterium pseudotuberculosis I19] Length = 108 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 28/62 (45%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G V+ F +V E KK+ WP+ +++ ++V L + + +D G + Sbjct: 45 GKKNNKVVAFVPEVASEMKKVIWPTAKQMINYTLIVFAFLILMTALVAGVDFVAGLGVEK 104 Query: 62 IL 63 +L Sbjct: 105 VL 106 >gi|15603610|ref|NP_246684.1| preprotein translocase subunit SecE [Pasteurella multocida subsp. multocida str. Pm70] gi|12722160|gb|AAK03829.1| SecE [Pasteurella multocida subsp. multocida str. Pm70] Length = 136 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 30/55 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF + R E +KI WP+R E + + ++V + + S+ +D I L+ F+ + Sbjct: 80 FFSESRIELRKIVWPTRPEAMQTTLIVAGVTIVVSLILWGLDSVIVALITFLTDL 134 >gi|205372083|ref|ZP_03224900.1| preprotein translocase subunit SecE [Bacillus coahuilensis m4-4] Length = 59 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 28/57 (49%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+ V E KK WP R E+ I VI + ++FF +D I LM IL Sbjct: 3 NIAKFFRNVSLEMKKTSWPKRKELTRYTITVISTVVFVALFFAAVDFGISTLMDLIL 59 >gi|15828021|ref|NP_302284.1| preprotein translocase subunit SecE [Mycobacterium leprae TN] gi|221230498|ref|YP_002503914.1| preprotein translocase subunit SecE [Mycobacterium leprae Br4923] gi|14548259|sp|Q9CBJ9|SECE_MYCLE RecName: Full=Probable preprotein translocase subunit secE gi|13093574|emb|CAC30861.1| SecE preprotein translocase [Mycobacterium leprae] gi|219933605|emb|CAR72003.1| SecE preprotein translocase [Mycobacterium leprae Br4923] Length = 146 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + N+ KQV E +K+ WP+R ++L VV+ L+ + D + L+ + G Sbjct: 90 IYNYLKQVVGEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLAKLVLLVFG 146 >gi|330976627|gb|EGH76671.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. aptata str. DSM 50252] Length = 122 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 31/52 (59%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ R E +K+ WP+R E + ++V+ + + ++ +D +GWL+ I+G Sbjct: 71 KEARAEIRKVVWPTRQETTQTTLIVVAGVLVMALLLWGLDSLLGWLVSLIVG 122 >gi|114331778|ref|YP_748000.1| preprotein translocase subunit SecE [Nitrosomonas eutropha C91] gi|114308792|gb|ABI60035.1| protein translocase subunit secE/sec61 gamma [Nitrosomonas eutropha C91] Length = 114 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 31/56 (55%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + +FFK +E KK+ WP++ E L + VV + + F ++D + ++ +++ Sbjct: 55 LFSFFKDSIEEVKKVVWPTKKETLQTSGVVCAFVITMAFFLWIVDSGLMVIVKYVM 110 >gi|74316410|ref|YP_314150.1| preprotein translocase subunit SecE [Thiobacillus denitrificans ATCC 25259] gi|74055905|gb|AAZ96345.1| SecE subunit of protein translocation complex [Thiobacillus denitrificans ATCC 25259] Length = 115 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 31/58 (53%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F RDE+KK+ WP+R E + VV+ + + ++F +D + WL+ +G G Sbjct: 57 FRFALDSRDEAKKVVWPTRKETIQMTGVVMAFVVVMALFLWAVDGVLLWLVKLAMGQG 114 >gi|254516892|ref|ZP_05128950.1| preprotein translocase, SecE subunit [gamma proteobacterium NOR5-3] gi|219674397|gb|EED30765.1| preprotein translocase, SecE subunit [gamma proteobacterium NOR5-3] Length = 120 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 33/62 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + + K R E +K+ WP+R E + + ++V+ + + ++ +D +GWL+ + Sbjct: 59 AKGASFWSLVKGSRTEIRKVVWPTRQETVQTTMIVVAFVLVVALILWGLDSFLGWLVSLV 118 Query: 63 LG 64 +G Sbjct: 119 IG 120 >gi|226355466|ref|YP_002785206.1| preprotein translocase subunit SecE [Deinococcus deserti VCD115] gi|226317456|gb|ACO45452.1| putative Preprotein translocase secE subunit [Deinococcus deserti VCD115] Length = 59 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 29/59 (49%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + ++ +F+ R E ++ WPSR +VL V+I + ++ +D L+ +L Sbjct: 1 MNLIQYFRDSRAELSRVSWPSRQQVLDGTQAVLIFVVALTLIVFALDLLFSNLIKAVLA 59 >gi|238018606|ref|ZP_04599032.1| hypothetical protein VEIDISOL_00441 [Veillonella dispar ATCC 17748] gi|237865077|gb|EEP66367.1| hypothetical protein VEIDISOL_00441 [Veillonella dispar ATCC 17748] Length = 73 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 30/60 (50%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R FF+ V+ E KK+ WP++ E++ IVV ++ + V+D L + +L Sbjct: 10 QRGGFGKFFRGVKAELKKVVWPTKKELINYTIVVFLVTIFIAFIIYVLDAVFAQLFNTLL 69 >gi|299821039|ref|ZP_07052927.1| preprotein translocase [Listeria grayi DSM 20601] gi|299816704|gb|EFI83940.1| preprotein translocase [Listeria grayi DSM 20601] Length = 64 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 36/57 (63%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ NFF V E +K+ WP+R E++ + VII + + +VFF+VID I L+ ++ Sbjct: 8 ALSNFFHNVISEMRKVSWPTRKELVTYTVTVIITVILFAVFFMVIDFGIEQLIKLVI 64 >gi|225862147|ref|YP_002747525.1| preprotein translocase, SecE subunit [Bacillus cereus 03BB102] gi|225789835|gb|ACO30052.1| preprotein translocase, SecE subunit [Bacillus cereus 03BB102] Length = 59 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 32/58 (55%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + NFF V E KK+ WP + E+L S VI + ++FF V+D I L+ IL Sbjct: 1 MRLTNFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAIFFAVVDMGISSLIRLIL 58 >gi|284050919|ref|ZP_06381129.1| preprotein translocase subunit SecE [Arthrospira platensis str. Paraca] Length = 92 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 30/61 (49%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +V F K ++E K+ WP+R ++L V++M+ +S+ +ID W + Sbjct: 32 KGFSVGGFLKGTKEELDKVVWPTRQQLLSESAGVLLMVMLSATLIYLIDNFFRWSSGQVF 91 Query: 64 G 64 G Sbjct: 92 G 92 >gi|134049124|gb|ABO46195.1| preprotein translocase, subunit E [Francisella tularensis subsp. tularensis WY96-3418] Length = 148 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+ R E K+ WP+R E + ++VI+++ I ++ + + + LG Sbjct: 93 WAFFQASRLELAKVVWPTRKETMTISLMVIVVVIIFALIISLFGIIFENFIQYFLG 148 >gi|330430120|gb|AEC21454.1| preprotein translocase subunit SecE [Pusillimonas sp. T7-7] Length = 126 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 30/56 (53%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F + +E K++ WP+R E +V + + + V+D+ + W+++ +L Sbjct: 67 TLSFGRDSYNEVKRVVWPTRKETTQMTGIVFVFVIAMGLLLWVVDKVLEWVIYGLL 122 >gi|284928832|ref|YP_003421354.1| protein translocase subunit secE/sec61 gamma [cyanobacterium UCYN-A] gi|284809291|gb|ADB94996.1| protein translocase subunit secE/sec61 gamma [cyanobacterium UCYN-A] Length = 75 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 28/58 (48%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V NF R+E KI WPSR ++L VI+M+S+ + ++D W + Sbjct: 18 TKVKNFVIDTREELAKIVWPSRQQLLSESAAVILMVSLVATVIYLVDNFFTWGSGKVF 75 >gi|260913288|ref|ZP_05919770.1| preprotein translocase [Pasteurella dagmatis ATCC 43325] gi|260632875|gb|EEX51044.1| preprotein translocase [Pasteurella dagmatis ATCC 43325] Length = 136 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 29/55 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF R E +KI WP+R E + + ++V + + S+ +D I L+ F+ + Sbjct: 80 FFSDSRVELRKIVWPTRPEAMQTTLIVAGVTIVVSLILWGLDSIIVALITFLTDL 134 >gi|167826166|ref|ZP_02457637.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 9] Length = 110 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M + + + F K E +K+ WP+R E + +VV + + ++F + D+SI W + Sbjct: 44 MSLPGKSFIAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEWAI 102 >gi|325964184|ref|YP_004242090.1| preprotein translocase, SecE subunit [Arthrobacter phenanthrenivorans Sphe3] gi|323470271|gb|ADX73956.1| preprotein translocase, SecE subunit [Arthrobacter phenanthrenivorans Sphe3] Length = 94 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 31/57 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +Q+ E KK+ P+R E++ +VV++ + I + ++D G + +I G Sbjct: 31 IALFIRQIIGELKKVVAPTRKELINYTLVVLVFVGIMMIIVSLLDIGFGTAVGWIFG 87 >gi|312135328|ref|YP_004002666.1| preprotein translocase, sece subunit [Caldicellulosiruptor owensensis OL] gi|311775379|gb|ADQ04866.1| preprotein translocase, SecE subunit [Caldicellulosiruptor owensensis OL] Length = 89 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 31/57 (54%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L FF+ VR E KK+ WPS+ +V+ +VV+ +VF L+ D L+ +L Sbjct: 29 KTLKFFRDVRIEMKKVVWPSQKQVVKHTVVVLAFTLFFTVFILLADLIYDQLIFKLL 85 >gi|297567071|ref|YP_003686043.1| preprotein translocase subunit SecE [Meiothermus silvanus DSM 9946] gi|296851520|gb|ADH64535.1| preprotein translocase, SecE subunit [Meiothermus silvanus DSM 9946] Length = 73 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 31/55 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V+N+F++ R E ++ WP+R E++ S V++++ V + D L+ FI Sbjct: 17 VVNYFRESRAELSRVTWPTRQEIVQSTEVILLVTVFFMVVLGLYDLVFRNLISFI 71 >gi|303327277|ref|ZP_07357719.1| preprotein translocase, SecE subunit [Desulfovibrio sp. 3_1_syn3] gi|302863265|gb|EFL86197.1| preprotein translocase, SecE subunit [Desulfovibrio sp. 3_1_syn3] Length = 79 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 28/55 (50%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + + E +K+ WP+ E + + V+ +++ +V ++D + L+ IL Sbjct: 25 RYVEDSKAELRKVTWPTLKETRKATLAVLGFVAVMAVILGLVDLGLSALIKSILS 79 >gi|162329653|ref|YP_001121315.2| preprotein translocase subunit SecE [Francisella tularensis subsp. tularensis WY96-3418] Length = 156 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+ R E K+ WP+R E + ++VI+++ I ++ + + + LG Sbjct: 101 WAFFQASRLELAKVVWPTRKETMTISLMVIVVVIIFALIISLFGIIFENFIQYFLG 156 >gi|45644659|gb|AAS73047.1| predicted preprotein translocase subunit SecE [uncultured marine gamma proteobacterium EBAC20E09] Length = 120 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + K+ R E +K+ WP+R E + ++V + + +FF ++ + +L +LG Sbjct: 63 NSIKLMKESRTEIRKVVWPTRMETTQTFMIVFGSIVVLCLFFWGLESLLSFLTSLVLG 120 >gi|289551665|ref|YP_003472569.1| Preprotein translocase subunit SecE [Staphylococcus lugdunensis HKU09-01] gi|315659124|ref|ZP_07911989.1| preprotein translocase [Staphylococcus lugdunensis M23590] gi|289181196|gb|ADC88441.1| Preprotein translocase subunit SecE [Staphylococcus lugdunensis HKU09-01] gi|315495848|gb|EFU84178.1| preprotein translocase [Staphylococcus lugdunensis M23590] Length = 64 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 29/52 (55%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 NFFK V+ E +K WP++ E+ ++V+ + FF V+D IG L+ Sbjct: 11 NFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVLFFMAFFYVLDIGIGNLIEL 62 >gi|167912897|ref|ZP_02499988.1| preprotein translocase subunit SecE [Burkholderia pseudomallei 112] gi|167920857|ref|ZP_02507948.1| preprotein translocase subunit SecE [Burkholderia pseudomallei BCC215] Length = 110 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M + + + F K E +K+ WP+R E + +VV + + ++F + D+SI W + Sbjct: 44 MSLPGKSFIAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEWAI 102 >gi|118498142|ref|YP_899192.1| preprotein translocase subunit SecE [Francisella tularensis subsp. novicida U112] gi|194324314|ref|ZP_03058087.1| preprotein translocase, SecE subunit [Francisella tularensis subsp. novicida FTE] gi|118424048|gb|ABK90438.1| preprotein translocase, subunit E, membrane protein [Francisella novicida U112] gi|194321379|gb|EDX18864.1| preprotein translocase, SecE subunit [Francisella tularensis subsp. novicida FTE] Length = 156 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+ R E K+ WP+R E + ++VI+++ I ++ + + + LG Sbjct: 101 WAFFQASRLELAKVVWPTRKETMTISLMVIVVVIIFALIISLFGVIFENFIQYFLG 156 >gi|169656749|ref|YP_001429285.2| preprotein translocase subunit SecE [Francisella tularensis subsp. holarctica FTNF002-00] gi|290953567|ref|ZP_06558188.1| preprotein translocase subunit SecE [Francisella tularensis subsp. holarctica URFT1] gi|295313121|ref|ZP_06803810.1| preprotein translocase subunit SecE [Francisella tularensis subsp. holarctica URFT1] gi|164551817|gb|ABU62329.2| preprotein translocase, SecE subunit [Francisella tularensis subsp. holarctica FTNF002-00] Length = 156 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+ R E K+ WP+R E + ++VI+++ I ++ + + + LG Sbjct: 101 WAFFQASRLELAKVVWPTRKETMTISLMVIVVVIIFALIISLFGVIFENFIQYFLG 156 >gi|289641397|ref|ZP_06473561.1| preprotein translocase, SecE subunit [Frankia symbiont of Datisca glomerata] gi|289508733|gb|EFD29668.1| preprotein translocase, SecE subunit [Frankia symbiont of Datisca glomerata] Length = 82 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 21/63 (33%), Positives = 35/63 (55%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G R L F+++V E +K+ +P RSE++ VIVV++ SI+ F +D + + Sbjct: 20 GRRRTTPLRFYREVVAELRKVVYPGRSELVTYVIVVLVFCSITVAFVASLDFGLTKAVLA 79 Query: 62 ILG 64 I G Sbjct: 80 IFG 82 >gi|294496968|ref|YP_003560668.1| preprotein translocase subunit SecE [Bacillus megaterium QM B1551] gi|295702335|ref|YP_003595410.1| preprotein translocase subunit SecE [Bacillus megaterium DSM 319] gi|294346905|gb|ADE67234.1| preprotein translocase, SecE subunit [Bacillus megaterium QM B1551] gi|294799994|gb|ADF37060.1| preprotein translocase, SecE subunit [Bacillus megaterium DSM 319] Length = 59 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 30/53 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 NF + V E KK+ WP ++E+ I VI + ++FF+V+D I L+ I Sbjct: 6 NFLRDVGREMKKVSWPKKNELTRYTITVISTVVFMTLFFVVVDYGISSLIRLI 58 >gi|254483547|ref|ZP_05096773.1| preprotein translocase, SecE subunit, putative [marine gamma proteobacterium HTCC2148] gi|214036204|gb|EEB76885.1| preprotein translocase, SecE subunit, putative [marine gamma proteobacterium HTCC2148] Length = 120 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 32/62 (51%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A K R E +K+ WPSR E + + ++V++ + + ++ +D +GWL+ Sbjct: 59 AKGAAFWTLVKGSRTEIRKVVWPSRQETVQTTMIVVVFVVLVALMLWGLDSFLGWLVSLA 118 Query: 63 LG 64 +G Sbjct: 119 IG 120 >gi|224475683|ref|YP_002633289.1| preprotein translocase subunit SecE [Staphylococcus carnosus subsp. carnosus TM300] gi|548912|sp|P36253|SECE_STACT RecName: Full=Preprotein translocase subunit secE gi|426472|emb|CAA53737.1| secE [Staphylococcus carnosus] gi|222420290|emb|CAL27104.1| secE [Staphylococcus carnosus subsp. carnosus TM300] Length = 65 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 29/52 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FFK V E +K WP++ E+L +VI+ + +FF +D IG L+ I Sbjct: 13 FFKGVISEMEKTSWPTKEEILKYTTIVIVTVVFFLIFFYALDLGIGKLIELI 64 >gi|291613223|ref|YP_003523380.1| preprotein translocase, SecE subunit [Sideroxydans lithotrophicus ES-1] gi|291583335|gb|ADE10993.1| preprotein translocase, SecE subunit [Sideroxydans lithotrophicus ES-1] Length = 115 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +F E+K++ WPSR E + + VV++ + ++F +D S+ +++ ++G Sbjct: 57 FSFASDSVAEAKRVVWPSRKETIQTTAVVVLFAVVMALFLWAVDASLMVIVNKLMG 112 >gi|121596190|ref|YP_988086.1| preprotein translocase subunit SecE [Acidovorax sp. JS42] gi|120608270|gb|ABM44010.1| protein translocase subunit secE/sec61 gamma [Acidovorax sp. JS42] Length = 127 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 27/53 (50%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F E KK+ WP+R E L V + + ++F D+++ W+++ ++ Sbjct: 70 FANDAWREVKKVVWPTRKETLQMTGYVFAFVVVMALFLWFTDKTLEWVLYDLI 122 >gi|238918137|ref|YP_002931651.1| preprotein translocase subunit SecE [Edwardsiella ictaluri 93-146] gi|238867705|gb|ACR67416.1| preprotein translocase subunit SecE, putative [Edwardsiella ictaluri 93-146] Length = 111 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M A + F ++ R E +K+ WP+R E L + ++V + ++ ++ +D + L+ Sbjct: 45 MTTQGKATVAFAREARTEMRKVIWPTRQEALHTTLIVAAVTAVMALILWGLDGVLVRLVS 104 Query: 61 FILGI 65 FI G+ Sbjct: 105 FITGL 109 >gi|269955418|ref|YP_003325207.1| preprotein translocase subunit SecE [Xylanimonas cellulosilytica DSM 15894] gi|269304099|gb|ACZ29649.1| preprotein translocase, SecE subunit [Xylanimonas cellulosilytica DSM 15894] Length = 84 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 31/57 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QV E KK+ P+R E+L VV++ ++I F ++D IG + + G Sbjct: 28 IALFVRQVVGELKKVVSPTRQELLTYTGVVLVFVAIVMAFVGLLDYLIGLGVFALFG 84 >gi|220913453|ref|YP_002488762.1| preprotein translocase subunit SecE [Arthrobacter chlorophenolicus A6] gi|219860331|gb|ACL40673.1| preprotein translocase, SecE subunit [Arthrobacter chlorophenolicus A6] Length = 89 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 32/57 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +Q+ E KK+ P+R E++ +VV++ ++I V ++D G + ++ G Sbjct: 26 IALFVRQIIGELKKVVAPTRKELINYTLVVLVFVAIMMVIVSLLDIGFGTAVGWLFG 82 >gi|309379176|emb|CBX22307.1| unnamed protein product [Neisseria lactamica Y92-1009] Length = 92 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 26/56 (46%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 + +F E KK+ WP R + + + VI+ +++ S+F D + WL Sbjct: 27 HGKEGFFAYFSNSWSEFKKVVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAFSWL 82 >gi|56707308|ref|YP_169204.1| preprotein translocase subunit SecE [Francisella tularensis subsp. tularensis SCHU S4] gi|110669778|ref|YP_666335.1| preprotein translocase subunit SecE [Francisella tularensis subsp. tularensis FSC198] gi|187931077|ref|YP_001891061.1| preprotein translocase subunit SecE [Francisella tularensis subsp. mediasiatica FSC147] gi|56603800|emb|CAG44771.1| preprotein translocase, subunit E, membrane protein [Francisella tularensis subsp. tularensis SCHU S4] gi|110320111|emb|CAL08154.1| preprotein translocase, subunit E, membrane protein [Francisella tularensis subsp. tularensis FSC198] gi|187711986|gb|ACD30283.1| preprotein translocase, subunit E, membrane protein [Francisella tularensis subsp. mediasiatica FSC147] Length = 156 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+ R E K+ WP+R E + ++VI+++ I ++ + + + LG Sbjct: 101 WAFFQASRLELAKVVWPTRKETMTISLMVIVVVIIFALIISLFGVIFENFIQYFLG 156 >gi|227549793|ref|ZP_03979842.1| preprotein translocase subunit SecE [Corynebacterium lipophiloflavum DSM 44291] gi|227078048|gb|EEI16011.1| preprotein translocase subunit SecE [Corynebacterium lipophiloflavum DSM 44291] Length = 102 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 26/57 (45%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V F +V E +K+ WP+ +++ ++V L + + +D W + +L Sbjct: 44 GVGAFPGEVVSEIRKVIWPTGRQMVNYTLIVFAFLIVLTAIVWSVDWVARWGIEQVL 100 >gi|167838225|ref|ZP_02465084.1| preprotein translocase subunit SecE [Burkholderia thailandensis MSMB43] Length = 110 Score = 47.1 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 28/51 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + F K E +K+ WP+R E + +VV + + ++F + D+SI W + Sbjct: 52 IAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEWAI 102 >gi|163784526|ref|ZP_02179387.1| Preprotein translocase subunit SecE [Hydrogenivirga sp. 128-5-R1-1] gi|159880202|gb|EDP73845.1| Preprotein translocase subunit SecE [Hydrogenivirga sp. 128-5-R1-1] Length = 70 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 19/62 (30%), Positives = 36/62 (58%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 +N ++NF K+V+DE KK+ WP+ V + I VI+ + SV+ V+D + ++ + Sbjct: 8 KMNASQLVNFLKEVKDELKKVTWPTSELVKKATIAVIVFTLLVSVYLWVLDIAFSRIIDY 67 Query: 62 IL 63 + Sbjct: 68 LF 69 >gi|78044057|ref|YP_361134.1| preprotein translocase subunit SecE [Carboxydothermus hydrogenoformans Z-2901] gi|77996172|gb|ABB15071.1| preprotein translocase, SecE subunit [Carboxydothermus hydrogenoformans Z-2901] Length = 87 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 25/47 (53%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 + +F+ V E KK+ WP+R+E +V VV + + I + + D Sbjct: 29 VKTQQYFRSVWAEVKKVHWPTRNESIVYTGVVFLTVIIVGLIIWLFD 75 >gi|326319232|ref|YP_004236904.1| preprotein translocase subunit SecE [Acidovorax avenae subsp. avenae ATCC 19860] gi|323376068|gb|ADX48337.1| preprotein translocase, SecE subunit [Acidovorax avenae subsp. avenae ATCC 19860] Length = 128 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K E KK+ WP+R E L V + + ++F D+++ W+++ ++ Sbjct: 71 FAKDAWKEVKKVVWPTRKETLQMTAYVFAFVLVMALFLWFTDKTLEWVLYDLI 123 >gi|319443087|ref|ZP_07992243.1| preprotein translocase subunit SecE [Corynebacterium variabile DSM 44702] Length = 104 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 25/58 (43%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + V E KK+ WP+ E++ S ++ I L I +D + FI G Sbjct: 46 GPVAYAGSVGREMKKVIWPTGREMVSSTLITIAFLVIMVALCASVDFLAHEGVEFIFG 103 >gi|296163265|ref|ZP_06846029.1| preprotein translocase, SecE subunit [Burkholderia sp. Ch1-1] gi|295886501|gb|EFG66355.1| preprotein translocase, SecE subunit [Burkholderia sp. Ch1-1] Length = 110 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 28/51 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + F K E +K+ WP+R E + +VV + + ++F V D+SI W + Sbjct: 52 IAFAKDSYKEVRKVVWPTRKEATQTTLVVFGFVFVMAIFLWVSDKSIEWAI 102 >gi|332184688|gb|AEE26942.1| Preprotein translocase subunit SecE [Francisella cf. novicida 3523] Length = 143 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+ + E K+ WP+R E + ++VI+++ I ++ + + + LG Sbjct: 88 WAFFQASKLELAKVVWPTRKETMTISLMVIVVVIIFALIISLFGVIFENFIQYFLG 143 >gi|317485863|ref|ZP_07944725.1| preprotein translocase [Bilophila wadsworthia 3_1_6] gi|316922878|gb|EFV44102.1| preprotein translocase [Bilophila wadsworthia 3_1_6] Length = 80 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 N+ + + E +K+ WP+ E + +VV+ + + ++F V+D + L+ FIL Sbjct: 25 NYLELSKTELRKVTWPTVKETRTTSLVVLAFVVVMAIFLGVVDLGLSKLISFILA 79 >gi|110598843|ref|ZP_01387099.1| SecE subunit of protein translocation complex [Chlorobium ferrooxidans DSM 13031] gi|110339551|gb|EAT58070.1| SecE subunit of protein translocation complex [Chlorobium ferrooxidans DSM 13031] Length = 63 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 32/54 (59%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +++ V +E +K+ WP + E+ IVV+ + I ++F ++D I ++M +L Sbjct: 10 QYYRDVINEMRKVVWPGKEEIKDLTIVVLTVSGILALFTFLVDWVINFVMGKLL 63 >gi|149925891|ref|ZP_01914154.1| SecE subunit of protein translocation complex [Limnobacter sp. MED105] gi|149825179|gb|EDM84390.1| SecE subunit of protein translocation complex [Limnobacter sp. MED105] Length = 156 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 31/48 (64%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 F K +E+K++ WP+R E + VV + + I S++ L++D+++ W+ Sbjct: 99 FAKDSVNEAKRVVWPTRKEGMQMTGVVFVFVLIMSIYLLLVDKTLEWV 146 >gi|160331566|ref|XP_001712490.1| secE [Hemiselmis andersenii] gi|159765938|gb|ABW98165.1| secE [Hemiselmis andersenii] Length = 119 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 33/60 (55%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 N+ +L+FF++V+DE K I WP+ VL ++V+I L S++F ID + Sbjct: 56 NKPNILDFFQEVKDEIKMIEWPTFDRVLKQFVIVLISLVFSALFIFSIDGLFAAGNKILF 115 >gi|293375375|ref|ZP_06621656.1| preprotein translocase, SecE subunit [Turicibacter sanguinis PC909] gi|325844476|ref|ZP_08168203.1| preprotein translocase, SecE subunit [Turicibacter sp. HGF1] gi|292645928|gb|EFF63957.1| preprotein translocase, SecE subunit [Turicibacter sanguinis PC909] gi|325489150|gb|EGC91534.1| preprotein translocase, SecE subunit [Turicibacter sp. HGF1] Length = 59 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 31/52 (59%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FFK V E KKI WP+ E+ V++ +++ +VFF V+D I +M+ + Sbjct: 7 FFKGVSAELKKITWPTEKEMKSYTFQVLVFVALLTVFFFVVDLVISQVMNLL 58 >gi|317133007|ref|YP_004092321.1| preprotein translocase, SecE subunit [Ethanoligenens harbinense YUAN-3] gi|315470986|gb|ADU27590.1| preprotein translocase, SecE subunit [Ethanoligenens harbinense YUAN-3] Length = 91 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 25/45 (55%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQS 54 F + R E KKI WP+R +V + IVV++ +++ + +D Sbjct: 37 RFLSETRAEFKKIIWPTRRQVTSNTIVVLVTIAVIGAVVMALDAL 81 >gi|223042950|ref|ZP_03612998.1| preprotein translocase, SecE subunit [Staphylococcus capitis SK14] gi|314932759|ref|ZP_07840128.1| preprotein translocase, SecE subunit [Staphylococcus caprae C87] gi|222443804|gb|EEE49901.1| preprotein translocase, SecE subunit [Staphylococcus capitis SK14] gi|313654440|gb|EFS18193.1| preprotein translocase, SecE subunit [Staphylococcus caprae C87] Length = 60 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 30/55 (54%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFFK V+ E +K WP++ E+ ++V+ + VFF +D I L +LG Sbjct: 6 NFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDVGINALKQLLLG 60 >gi|282158433|gb|ADA77824.1| preprotein translocase subunit SecE [Francisella tularensis subsp. tularensis NE061598] Length = 143 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+ R E K+ WP+R E + ++VI+++ I ++ + + + LG Sbjct: 88 WAFFQASRLELAKVVWPTRKETMTISLMVIVVVIIFALIISLFGVIFENFIQYFLG 143 >gi|120596976|ref|YP_961550.1| preprotein translocase subunit SecE [Shewanella sp. W3-18-1] gi|146294854|ref|YP_001185278.1| preprotein translocase subunit SecE [Shewanella putrefaciens CN-32] gi|120557069|gb|ABM22996.1| protein translocase subunit secE/sec61 gamma [Shewanella sp. W3-18-1] gi|145566544|gb|ABP77479.1| protein translocase subunit secE/sec61 gamma [Shewanella putrefaciens CN-32] gi|319424567|gb|ADV52641.1| preprotein translocase, SecE subunit [Shewanella putrefaciens 200] Length = 123 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 31/62 (50%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F ++ + E +K+ WP+R E L + +V+ I ++ +D + +++FI Sbjct: 62 KGKKAFAFARESQIEVRKVVWPTRQEALNTTFIVLAATGILALVLWGMDAVLMRIVNFIT 121 Query: 64 GI 65 G+ Sbjct: 122 GV 123 >gi|326392848|ref|ZP_08214085.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus JW 200] gi|325991110|gb|EGD49865.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus JW 200] Length = 50 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 27/49 (55%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFL 49 M ++ FFK VR E KK+ WPSR ++ +V+I++++ F Sbjct: 1 MAGEGRKIVKFFKDVRAEMKKVTWPSRETMITYTEIVLIVVALLQYSFF 49 >gi|160895953|ref|YP_001561535.1| preprotein translocase subunit SecE [Delftia acidovorans SPH-1] gi|160361537|gb|ABX33150.1| preprotein translocase, SecE subunit [Delftia acidovorans SPH-1] Length = 127 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 31/55 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++F + E KK+ WP+R E + + V + I ++F D+++ W+++ ++ Sbjct: 68 VSFAQDAWREVKKVVWPTRKETMQMTLYVFGFVVIMALFLWFTDKTLEWVLYDLI 122 >gi|15807042|ref|NP_295771.1| preprotein translocase subunit SecE [Deinococcus radiodurans R1] gi|6459840|gb|AAF11598.1|AE002041_2 preprotein translocase, SecE subunit [Deinococcus radiodurans R1] Length = 61 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 29/59 (49%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + ++ +F+ R+E ++ WPSR +VL V+I + ++ +D G + L Sbjct: 1 MNLIQYFRDAREELSRVTWPSRQDVLEGTQAVLIFVVALTLIVWALDLLFGTAIKAALA 59 >gi|291303408|ref|YP_003514686.1| preprotein translocase SecE subunit [Stackebrandtia nassauensis DSM 44728] gi|290572628|gb|ADD45593.1| preprotein translocase, SecE subunit [Stackebrandtia nassauensis DSM 44728] Length = 147 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F +++ ++ +K+ +P+R ++L VV++ ++I +D + + ++ G Sbjct: 90 FIREIFEQLRKVVYPTRKQLLTYTAVVLVFVTIMIGVIYGLDYVMSKGVMWVFG 143 >gi|226309791|ref|YP_002769685.1| preprotein translocase SecE subunit [Brevibacillus brevis NBRC 100599] gi|226092739|dbj|BAH41181.1| preprotein translocase SecE subunit [Brevibacillus brevis NBRC 100599] Length = 82 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 22/64 (34%), Positives = 36/64 (56%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 +G + FF V E KK+ WP+R E+ +VV++ + + ++FF V+D I L+ Sbjct: 18 IGASFRRTGGFFSDVMSELKKVRWPNRKELTTYTLVVLVTVVLLAIFFFVVDLGISRLID 77 Query: 61 FILG 64 ILG Sbjct: 78 LILG 81 >gi|222529522|ref|YP_002573404.1| preprotein translocase, SecE subunit [Caldicellulosiruptor bescii DSM 6725] gi|312622248|ref|YP_004023861.1| preprotein translocase, sece subunit [Caldicellulosiruptor kronotskyensis 2002] gi|222456369|gb|ACM60631.1| preprotein translocase, SecE subunit [Caldicellulosiruptor bescii DSM 6725] gi|312202715|gb|ADQ46042.1| preprotein translocase, SecE subunit [Caldicellulosiruptor kronotskyensis 2002] Length = 89 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 31/57 (54%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L FF+ VR E KK+ WPS+ +V+ IVV+ +VF L+ D L+ +L Sbjct: 29 KTLKFFRDVRIEMKKVVWPSQKQVVKHTIVVLTFTLFFTVFILLADLIYDQLIFKLL 85 >gi|218438015|ref|YP_002376344.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 7424] gi|218170743|gb|ACK69476.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 7424] Length = 78 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 32/60 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 N+ + F + ++E +K+ WPSR +++ VI+M+++ + ++D W+ + Sbjct: 19 NQFKLTEFANETKEELEKVVWPSRQQLISESAAVILMVTLVATVIYLVDNFFAWIAGKVF 78 >gi|319791329|ref|YP_004152969.1| preprotein translocase, sece subunit [Variovorax paradoxus EPS] gi|315593792|gb|ADU34858.1| preprotein translocase, SecE subunit [Variovorax paradoxus EPS] Length = 127 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 27/51 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 + F + E KK+ WP+R E + V ++I SVF + D+++ W+ Sbjct: 67 LWAFGRDSWREVKKVVWPTRKEAMQMTAYVFAFVAIMSVFLWLTDKTLEWV 117 >gi|302871672|ref|YP_003840308.1| preprotein translocase, SecE subunit [Caldicellulosiruptor obsidiansis OB47] gi|302574531|gb|ADL42322.1| preprotein translocase, SecE subunit [Caldicellulosiruptor obsidiansis OB47] Length = 89 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 21/57 (36%), Positives = 31/57 (54%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L FF+ VR E KK+ WPS+ +V+ IVV+ +VF L+ D L+ +L Sbjct: 29 KTLKFFRDVRIEMKKVVWPSQKQVVKHTIVVLTFTLFFTVFILLADLIYDQLIFKLL 85 >gi|148243459|ref|YP_001228616.1| preprotein translocase SecE subunit [Synechococcus sp. RCC307] gi|147851769|emb|CAK29263.1| Preprotein translocase SecE subunit [Synechococcus sp. RCC307] Length = 110 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 10/47 (21%), Positives = 27/47 (57%) Query: 17 DESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 E +++ WPSR +++ + V++M+++S+ +D+ W+ + Sbjct: 63 AELRRVVWPSRQQLISESVAVLLMVTLSAAAIASLDRFFRWMSQLVF 109 >gi|222112417|ref|YP_002554681.1| preprotein translocase subunit SecE [Acidovorax ebreus TPSY] gi|221731861|gb|ACM34681.1| preprotein translocase, SecE subunit [Acidovorax ebreus TPSY] Length = 127 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 27/53 (50%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F E KK+ WP+R E L V + + ++F D+++ W+++ ++ Sbjct: 70 FASDAWREVKKVVWPTRKETLQMTGYVFAFVVVMALFLWFTDKTLEWVLYDLI 122 >gi|295106905|emb|CBL04448.1| preprotein translocase, SecE subunit, bacterial [Gordonibacter pamelaeae 7-10-1-b] Length = 145 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 16/45 (35%), Positives = 26/45 (57%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 F K VR E K++ WP++ +VL +VV+ L V+ ++D I Sbjct: 88 FLKDVRAEMKRVTWPTKKDVLRWSVVVVAALLFFGVYVALLDNVI 132 >gi|161723146|ref|YP_443586.2| preprotein translocase subunit SecE [Burkholderia thailandensis E264] Length = 126 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 30/59 (50%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M + + + F K E +K+ WP+R E + +VV + + ++ + D+SI W + Sbjct: 60 MSLPGKSFIAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALLLWISDKSIEWAI 118 >gi|328958749|ref|YP_004376135.1| preprotein translocase subunit SecE [Carnobacterium sp. 17-4] gi|328675073|gb|AEB31119.1| preprotein translocase subunit SecE [Carnobacterium sp. 17-4] Length = 59 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 31/57 (54%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + NFF VR E K + WP+ E+ + V ++ + +FF V+D IG L+ IL Sbjct: 3 KIKNFFGGVRQEIKTVTWPTGKELRKYTLTVFVVCLLFVLFFAVVDFGIGALLDLIL 59 >gi|108804987|ref|YP_644924.1| protein translocase subunit secE/sec61 gamma [Rubrobacter xylanophilus DSM 9941] gi|108766230|gb|ABG05112.1| protein translocase subunit secE/sec61 gamma [Rubrobacter xylanophilus DSM 9941] Length = 86 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 26/54 (48%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F ++VR E ++ WP R ++ S VV+I++ + + + D L I Sbjct: 32 RFVREVRAELGRVTWPDREQLQQSTAVVLIIVLLLTAYIAAWDFVFQSLARLIF 85 >gi|297180666|gb|ADI16875.1| preprotein translocase subunit sece [uncultured gamma proteobacterium HF0010_16J05] Length = 124 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 32/58 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + K+ R E +++ WPS E + +VV++++ + S+ +D + W++ I+G Sbjct: 67 GIWTLIKEARTEVRRVVWPSNQETTQTTLVVLVIVLLFSLILWGLDSLLSWIVSSIIG 124 >gi|242278646|ref|YP_002990775.1| preprotein translocase, SecE subunit [Desulfovibrio salexigens DSM 2638] gi|242121540|gb|ACS79236.1| preprotein translocase, SecE subunit [Desulfovibrio salexigens DSM 2638] Length = 83 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 33/55 (60%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+Q + E KK+ WP++ E + + V++++ + S+F V+D + L+ IL Sbjct: 29 EFFEQSKVEIKKVVWPTQKETIQTCTAVLVLVVVMSLFLGVVDMGLSKLVEAILS 83 >gi|90020565|ref|YP_526392.1| protein translocase subunit secE/sec61 gamma [Saccharophagus degradans 2-40] gi|89950165|gb|ABD80180.1| protein translocase subunit secE/sec61 gamma [Saccharophagus degradans 2-40] Length = 121 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 11/61 (18%), Positives = 28/61 (45%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 K + E +K+ WP+ E+ + ++V+ ++ ++ +D +G+L I+ Sbjct: 61 KGNNFWELLKGAQIELRKVVWPTGPEITQTTLIVVAVVIVTGFILWGLDSLLGYLFSLII 120 Query: 64 G 64 Sbjct: 121 A 121 >gi|21672990|ref|NP_661055.1| preprotein translocase subunit SecE [Chlorobium tepidum TLS] gi|21646052|gb|AAM71397.1| preprotein translocase SecE subunit [Chlorobium tepidum TLS] Length = 63 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 31/54 (57%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +++ V E +K+ WP+R EV IVV+ + I ++F V+D I +M +L Sbjct: 10 KYYRDVVGEMRKVSWPTREEVKDMTIVVLTVSGILALFTFVVDWVISTVMGKLL 63 >gi|251799660|ref|YP_003014391.1| preprotein translocase, SecE subunit [Paenibacillus sp. JDR-2] gi|247547286|gb|ACT04305.1| preprotein translocase, SecE subunit [Paenibacillus sp. JDR-2] Length = 69 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 35/63 (55%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + + +FF E KK+ WP+R E+ IVV++ ++ +++F ++D I L++ Sbjct: 7 LKQSFGTTFSFFADSWAELKKVRWPNRKELTSYSIVVLLTIAFVTIYFWLLDIGISSLVN 66 Query: 61 FIL 63 I+ Sbjct: 67 LIV 69 >gi|134283111|ref|ZP_01769812.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 305] gi|226198272|ref|ZP_03793843.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei Pakistan 9] gi|254300568|ref|ZP_04968013.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 406e] gi|134245306|gb|EBA45399.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 305] gi|157810518|gb|EDO87688.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei 406e] gi|225929792|gb|EEH25808.1| preprotein translocase, SecE subunit [Burkholderia pseudomallei Pakistan 9] Length = 76 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M + + + F K E +K+ WP+R E + +VV + + ++F + D+SI W + Sbjct: 10 MSLPGKSFIAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALFLWISDKSIEWAI 68 >gi|227505154|ref|ZP_03935203.1| preprotein translocase subunit SecE [Corynebacterium striatum ATCC 6940] gi|227198267|gb|EEI78315.1| preprotein translocase subunit SecE [Corynebacterium striatum ATCC 6940] Length = 110 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 25/57 (43%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V F +V E KK+ WP+ E++ ++ L + + +D G + IL Sbjct: 52 GVAAFPGEVASEMKKVVWPTTKEMVQYTLITFAFLIVLTALVWGVDTLTGLGVEKIL 108 >gi|182418858|ref|ZP_02950117.1| preprotein translocase, SecE subunit [Clostridium butyricum 5521] gi|237666541|ref|ZP_04526526.1| preprotein translocase, SecE subunit [Clostridium butyricum E4 str. BoNT E BL5262] gi|182377290|gb|EDT74856.1| preprotein translocase, SecE subunit [Clostridium butyricum 5521] gi|237657740|gb|EEP55295.1| preprotein translocase, SecE subunit [Clostridium butyricum E4 str. BoNT E BL5262] Length = 76 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 31/64 (48%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 V + + FF++V+ E K+I WPS+ E + + V+I I V +D L Sbjct: 12 AVKKNGLFGFFREVKAEVKRITWPSKDETKKAFVAVVIFALIYIVLVSGLDFIFSNLFEM 71 Query: 62 ILGI 65 IL + Sbjct: 72 ILKL 75 >gi|87201855|gb|ABD29665.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus NCTC 8325] Length = 72 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FFK V+ E +K WP++ E+ ++V+ + VFF +D I L + + G Sbjct: 19 FFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFG 72 >gi|294630859|ref|ZP_06709419.1| preprotein translocase subunit SecE [Streptomyces sp. e14] gi|292834192|gb|EFF92541.1| preprotein translocase subunit SecE [Streptomyces sp. e14] Length = 95 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R ++ VVI ++I VID + ++ G Sbjct: 42 FYRQIVAELRKVVWPTRGQLSSYTTVVIFFVAIMIALVTVIDYGLNHAAKYVFG 95 >gi|297201704|ref|ZP_06919101.1| preprotein translocase subunit SecE [Streptomyces sviceus ATCC 29083] gi|197710923|gb|EDY54957.1| preprotein translocase subunit SecE [Streptomyces sviceus ATCC 29083] Length = 95 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F++Q+ E +K+ WPSR+++ VVI+ + + VID + ++ G Sbjct: 39 LATFYRQIVAELRKVVWPSRNQLTTYTTVVIVFVLVMIGLVTVIDYGLNHAAKYVFG 95 >gi|59713029|ref|YP_205805.1| preprotein translocase subunit SecE [Vibrio fischeri ES114] gi|59481130|gb|AAW86917.1| preprotein translocase membrane subunit [Vibrio fischeri ES114] Length = 125 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 29/63 (46%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F ++ R E +K+ W +R E + +V+ + + ++ ID + L+ I Sbjct: 63 AKGQTAIAFARESRMEVRKVVWLTRQETTQTTFIVLAVCIVMALILWGIDGIMVRLIGLI 122 Query: 63 LGI 65 G+ Sbjct: 123 TGV 125 >gi|312127419|ref|YP_003992293.1| preprotein translocase, sece subunit [Caldicellulosiruptor hydrothermalis 108] gi|311777438|gb|ADQ06924.1| preprotein translocase, SecE subunit [Caldicellulosiruptor hydrothermalis 108] Length = 89 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 31/56 (55%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L FF+ VR E KK+ WPS+ +V+ IVV+ +VF L+ D L+ +L Sbjct: 30 TLKFFRDVRIEMKKVVWPSQKQVVKHTIVVLTFTLFFTVFILLADLIYDQLIFKLL 85 >gi|242372753|ref|ZP_04818327.1| preprotein translocase subunit SecE [Staphylococcus epidermidis M23864:W1] gi|242349526|gb|EES41127.1| preprotein translocase subunit SecE [Staphylococcus epidermidis M23864:W1] Length = 65 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 30/55 (54%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFFK V+ E +K WP++ E+ ++V+ + VFF +D I L +LG Sbjct: 11 NFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDIGINALKQLLLG 65 >gi|297182719|gb|ADI18875.1| preprotein translocase subunit sece [uncultured Pseudomonadales bacterium HF0010_05E14] Length = 122 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 27/49 (55%) Query: 16 RDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 R E KK+ WP++ E + ++V+ ++ + ++ ID W+ I+G Sbjct: 74 RTEWKKVVWPTKQERNQTTLIVLAVIVLMALILWSIDSFFSWIAKLIMG 122 >gi|302390621|ref|YP_003826442.1| preprotein translocase, SecE subunit [Thermosediminibacter oceani DSM 16646] gi|302201249|gb|ADL08819.1| preprotein translocase, SecE subunit [Thermosediminibacter oceani DSM 16646] Length = 68 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 35/54 (64%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK+VR E KK+ WP+R E++ IVV++ +++ S F ++D + ++ IL Sbjct: 14 RFFKEVRSELKKVTWPTRDELVSYTIVVLVSVALVSGFIWIVDSILMNVLKTIL 67 >gi|241765522|ref|ZP_04763484.1| preprotein translocase, SecE subunit [Acidovorax delafieldii 2AN] gi|241364679|gb|EER59704.1| preprotein translocase, SecE subunit [Acidovorax delafieldii 2AN] Length = 128 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 29/55 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F + E KK+ WP+R E L V + I ++F D+++ W+++ ++ Sbjct: 68 VAFARDAWREVKKVVWPTRKETLQMTAYVFAFVVIMALFLWFTDKTLEWVLYDLI 122 >gi|261401759|ref|ZP_05987884.1| preprotein translocase, SecE subunit [Neisseria lactamica ATCC 23970] gi|313667420|ref|YP_004047704.1| preprotein translocase SecE subunit [Neisseria lactamica ST-640] gi|269208097|gb|EEZ74552.1| preprotein translocase, SecE subunit [Neisseria lactamica ATCC 23970] gi|313004882|emb|CBN86308.1| putative preprotein translocase SecE subunit [Neisseria lactamica 020-06] Length = 92 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 26/50 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 +F E KK+ WP R + + + VI+ +++ S+F D +I WL Sbjct: 33 FAYFSNSWSEFKKVVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAISWL 82 >gi|257063592|ref|YP_003143264.1| preprotein translocase, SecE subunit [Slackia heliotrinireducens DSM 20476] gi|256791245|gb|ACV21915.1| preprotein translocase, SecE subunit [Slackia heliotrinireducens DSM 20476] Length = 126 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 19/47 (40%), Positives = 24/47 (51%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 F K V E K++ WPSR EV+ VV+ L VF V+D I Sbjct: 67 FKFLKDVSAEMKRVTWPSRPEVIRWSGVVVGALLFFGVFVAVLDNLI 113 >gi|160901845|ref|YP_001567426.1| preprotein translocase, SecE subunit [Petrotoga mobilis SJ95] gi|160359489|gb|ABX31103.1| preprotein translocase, SecE subunit [Petrotoga mobilis SJ95] Length = 72 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 34/53 (64%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F V E+KKI WP+R E+L S +VV+I+++I +V+ +D + L +++ Sbjct: 7 FLTSVWQEAKKINWPTRKELLNSTLVVLIVIAIFAVYLFAVDFGLLQLFSWLV 59 >gi|119356074|ref|YP_910718.1| preprotein translocase subunit SecE [Chlorobium phaeobacteroides DSM 266] gi|119353423|gb|ABL64294.1| protein translocase subunit secE/sec61 gamma [Chlorobium phaeobacteroides DSM 266] Length = 63 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 31/57 (54%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V +++ V E +K+ WP + E+ IVV+ + I ++F ++D I +M +L Sbjct: 7 KVGQYYRDVVSEMRKVVWPGKDELKDLTIVVLTVSGILALFTFLVDWVINAVMGLLL 63 >gi|328955956|ref|YP_004373289.1| preprotein translocase, SecE subunit [Coriobacterium glomerans PW2] gi|328456280|gb|AEB07474.1| preprotein translocase, SecE subunit [Coriobacterium glomerans PW2] Length = 148 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 27/56 (48%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + +R E +++ WP++ E++ I V L + + ++D IG + G+ Sbjct: 91 RYIGSIRTEMRRVTWPTKKELINYSIAVCASLVVVGIVIALLDTVIGQGLVLFSGL 146 >gi|167039506|ref|YP_001662491.1| preprotein translocase, SecE subunit [Thermoanaerobacter sp. X514] gi|166853746|gb|ABY92155.1| preprotein translocase, SecE subunit [Thermoanaerobacter sp. X514] Length = 51 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 29/50 (58%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLV 50 M ++ FFK +R E KK+ WPSR V+ +V+I++++ +VF Sbjct: 1 MAGEGRKIVKFFKDIRAEMKKVTWPSRKTVITYTEIVLIVMALLTVFIFF 50 >gi|33152873|ref|NP_874226.1| preprotein translocase subunit SecE [Haemophilus ducreyi 35000HP] gi|33149098|gb|AAP96615.1| preprotein translocase SecE subunit [Haemophilus ducreyi 35000HP] Length = 138 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F K+ R E +KI WP+R E + ++V+ + + S+ ID I L+ F+ + Sbjct: 80 IAFAKESRTELRKIIWPTRPEATQTTLIVVAVCVVVSLILWGIDSIIVTLVTFLTNL 136 >gi|119962697|ref|YP_948676.1| preprotein translocase subunit SecE [Arthrobacter aurescens TC1] gi|119949556|gb|ABM08467.1| preprotein translocase, SecE subunit [Arthrobacter aurescens TC1] Length = 93 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 32/57 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QV E KK+ P+R E++ +VV++ ++I + ++D + G ++ G Sbjct: 30 IALFVRQVIGELKKVVAPTRKELINYTLVVLVFVAIMMLIVSLLDIAFGTGASWVFG 86 >gi|308231605|ref|ZP_07413085.2| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu001] gi|308370465|ref|ZP_07421608.2| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu003] gi|308375216|ref|ZP_07443127.2| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu007] gi|308376462|ref|ZP_07438919.2| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu008] gi|308377482|ref|ZP_07479320.2| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu009] gi|308379831|ref|ZP_07487747.2| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu011] gi|308216641|gb|EFO76040.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu001] gi|308331947|gb|EFP20798.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu003] gi|308347107|gb|EFP35958.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu007] gi|308351050|gb|EFP39901.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu008] gi|308355682|gb|EFP44533.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu009] gi|308363493|gb|EFP52344.1| preprotein translocase subunit secE1 [Mycobacterium tuberculosis SUMu011] Length = 132 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 28/57 (49%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R ++L VV+ L+ D + L+ + G Sbjct: 76 VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG 132 >gi|124268641|ref|YP_001022645.1| preprotein translocase subunit SecE [Methylibium petroleiphilum PM1] gi|124261416|gb|ABM96410.1| protein translocase subunit secE/sec61 gamma [Methylibium petroleiphilum PM1] Length = 127 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 30/57 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ F + E +K+ WPSR E + V + + ++F + D+++ W ++ ++ Sbjct: 66 ALAGFGRDSVRELRKVVWPSRKEAIQMTGYVFAFVFVMALFLWLTDKTLEWALYDLI 122 >gi|221069404|ref|ZP_03545509.1| preprotein translocase, SecE subunit [Comamonas testosteroni KF-1] gi|220714427|gb|EED69795.1| preprotein translocase, SecE subunit [Comamonas testosteroni KF-1] Length = 127 Score = 46.3 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 29/53 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F + E KK+ WP+R E + + V + + ++F D+++ W+++ ++ Sbjct: 70 FARDAWREVKKVVWPTRKETMQMTLYVFAFVVVMALFLWFTDKTLEWVLYDLI 122 >gi|225850722|ref|YP_002730956.1| preprotein translocase, SecE subunit [Persephonella marina EX-H1] gi|225645496|gb|ACO03682.1| preprotein translocase, SecE subunit [Persephonella marina EX-H1] Length = 62 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 31/54 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F K+VR+E KK+ WPS+ V + I VI+ I SV+ +D + +F+ Sbjct: 7 IKFLKEVREELKKVTWPSKQLVRTATIAVIVFTLIVSVYLWGLDILFDRIFNFL 60 >gi|163752684|ref|ZP_02159847.1| preprotein translocase, SecE subunit [Shewanella benthica KT99] gi|161327424|gb|EDP98647.1| preprotein translocase, SecE subunit [Shewanella benthica KT99] Length = 123 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 32/57 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F ++ + E +K+ WP+R E L + +V+ + ++ +D + +++FI G+ Sbjct: 67 LAFAREAQIEVRKVVWPTRQEALNTTFIVLAATGVIALILWGMDAVLLRIVNFITGV 123 >gi|264676488|ref|YP_003276394.1| preprotein translocase, SecE subunit [Comamonas testosteroni CNB-2] gi|262207000|gb|ACY31098.1| preprotein translocase, SecE subunit [Comamonas testosteroni CNB-2] Length = 127 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 29/53 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F + E KK+ WP+R E + + V + + ++F D+++ W+++ ++ Sbjct: 70 FARDAWREVKKVVWPTRKETMQMTLYVFAFVVVMALFLWFTDKTLEWVLYDLI 122 >gi|162138548|ref|YP_378159.2| preprotein translocase subunit SecE [Synechococcus sp. CC9902] Length = 160 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 25/61 (40%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F E K + WPSR ++ I VI+M+S+S+ + + GW + Sbjct: 99 AESTRPGGFLADTVQELKLVVWPSRQQLFSESIAVILMVSLSAATIAAVSRFFGWASSQV 158 Query: 63 L 63 Sbjct: 159 F 159 >gi|77165800|ref|YP_344325.1| SecE subunit of protein translocation complex [Nitrosococcus oceani ATCC 19707] gi|254433827|ref|ZP_05047335.1| preprotein translocase, SecE subunit, putative [Nitrosococcus oceani AFC27] gi|76884114|gb|ABA58795.1| protein translocase subunit secE/sec61 gamma [Nitrosococcus oceani ATCC 19707] gi|207090160|gb|EDZ67431.1| preprotein translocase, SecE subunit, putative [Nitrosococcus oceani AFC27] Length = 115 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 34/60 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 A L+F + R E +K+ WP+R E + + ++V++M+ + + + D + W + + G G Sbjct: 55 AALSFAGETRVEFRKVVWPTRQETIRTTLLVLLMVMVMASILWLFDTLLMWAVRLLTGQG 114 >gi|33591282|ref|NP_878926.1| preprotein translocase subunit SecE [Bordetella pertussis Tohama I] gi|33594731|ref|NP_882374.1| preprotein translocase subunit SecE [Bordetella parapertussis 12822] gi|33599001|ref|NP_886561.1| preprotein translocase subunit SecE [Bordetella bronchiseptica RB50] gi|33564807|emb|CAE39749.1| preprotein translocase SecE subunit [Bordetella parapertussis] gi|33570924|emb|CAE40388.1| preprotein translocase SecE subunit [Bordetella pertussis Tohama I] gi|33575047|emb|CAE30510.1| preprotein translocase SecE subunit [Bordetella bronchiseptica RB50] Length = 126 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 32/56 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F + +E K++ WP+R E + +V +++ + V+D+ I W+++ +L Sbjct: 67 TLSFAGESYNEVKRVSWPTRKETIQMTGIVFAFVAVMGLLMWVLDKGIEWVLYGLL 122 >gi|325288564|ref|YP_004264745.1| preprotein translocase, SecE subunit [Syntrophobotulus glycolicus DSM 8271] gi|324963965|gb|ADY54744.1| preprotein translocase, SecE subunit [Syntrophobotulus glycolicus DSM 8271] Length = 79 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 33/54 (61%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF++V +E KK+ WP+R +++V VV + + I +V ++D + + + IL Sbjct: 26 FFREVWNELKKVHWPTRKQMMVYTGVVFVTVGIFAVLIWIVDSMLTFSLTSILK 79 >gi|315635153|ref|ZP_07890431.1| preprotein translocase [Aggregatibacter segnis ATCC 33393] gi|315476115|gb|EFU66869.1| preprotein translocase [Aggregatibacter segnis ATCC 33393] Length = 136 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 27/52 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF+ R E ++I WPSR E + +V+ + S+ +D I ++ F+ Sbjct: 80 FFQDARTELRRIVWPSRPEATQTTFIVVGVTVFVSLILWGLDSIIVSIITFL 131 >gi|157377462|ref|YP_001476062.1| preprotein translocase subunit SecE [Shewanella sediminis HAW-EB3] gi|157319836|gb|ABV38934.1| preprotein translocase, SecE subunit [Shewanella sediminis HAW-EB3] Length = 123 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 32/57 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F ++ + E +K+ WP+R E L + +V+ I ++ +D + +++FI G+ Sbjct: 67 LAFAREAQIEVRKVVWPTRQEALNTTFIVLAATGILALILWGMDAVLLRIVNFITGV 123 >gi|52078594|ref|YP_077385.1| preprotein translocase subunit SecE [Bacillus licheniformis ATCC 14580] gi|52783956|ref|YP_089785.1| preprotein translocase subunit SecE [Bacillus licheniformis ATCC 14580] gi|319649131|ref|ZP_08003339.1| preprotein translocase subunit secE [Bacillus sp. BT1B_CT2] gi|585979|sp|P38381|SECE_BACLI RecName: Full=Preprotein translocase subunit secE gi|52001805|gb|AAU21747.1| preprotein translocase subunit [Bacillus licheniformis ATCC 14580] gi|52346458|gb|AAU39092.1| SecE [Bacillus licheniformis ATCC 14580] gi|317388831|gb|EFV69650.1| preprotein translocase subunit secE [Bacillus sp. BT1B_CT2] Length = 59 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 30/58 (51%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ F K V E KK+ WP E+ I VI + ++FF +ID I L+ I+ Sbjct: 1 MGIIKFLKNVGKEMKKVTWPKGKELTRYTITVITTVIFFAIFFALIDSGITQLIRLIV 58 >gi|257454930|ref|ZP_05620178.1| preprotein translocase subunit SecE [Enhydrobacter aerosaccus SK60] gi|257447640|gb|EEV22635.1| preprotein translocase subunit SecE [Enhydrobacter aerosaccus SK60] Length = 155 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 26/53 (49%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + R E +++ WP++ E L V ++ I + ++D L+ +++G Sbjct: 102 LQDSRVELRRVTWPTKQETLEYTWQVAVVAGILAFIVWLLDTVFSQLIQYVIG 154 >gi|296137527|ref|YP_003644769.1| preprotein translocase, SecE subunit [Thiomonas intermedia K12] gi|294341872|emb|CAZ90301.1| putative Preprotein translocase secE subunit [Thiomonas sp. 3As] gi|295797649|gb|ADG32439.1| preprotein translocase, SecE subunit [Thiomonas intermedia K12] Length = 127 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 34/57 (59%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A++ + + E+KK+ WP+R E + +V + + ++F + D+S+ ++++ ++ Sbjct: 66 ALIAYGQDAVRETKKVVWPTRKEAMQMTGIVFAFVILMALFLWLTDKSLEYVLYDLI 122 >gi|78188329|ref|YP_378667.1| preprotein translocase subunit SecE [Chlorobium chlorochromatii CaD3] gi|78170528|gb|ABB27624.1| protein translocase subunit secE/sec61 gamma [Chlorobium chlorochromatii CaD3] Length = 63 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 33/57 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V +++ V E +K+ WP++ E+ +VV+ + I ++F ++D I +M ++L Sbjct: 7 KVSQYYRDVVVEMRKVVWPTKQELKDLTVVVLTVSGILALFTFLVDWVINGVMGWLL 63 >gi|299531365|ref|ZP_07044775.1| preprotein translocase subunit SecE [Comamonas testosteroni S44] gi|298720772|gb|EFI61719.1| preprotein translocase subunit SecE [Comamonas testosteroni S44] Length = 93 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 29/53 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F + E KK+ WP+R E + + V + + ++F D+++ W+++ ++ Sbjct: 36 FARDAWREVKKVVWPTRKETMQMTLYVFAFVVVMALFLWFTDKTLEWVLYDLI 88 >gi|38233044|ref|NP_938811.1| preprotein translocase subunit SecE [Corynebacterium diphtheriae NCTC 13129] gi|38199303|emb|CAE48934.1| Putative translocase protein [Corynebacterium diphtheriae] Length = 122 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 29/60 (48%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 N V++F +V E KK+ WP+ +++ ++V L + + +D G + +L Sbjct: 61 NGNKVVSFVPEVASEMKKVIWPTAQQMMSYTLIVFAFLILVTALVAGVDFLAGLGVEKVL 120 >gi|145220414|ref|YP_001131123.1| preprotein translocase subunit SecE [Prosthecochloris vibrioformis DSM 265] gi|145206578|gb|ABP37621.1| protein translocase subunit secE/sec61 gamma [Chlorobium phaeovibrioides DSM 265] Length = 63 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 31/54 (57%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +++ V +E +K+ WP + E+ +VV+ + + ++F V+D IG M +L Sbjct: 10 QYYRDVVNEMRKVVWPGKEEIKDLTVVVLTVSGLLALFTFVVDWVIGSAMGKLL 63 >gi|303256435|ref|ZP_07342449.1| preprotein translocase, SecE subunit [Burkholderiales bacterium 1_1_47] gi|331000375|ref|ZP_08324055.1| preprotein translocase, SecE subunit [Parasutterella excrementihominis YIT 11859] gi|302859926|gb|EFL83003.1| preprotein translocase, SecE subunit [Burkholderiales bacterium 1_1_47] gi|329572081|gb|EGG53750.1| preprotein translocase, SecE subunit [Parasutterella excrementihominis YIT 11859] Length = 127 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 31/55 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + K +E +++ WP+R E + + +V + + + F ++D+ I +L++ +L Sbjct: 69 AKYCKASYEELRRVVWPTRKETINTTGIVCAFVVVIAFFLFIVDKLIEFLLYDVL 123 >gi|240129152|ref|ZP_04741813.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae SK-93-1035] gi|268687536|ref|ZP_06154398.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae SK-93-1035] gi|268627820|gb|EEZ60220.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae SK-93-1035] Length = 92 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 26/50 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 +F E KK+ WP R + + + VI+ +++ S+F D +I WL Sbjct: 33 FAYFSNSWSEFKKVVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAISWL 82 >gi|261409535|ref|YP_003245776.1| preprotein translocase subunit SecE [Paenibacillus sp. Y412MC10] gi|315649718|ref|ZP_07902802.1| preprotein translocase, SecE subunit [Paenibacillus vortex V453] gi|329925618|ref|ZP_08280459.1| preprotein translocase, SecE subunit [Paenibacillus sp. HGF5] gi|261285998|gb|ACX67969.1| preprotein translocase, SecE subunit [Paenibacillus sp. Y412MC10] gi|315274906|gb|EFU38282.1| preprotein translocase, SecE subunit [Paenibacillus vortex V453] gi|328939747|gb|EGG36089.1| preprotein translocase, SecE subunit [Paenibacillus sp. HGF5] Length = 63 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 34/63 (53%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M ++ +FF + E KK+ WP+R E+ ++V+ + +++F V+D I ++ Sbjct: 1 MKRGFKSLFSFFSESWAELKKVRWPNRKELTNYTLIVLGTIVFVTIYFWVVDIGISAVIE 60 Query: 61 FIL 63 I+ Sbjct: 61 AII 63 >gi|84494814|ref|ZP_00993933.1| preprotein translocase SecE subunit [Janibacter sp. HTCC2649] gi|84384307|gb|EAQ00187.1| preprotein translocase SecE subunit [Janibacter sp. HTCC2649] Length = 87 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 30/56 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F Q+ DE +K+ P+R+E+ +VVI+ +++ +D G L+ + G G Sbjct: 31 FISQILDELRKVVRPTRNELWNYTLVVIVFVTVMMALVSALDFGFGKLVALVFGNG 86 >gi|189345739|ref|YP_001942268.1| preprotein translocase subunit SecE [Chlorobium limicola DSM 245] gi|189339886|gb|ACD89289.1| preprotein translocase, SecE subunit [Chlorobium limicola DSM 245] Length = 63 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 30/57 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V +++ V E +K+ WPS+ E +VV+ + I ++F V+D I M +L Sbjct: 7 KVSQYYRDVVSEMRKVAWPSKEEAKDLTVVVLTVSGILALFTFVVDWVINSAMSRLL 63 >gi|328949289|ref|YP_004366626.1| preprotein translocase, SecE subunit [Treponema succinifaciens DSM 2489] gi|328449613|gb|AEB15329.1| preprotein translocase, SecE subunit [Treponema succinifaciens DSM 2489] Length = 59 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 28/57 (49%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FFK+ E +K+ WP+RS+VL S VV I I ++ +D + + Sbjct: 3 KIFQFFKECAGELRKVTWPTRSDVLSSTKVVFISTIIVALILGFLDWLFTEGLRLVF 59 >gi|193214884|ref|YP_001996083.1| preprotein translocase subunit SecE [Chloroherpeton thalassium ATCC 35110] gi|193088361|gb|ACF13636.1| preprotein translocase, SecE subunit [Chloroherpeton thalassium ATCC 35110] Length = 64 Score = 46.0 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 31/58 (53%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V+ ++ V E +K+ WPS+ E+ + IVV+ + I +VF +D I ++ L Sbjct: 7 KVVKYYSDVVTEMRKVTWPSQEELKDATIVVLSVSGILAVFTFSVDWIINAVIKQFLN 64 >gi|127511079|ref|YP_001092276.1| preprotein translocase subunit SecE [Shewanella loihica PV-4] gi|126636374|gb|ABO22017.1| protein translocase subunit secE/sec61 gamma [Shewanella loihica PV-4] Length = 123 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 32/57 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F ++ E +K+ WP+R E L + +V++ + ++ +D + +++FI G+ Sbjct: 67 LTFARESHIEVRKVVWPTRQEALNTTFIVLLATGVLALVLWGMDAVLLRIVNFITGV 123 >gi|300309441|ref|YP_003773533.1| preprotein translocase SecE subunit transmembrane protein [Herbaspirillum seropedicae SmR1] gi|300072226|gb|ADJ61625.1| preprotein translocase SecE subunit transmembrane protein [Herbaspirillum seropedicae SmR1] Length = 126 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 27/49 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 F K+ E+KK+ WP+R E + VV + I ++F D+ + +L+ Sbjct: 70 FAKESVRETKKVVWPTRKEAMQITAVVFAFVLIMAIFLWGTDKLLEFLL 118 >gi|170729022|ref|YP_001763048.1| preprotein translocase subunit SecE [Shewanella woodyi ATCC 51908] gi|169814369|gb|ACA88953.1| preprotein translocase, SecE subunit [Shewanella woodyi ATCC 51908] Length = 123 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 32/57 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F ++ + E +K+ WP+R E L + +V+ + ++ +D + +++FI G+ Sbjct: 67 LTFAREAQIEVRKVVWPTRQEALNTTFIVLAATGVLALILWGMDAVLLRIVNFITGV 123 >gi|15676053|ref|NP_273183.1| preprotein translocase subunit SecE [Neisseria meningitidis MC58] gi|121634003|ref|YP_974248.1| preprotein translocase subunit SecE [Neisseria meningitidis FAM18] gi|161870929|ref|YP_001600109.1| preprotein translocase subunit SecE [Neisseria meningitidis 053442] gi|254805829|ref|YP_003084050.1| putative preprotein translocase SecE subunit [Neisseria meningitidis alpha14] gi|304388926|ref|ZP_07370973.1| preprotein translocase [Neisseria meningitidis ATCC 13091] gi|7225342|gb|AAF40584.1| preprotein translocase SecE subunit [Neisseria meningitidis MC58] gi|120865709|emb|CAM09436.1| putative preprotein translocase SecE subunit [Neisseria meningitidis FAM18] gi|161596482|gb|ABX74142.1| preprotein translocase SECE subunit [Neisseria meningitidis 053442] gi|254669371|emb|CBA08490.1| putative preprotein translocase SecE subunit [Neisseria meningitidis alpha14] gi|261391663|emb|CAX49111.1| preprotein translocase SecE subunit [Neisseria meningitidis 8013] gi|304337060|gb|EFM03247.1| preprotein translocase [Neisseria meningitidis ATCC 13091] gi|308388343|gb|ADO30663.1| preprotein translocase subunit SecE [Neisseria meningitidis alpha710] gi|325127119|gb|EGC50073.1| preprotein translocase, SecE subunit [Neisseria meningitidis N1568] gi|325131100|gb|EGC53822.1| preprotein translocase, SecE subunit [Neisseria meningitidis OX99.30304] gi|325133039|gb|EGC55711.1| preprotein translocase, SecE subunit [Neisseria meningitidis M6190] gi|325135131|gb|EGC57757.1| preprotein translocase, SecE subunit [Neisseria meningitidis M13399] gi|325137184|gb|EGC59779.1| preprotein translocase, SecE subunit [Neisseria meningitidis M0579] gi|325139018|gb|EGC61564.1| preprotein translocase, SecE subunit [Neisseria meningitidis ES14902] gi|325141140|gb|EGC63640.1| preprotein translocase, SecE subunit [Neisseria meningitidis CU385] gi|325145323|gb|EGC67600.1| preprotein translocase, SecE subunit [Neisseria meningitidis M01-240013] gi|325197414|gb|ADY92870.1| preprotein translocase, SecE subunit [Neisseria meningitidis G2136] gi|325199339|gb|ADY94794.1| preprotein translocase, SecE subunit [Neisseria meningitidis H44/76] gi|325203040|gb|ADY98494.1| preprotein translocase, SecE subunit [Neisseria meningitidis M01-240149] gi|325203245|gb|ADY98698.1| preprotein translocase, SecE subunit [Neisseria meningitidis M01-240355] gi|325205218|gb|ADZ00671.1| preprotein translocase, SecE subunit [Neisseria meningitidis M04-240196] Length = 92 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 26/50 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 +F E KK+ WP R + + + VI+ +++ S+F D +I WL Sbjct: 33 FAYFSNSWSEFKKVVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAISWL 82 >gi|152964643|ref|YP_001360427.1| preprotein translocase, SecE subunit [Kineococcus radiotolerans SRS30216] gi|151359160|gb|ABS02163.1| preprotein translocase, SecE subunit [Kineococcus radiotolerans SRS30216] Length = 77 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 35/61 (57%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R +L F +QV +E +K+ WPSR ++L VV++ + + +F +D IG L+ + Sbjct: 16 KRTGLLLFLRQVVEELRKVVWPSRRDLLSYTGVVLVFVVVMMLFVSALDYGIGKLVLLVF 75 Query: 64 G 64 G Sbjct: 76 G 76 >gi|161353779|ref|YP_514381.2| preprotein translocase subunit SecE [Francisella tularensis subsp. holarctica LVS] Length = 156 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 27/55 (49%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF+ R E K+ WP+R E + ++VI+++ I ++ + + + L Sbjct: 101 WAFFQASRLELAKVVWPTRKETMTISLMVIVVVIIFALIISLFGVIFENFIQYFL 155 >gi|119478594|ref|ZP_01618516.1| translocase [marine gamma proteobacterium HTCC2143] gi|119448429|gb|EAW29679.1| translocase [marine gamma proteobacterium HTCC2143] Length = 122 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 32/62 (51%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A K+ R E +K+ WP+R E + +V++ + ++SV +D +GWL+ Sbjct: 61 AQGAAFWKLAKEARTEIRKVVWPTRQEATQTTFIVVVFVLVTSVILWGLDSLLGWLVSLA 120 Query: 63 LG 64 +G Sbjct: 121 IG 122 >gi|59802178|ref|YP_208890.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae FA 1090] gi|239997907|ref|ZP_04717831.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae 35/02] gi|240015114|ref|ZP_04722027.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae DGI18] gi|240017563|ref|ZP_04724103.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae FA6140] gi|240081706|ref|ZP_04726249.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae FA19] gi|240113982|ref|ZP_04728472.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae MS11] gi|240116718|ref|ZP_04730780.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID18] gi|240118940|ref|ZP_04733002.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID1] gi|240122185|ref|ZP_04735147.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID24-1] gi|240124478|ref|ZP_04737434.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID332] gi|240124654|ref|ZP_04737540.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae SK-92-679] gi|254494739|ref|ZP_05107910.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae 1291] gi|260439523|ref|ZP_05793339.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae DGI2] gi|268593757|ref|ZP_06127924.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae 35/02] gi|268597804|ref|ZP_06131971.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae FA19] gi|268600047|ref|ZP_06134214.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae MS11] gi|268602389|ref|ZP_06136556.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID18] gi|268604651|ref|ZP_06138818.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID1] gi|268683109|ref|ZP_06149971.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID332] gi|268683228|ref|ZP_06150090.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae SK-92-679] gi|291042758|ref|ZP_06568499.1| preprotein translocase subunit secE [Neisseria gonorrhoeae DGI2] gi|293398221|ref|ZP_06642426.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae F62] gi|59719073|gb|AAW90478.1| putative preprotein translocase SecE subunit [Neisseria gonorrhoeae FA 1090] gi|226513779|gb|EEH63124.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae 1291] gi|268547146|gb|EEZ42564.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae 35/02] gi|268551592|gb|EEZ46611.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae FA19] gi|268584178|gb|EEZ48854.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae MS11] gi|268586520|gb|EEZ51196.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID18] gi|268588782|gb|EEZ53458.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID1] gi|268623393|gb|EEZ55793.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae PID332] gi|268623512|gb|EEZ55912.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae SK-92-679] gi|291013192|gb|EFE05158.1| preprotein translocase subunit secE [Neisseria gonorrhoeae DGI2] gi|291611484|gb|EFF40554.1| preprotein translocase subunit SecE [Neisseria gonorrhoeae F62] Length = 92 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 26/50 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 +F E KK+ WP R + + + VI+ +++ S+F D +I WL Sbjct: 33 FAYFSNSWSEFKKVVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAISWL 82 >gi|197117310|ref|YP_002137737.1| preprotein translocase subunit SecE [Geobacter bemidjiensis Bem] gi|197086670|gb|ACH37941.1| preprotein translocase, SecE subunit [Geobacter bemidjiensis Bem] Length = 61 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 31/54 (57%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF+ V+ E K+ WP+R E + + VV++++ I S++ D + L+ IL Sbjct: 7 TFFEDVQAELAKVTWPTRKETISTAQVVVVIIVIISLYLGACDAVLTKLIRSIL 60 >gi|332040083|gb|EGI76468.1| preprotein translocase subunit SecE [Hylemonella gracilis ATCC 19624] Length = 115 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 27/53 (50%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F + E K+ WP+R E + + V + ++F + D+++ W++ +L Sbjct: 58 FGRDAWREVGKVVWPTRRESIQMTLYVFGFAVVMALFLWLTDKTLEWVIFDLL 110 >gi|297179993|gb|ADI16218.1| preprotein translocase subunit sece [uncultured bacterium HF0010_16H03] Length = 120 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + K+ R E +++ WP+R E + +VV + + +FF ++ + +L +LG Sbjct: 63 NAIKLMKESRTEIRRVVWPTRIETTQTFLVVFASIVVLCLFFWALESLLTFLTKLVLG 120 >gi|296119179|ref|ZP_06837749.1| SecE subunit of protein translocation complex [Corynebacterium ammoniagenes DSM 20306] gi|295967805|gb|EFG81060.1| SecE subunit of protein translocation complex [Corynebacterium ammoniagenes DSM 20306] Length = 116 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 27/55 (49%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F +V E KK+ WP+ E++ +VV L I + +D G + ++L Sbjct: 60 VTFVPEVVSEIKKVVWPTAKEMVQYTLVVFAFLIILTALVWGVDTLTGMGIEWLL 114 >gi|313888194|ref|ZP_07821868.1| preprotein translocase, SecE subunit [Peptoniphilus harei ACS-146-V-Sch2b] gi|312845884|gb|EFR33271.1| preprotein translocase, SecE subunit [Peptoniphilus harei ACS-146-V-Sch2b] Length = 71 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 35/59 (59%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + + +F+ V+ E KK+ WP++ V+ I+VI+ + +SS+ L D+ I +L FI Sbjct: 12 KKGGLGRYFRGVKSEFKKVVWPTKDTVIKYSIIVIVAVILSSLLLLAYDKIIMFLFGFI 70 >gi|119947055|ref|YP_944735.1| preprotein translocase, SecE subunit [Psychromonas ingrahamii 37] gi|119865659|gb|ABM05136.1| protein translocase subunit secE/sec61 gamma [Psychromonas ingrahamii 37] Length = 126 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 30/54 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F K R E +K+ WP+R E + + ++++ + +I + +D + L+ FI Sbjct: 69 IAFAKDARLEVRKVVWPTRQETVQTTLIILAVSAIVGLILWGLDGVLVRLVAFI 122 >gi|78221833|ref|YP_383580.1| preprotein translocase subunit SecE [Geobacter metallireducens GS-15] gi|78193088|gb|ABB30855.1| protein translocase subunit secE/sec61 gamma [Geobacter metallireducens GS-15] Length = 61 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 31/55 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +F +V+ E K+ WP+R E + + VV+ ++ I S++ D + LM ILG Sbjct: 7 DFLTEVKAELGKVTWPTRKETISTTWVVVAIVVIISIYLGACDVILAKLMRLILG 61 >gi|304405634|ref|ZP_07387293.1| preprotein translocase, SecE subunit [Paenibacillus curdlanolyticus YK9] gi|304345673|gb|EFM11508.1| preprotein translocase, SecE subunit [Paenibacillus curdlanolyticus YK9] Length = 69 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +FF E KK+ WPSR E+ IVV++ + + +++F V+D I L+ ++ Sbjct: 13 TTFSFFADSWAELKKVRWPSRKELTSYTIVVLVTIILVTIYFWVLDIGISELVELVV 69 >gi|73663529|ref|YP_302310.1| preprotein translocase subunit SecE [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] gi|72496044|dbj|BAE19365.1| preprotein translocase subunit SecE [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] Length = 59 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 29/52 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF+ V+ E +K WP++ E+ ++V+ + VFF +D IG ++ I Sbjct: 7 FFQGVKSEMEKTSWPTKEELFKYTVIVVATVVFFLVFFYALDLGIGRIIELI 58 >gi|284106471|ref|ZP_06386257.1| Protein secE/sec61-gamma protein [Candidatus Poribacteria sp. WGA-A3] gi|283830067|gb|EFC34338.1| Protein secE/sec61-gamma protein [Candidatus Poribacteria sp. WGA-A3] Length = 63 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F +V+ E KK+ +P+R E + S VV++ I S++ + D + WL+ IL Sbjct: 7 KIAEFLIEVKGELKKVSYPTRDETIGSTSVVVVFCFIMSLYLSMTDSILVWLVSRIL 63 >gi|326392211|ref|ZP_08213672.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus JW 200] gi|325991750|gb|EGD50281.1| preprotein translocase, SecE subunit [Thermoanaerobacter ethanolicus JW 200] Length = 49 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 17/49 (34%), Positives = 29/49 (59%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFL 49 M ++ FFK VR E KK+ WPSR ++ +V+I++++ +VF Sbjct: 1 MAGEGRKIVKFFKDVRAEMKKVTWPSRETMITYTEIVLIVVALFTVFIF 49 >gi|225849561|ref|YP_002729726.1| preprotein translocase subunit SecE [Sulfurihydrogenibium azorense Az-Fu1] gi|225643578|gb|ACN98628.1| preprotein translocase, SecE subunit [Sulfurihydrogenibium azorense Az-Fu1] Length = 61 Score = 45.6 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 31/55 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +NF K+V +E KK+ WPSR V + VI+ I +V+ +D ++ FIL Sbjct: 5 INFLKEVYEELKKVTWPSRELVKTATATVIVFTLIIAVYLWGLDLLFAKIITFIL 59 >gi|222056718|ref|YP_002539080.1| preprotein translocase, SecE subunit [Geobacter sp. FRC-32] gi|221566007|gb|ACM21979.1| preprotein translocase, SecE subunit [Geobacter sp. FRC-32] Length = 61 Score = 45.6 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 34/58 (58%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + NF ++VR E K+ WP+R E + + VV++++ + S++ D + L+ FIL Sbjct: 3 VKTKNFLEEVRAELGKVTWPARKETISTAWVVVVIIVLISLYLGACDVVLAKLIRFIL 60 >gi|288942085|ref|YP_003444325.1| preprotein translocase subunit SecE [Allochromatium vinosum DSM 180] gi|288897457|gb|ADC63293.1| preprotein translocase, SecE subunit [Allochromatium vinosum DSM 180] Length = 125 Score = 45.6 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 33/60 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 A+ F R E +K+ WPSR E L + +VV++M+ + + + D + ++ F+ G G Sbjct: 65 ALWQFMSDSRMEVRKVVWPSRQETLQTTLVVVVMVLLVGIVLWLFDMMLMSILRFLTGQG 124 >gi|239813601|ref|YP_002942511.1| preprotein translocase subunit SecE [Variovorax paradoxus S110] gi|239800178|gb|ACS17245.1| preprotein translocase, SecE subunit [Variovorax paradoxus S110] Length = 127 Score = 45.6 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 27/51 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 + F + E KK+ WP+R E + V +++ SVF + D+++ W+ Sbjct: 67 LWAFGRDSWREVKKVVWPTRKEAMQMTAYVFAFVAVMSVFLWLTDKTLEWV 117 >gi|134096334|ref|YP_001101409.1| preprotein translocase membrane subunit [Herminiimonas arsenicoxydans] gi|133740237|emb|CAL63288.1| Preprotein translocase subunit SecE [Herminiimonas arsenicoxydans] Length = 127 Score = 45.6 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 31/55 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +NF K+ E+KK+ WP+R E L +V + + ++F D+ + +++ ++ Sbjct: 68 VNFAKEAVRETKKVVWPTRKETLQMTAIVFGFVLVMALFLFGTDKLLEVVLYDLI 122 >gi|57234267|ref|YP_181718.1| preprotein translocase subunit SecE [Dehalococcoides ethenogenes 195] gi|57224715|gb|AAW39772.1| preprotein translocase, SecE subunit [Dehalococcoides ethenogenes 195] Length = 72 Score = 45.6 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 26/53 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF + E KK+ WPSR +V+ +V+++ + V+D W + + Sbjct: 18 FFSNLVAELKKVVWPSRPDVIKLTTMVLVVAIAVGILLGVVDYGFSWFIDNVF 70 >gi|317052116|ref|YP_004113232.1| preprotein translocase subunit SecE [Desulfurispirillum indicum S5] gi|316947200|gb|ADU66676.1| preprotein translocase, SecE subunit [Desulfurispirillum indicum S5] Length = 59 Score = 45.6 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 33/59 (55%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + F K V+ E K+ WP + EV +VV+++++ +V+F +D ++ ++G Sbjct: 1 MKTVEFLKSVKSEFGKVVWPKKDEVKGMTLVVLVLVAFMTVYFGALDAVFSRMISLLIG 59 >gi|37520398|ref|NP_923775.1| preprotein translocase subunit [Gloeobacter violaceus PCC 7421] gi|35211391|dbj|BAC88770.1| preprotein translocase subunit [Gloeobacter violaceus PCC 7421] Length = 73 Score = 45.6 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 31/59 (52%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F +VR E K+ WP R +++ + V++++ + + F ++D+ + WL I Sbjct: 15 KFNPRQFLTEVRGELDKVVWPDRKQLISQSVSVVLIVVVIASFIYLLDELLKWLSGLIF 73 >gi|139438531|ref|ZP_01772047.1| Hypothetical protein COLAER_01045 [Collinsella aerofaciens ATCC 25986] gi|133776070|gb|EBA39890.1| Hypothetical protein COLAER_01045 [Collinsella aerofaciens ATCC 25986] Length = 112 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 27/56 (48%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 +F V+ E K++ WP + E++ +VV L + V ++D G + G+ Sbjct: 55 KYFASVKSEMKRVTWPDKKELVNYSVVVCASLIVVGVVIALLDAGFGEALALFSGL 110 >gi|167009400|ref|ZP_02274331.1| preprotein translocase subunit SecE [Francisella tularensis subsp. holarctica FSC200] gi|89144850|emb|CAJ80189.1| preprotein translocase, subunit E, membrane protein [Francisella tularensis subsp. holarctica LVS] Length = 143 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 27/55 (49%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF+ R E K+ WP+R E + ++VI+++ I ++ + + + L Sbjct: 88 WAFFQASRLELAKVVWPTRKETMTISLMVIVVVIIFALIISLFGVIFENFIQYFL 142 >gi|312793746|ref|YP_004026669.1| preprotein translocase, sece subunit [Caldicellulosiruptor kristjanssonii 177R1B] gi|312876855|ref|ZP_07736832.1| preprotein translocase, SecE subunit [Caldicellulosiruptor lactoaceticus 6A] gi|311796370|gb|EFR12722.1| preprotein translocase, SecE subunit [Caldicellulosiruptor lactoaceticus 6A] gi|312180886|gb|ADQ41056.1| preprotein translocase, SecE subunit [Caldicellulosiruptor kristjanssonii 177R1B] Length = 89 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 31/57 (54%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+ VR E KK+ WPS+ +V+ IVV+ +VF L+ D L+ +L Sbjct: 29 KTVKFFRDVRIEMKKVVWPSQKQVVKHTIVVLTFTLFFTVFILLADLIYDQLIFKLL 85 >gi|219882610|ref|YP_002477774.1| preprotein translocase, SecE subunit [Arthrobacter chlorophenolicus A6] gi|219861616|gb|ACL41957.1| preprotein translocase, SecE subunit [Arthrobacter chlorophenolicus A6] Length = 92 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 27/57 (47%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F +QV E +K+ P+R E+ + V+ ++ +F ++D G L I Sbjct: 29 TIFLFLRQVIGELRKVVTPTRKELFRYTVTVVAFVAFMILFVTLVDLGFGSLSRLIF 85 >gi|50954134|ref|YP_061422.1| preprotein translocase subunit SecE [Leifsonia xyli subsp. xyli str. CTCB07] gi|50950616|gb|AAT88317.1| preprotein translocase SecE subunit [Leifsonia xyli subsp. xyli str. CTCB07] Length = 90 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QV E KK+ P+R E++ VV++ + I ++D G + ++ G Sbjct: 31 IALFIRQVIGELKKVVTPTRKELVSYTGVVLVFVVIMMALVSLLDWIFGLGLVWVFG 87 >gi|289523626|ref|ZP_06440480.1| preprotein translocase, SecE subunit [Anaerobaculum hydrogeniformans ATCC BAA-1850] gi|289503318|gb|EFD24482.1| preprotein translocase, SecE subunit [Anaerobaculum hydrogeniformans ATCC BAA-1850] Length = 60 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V+NF ++ R E +++ WP+R +V +S ++VI + + S + V+D + ++G Sbjct: 3 KVMNFLREARAELRRVTWPNRKQVWISTLLVIGVTLLVSAYLGVLDLIFTAVFSKVVG 60 >gi|328949967|ref|YP_004367302.1| preprotein translocase, SecE subunit [Marinithermus hydrothermalis DSM 14884] gi|328450291|gb|AEB11192.1| preprotein translocase, SecE subunit [Marinithermus hydrothermalis DSM 14884] Length = 60 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 29/56 (51%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ +F++ R E ++ WPSR E++ S +++ S V D G LM I+ Sbjct: 4 IIAYFREARAELARVTWPSREEIIQSTEAILLFTLFSMTILWVYDLVFGQLMRLII 59 >gi|239636934|ref|ZP_04677932.1| preprotein translocase, SecE subunit [Staphylococcus warneri L37603] gi|239597482|gb|EEQ79981.1| preprotein translocase, SecE subunit [Staphylococcus warneri L37603] gi|330686256|gb|EGG97868.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis VCU121] Length = 60 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+ V+ E +K WP++ E+ ++V+ + VFF +D I L + ++G Sbjct: 7 FFQGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLIG 60 >gi|171462865|ref|YP_001796978.1| preprotein translocase, SecE subunit [Polynucleobacter necessarius subsp. necessarius STIR1] gi|171192403|gb|ACB43364.1| preprotein translocase, SecE subunit [Polynucleobacter necessarius subsp. necessarius STIR1] Length = 125 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 27/51 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + + K E KK+ WP+R E +VV + I S+F + D+ I WL+ Sbjct: 67 IAYTKDSWYEVKKVVWPTRKETAQMTLVVFGFVLIMSLFLWIADKLIEWLV 117 >gi|37912938|gb|AAR05270.1| predicted preprotein translocase subunit SecE [uncultured marine gamma proteobacterium EB000-45B06] gi|40063165|gb|AAR38002.1| preprotein translocase, SecE subunit [uncultured marine bacterium 562] Length = 120 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + ++ R E +K+ WP+R E + +VV + + +FF ++ + +L +LG Sbjct: 63 NAIKLMRESRTEIRKVVWPTRLETTQTFLVVFSAIVVLCLFFWGLESLLTFLTKLVLG 120 >gi|225020306|ref|ZP_03709498.1| hypothetical protein CORMATOL_00313 [Corynebacterium matruchotii ATCC 33806] gi|224947050|gb|EEG28259.1| hypothetical protein CORMATOL_00313 [Corynebacterium matruchotii ATCC 33806] Length = 107 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 28/60 (46%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + V+ F +V E +K+ WP+ ++L I+V L + + +D G + +L Sbjct: 46 RQNKVVAFMPEVVSEMRKVIWPTARQMLNYTIIVFAFLILLTGLVAGVDFLAGIGVEKVL 105 >gi|152977735|ref|YP_001343364.1| preprotein translocase subunit SecE [Actinobacillus succinogenes 130Z] gi|150839458|gb|ABR73429.1| preprotein translocase, SecE subunit [Actinobacillus succinogenes 130Z] Length = 136 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 31/57 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L FF + R E +++ WP+R E + +V+ + ++S+ D I +++F+ + Sbjct: 78 LAFFSEARTELRRVTWPTRPEATQTTFIVVAVTVVTSLILWGFDSVIVSVLNFLTDL 134 >gi|146328849|ref|YP_001210164.1| preprotein translocase, SecE subunit [Dichelobacter nodosus VCS1703A] gi|146232319|gb|ABQ13297.1| preprotein translocase, SecE subunit [Dichelobacter nodosus VCS1703A] Length = 123 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 29/48 (60%) Query: 16 RDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R E +K+FWP + E L + +V ++ + ++F L +D + WL+ +L Sbjct: 76 RIEMRKVFWPGKQEWLRATGMVFAVVIVFAIFLLTVDMLLAWLIRMVL 123 >gi|149922223|ref|ZP_01910661.1| hypothetical protein PPSIR1_23984 [Plesiocystis pacifica SIR-1] gi|149816963|gb|EDM76448.1| hypothetical protein PPSIR1_23984 [Plesiocystis pacifica SIR-1] Length = 107 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 27/59 (45%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +R F V E +I WP+R+E + +VV+I+ I S ++D ++ Sbjct: 46 SREQHFKFISDVATEVSQIVWPTRAETRAATVVVVIITLICSGILWLMDTFWSQATSWL 104 >gi|148273973|ref|YP_001223534.1| preprotein translocase subunit SecE [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|170782937|ref|YP_001711271.1| preprotein translocase subunit SecE [Clavibacter michiganensis subsp. sepedonicus] gi|147831903|emb|CAN02874.1| putative preprotein translocase subunit [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|169157507|emb|CAQ02698.1| preprotein translocase SecE subunit [Clavibacter michiganensis subsp. sepedonicus] Length = 90 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 30/56 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F KQV E KK+ P+R E+L VV+ + + V ++DQ G+L + G G Sbjct: 34 FIKQVVQELKKVVTPTRKELLTFTGVVLAFVIVMMVIVSLLDQLFGYLAIVVFGNG 89 >gi|94984751|ref|YP_604115.1| preprotein translocase subunit SecE [Deinococcus geothermalis DSM 11300] gi|94555032|gb|ABF44946.1| SecE subunit of protein translocation complex [Deinococcus geothermalis DSM 11300] Length = 59 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 31/59 (52%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + ++ + + R+E ++ WP+R +V+ V+I + ++ V+D G L+ +L Sbjct: 1 MNLMQYLRDSREELARVTWPTRQQVIDGTQAVLIFVIALTLIVFVMDFVFGHLIRAVLA 59 >gi|220904895|ref|YP_002480207.1| preprotein translocase, SecE subunit [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] gi|219869194|gb|ACL49529.1| preprotein translocase, SecE subunit [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] Length = 79 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + + E +K+ WP+ E + + V+ +++ +V ++D + L+ IL Sbjct: 24 ARYVEDAKAELRKVTWPTVKETRKATLAVLGFVAVMAVILGLVDLGLSSLIKTILS 79 >gi|218960796|ref|YP_001740571.1| Preprotein translocase subunit SecE [Candidatus Cloacamonas acidaminovorans] gi|167729453|emb|CAO80364.1| Preprotein translocase subunit SecE [Candidatus Cloacamonas acidaminovorans] Length = 61 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 33/60 (55%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+ VR E K + WP+++++ +VVIIM +I ++F +ID ++ + Sbjct: 2 KFEKITRFFRDVRSEMKCVSWPTKTDLKEGTLVVIIMSAIVAIFLSLIDFGFTKIVELVF 61 >gi|261378972|ref|ZP_05983545.1| preprotein translocase, SecE subunit [Neisseria cinerea ATCC 14685] gi|269144587|gb|EEZ71005.1| preprotein translocase, SecE subunit [Neisseria cinerea ATCC 14685] Length = 92 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 29/56 (51%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 + R + +F E KK+ WP R + + + VI+ +++ S+F D +I WL Sbjct: 27 IGREGLFAYFSNSWLEFKKVVWPKREDAVKMTMFVIVFVAVLSIFIYAADTAISWL 82 >gi|145294626|ref|YP_001137447.1| preprotein translocase subunit SecE [Corynebacterium glutamicum R] gi|7288196|dbj|BAA92857.1| secE [Corynebacterium glutamicum] gi|140844546|dbj|BAF53545.1| hypothetical protein [Corynebacterium glutamicum R] Length = 111 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 29/57 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V++F +V E +K+ WP+ +++ +VV+ L + + +D G + IL Sbjct: 53 GVVSFLPEVVGEVRKVIWPTARQMVTYTLVVLGFLIVLTALVSGVDFLAGLGVEKIL 109 >gi|254431245|ref|ZP_05044948.1| putative preprotein translocase, SecE subunit [Cyanobium sp. PCC 7001] gi|197625698|gb|EDY38257.1| putative preprotein translocase, SecE subunit [Cyanobium sp. PCC 7001] Length = 101 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 26/48 (54%) Query: 17 DESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 E +K+ WPSR ++ + VI+M+ +S+ ID+ GW + G Sbjct: 54 AELRKVVWPSRQQLFSESVAVILMVGLSAAAIAAIDRFYGWAAAQVFG 101 >gi|294142946|ref|YP_003558924.1| preprotein translocase subunit SecE [Shewanella violacea DSS12] gi|293329415|dbj|BAJ04146.1| preprotein translocase, SecE subunit [Shewanella violacea DSS12] Length = 123 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 31/55 (56%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++ + E +K+ WP+R E L + VV+ + ++ +D + +++FI G+ Sbjct: 69 FAREAQIEVRKVVWPTRQEALNTTFVVLAATGVLALILWGMDAVLLRIVNFITGV 123 >gi|289432787|ref|YP_003462660.1| preprotein translocase, SecE subunit [Dehalococcoides sp. GT] gi|288946507|gb|ADC74204.1| preprotein translocase, SecE subunit [Dehalococcoides sp. GT] Length = 72 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 27/53 (50%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF + E KK+ WP+RS+V+ +V+++ + V+D W + + Sbjct: 18 FFSNLIAELKKVVWPTRSDVIKLTTMVLVVAITVGIVLGVVDYGFSWFIDNVF 70 >gi|160934067|ref|ZP_02081454.1| hypothetical protein CLOLEP_02930 [Clostridium leptum DSM 753] gi|156866740|gb|EDO60112.1| hypothetical protein CLOLEP_02930 [Clostridium leptum DSM 753] Length = 74 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 30/57 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 FF+ ++E KKI WP+ V ++ VV+ ++ I +F +D + L +G+ Sbjct: 17 KFFRDCKNEIKKIVWPTPKAVFKNMGVVLSVIIIIGLFIFALDTGLINLFRLFMGVA 73 >gi|269796270|ref|YP_003315725.1| preprotein translocase, SecE subunit [Sanguibacter keddieii DSM 10542] gi|269098455|gb|ACZ22891.1| preprotein translocase, SecE subunit [Sanguibacter keddieii DSM 10542] Length = 92 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 31/57 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QV E KK+ P+RSE+ +VVI+ + + F L +D I + ++ G Sbjct: 36 IALFVRQVVAELKKVVTPTRSELWNYTLVVIVFVLVCMAFVLALDYVINKGVFWVFG 92 >gi|261415676|ref|YP_003249359.1| preprotein translocase, SecE subunit [Fibrobacter succinogenes subsp. succinogenes S85] gi|261372132|gb|ACX74877.1| preprotein translocase, SecE subunit [Fibrobacter succinogenes subsp. succinogenes S85] gi|302327690|gb|ADL26891.1| preprotein translocase, SecE subunit [Fibrobacter succinogenes subsp. succinogenes S85] Length = 62 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 31/57 (54%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + + E K++ WP+ E+ S +VV++ I + +D + W+++FI+G G Sbjct: 6 QYVSESVQELKQVTWPTWEELKGSTLVVMLFSVIMGFYIAGLDFVLSWIVNFIMGRG 62 >gi|19551717|ref|NP_599719.1| preprotein translocase subunit SecE [Corynebacterium glutamicum ATCC 13032] gi|62389372|ref|YP_224774.1| preprotein translocase subunit SecE [Corynebacterium glutamicum ATCC 13032] gi|7108626|gb|AAF36505.1|AF130462_2 SecE protein [Corynebacterium glutamicum] gi|14041186|emb|CAC38382.1| SecE protein [Corynebacterium glutamicum] gi|21323239|dbj|BAB97867.1| Preprotein translocase subunit SecE [Corynebacterium glutamicum ATCC 13032] gi|41324706|emb|CAF19188.1| SecE subunit of protein translocation complex [Corynebacterium glutamicum ATCC 13032] Length = 111 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 29/57 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V++F +V E +K+ WP+ +++ +VV+ L + + +D G + IL Sbjct: 53 GVISFLPEVVGEVRKVIWPTARQMVTYTLVVLGFLIVLTALVSGVDFLAGLGVEKIL 109 >gi|329907540|ref|ZP_08274681.1| Preprotein translocase subunit SecE [Oxalobacteraceae bacterium IMCC9480] gi|327546947|gb|EGF31852.1| Preprotein translocase subunit SecE [Oxalobacteraceae bacterium IMCC9480] Length = 127 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 31/55 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 LNF + E+KK+ WP+R E + +V + + ++F D+ + ++++ ++ Sbjct: 68 LNFASEAVRETKKVVWPTRKEAMQITAIVFCFVLVMALFLWGTDKLLEFILYDLI 122 >gi|305679703|ref|ZP_07402513.1| preprotein translocase, SecE subunit [Corynebacterium matruchotii ATCC 14266] gi|305660323|gb|EFM49820.1| preprotein translocase, SecE subunit [Corynebacterium matruchotii ATCC 14266] Length = 107 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 28/60 (46%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + V+ F +V E +K+ WP+ ++L I+V L + + +D G + +L Sbjct: 46 RQNKVVAFMPEVVSEMRKVIWPTARQMLNYTIIVFAFLILLTGLVAGVDFLAGIGVEKVL 105 >gi|16802291|ref|NP_463776.1| preprotein translocase subunit SecE [Listeria monocytogenes EGD-e] gi|224498909|ref|ZP_03667258.1| preprotein translocase subunit SecE [Listeria monocytogenes Finland 1988] gi|224502461|ref|ZP_03670768.1| preprotein translocase subunit SecE [Listeria monocytogenes FSL R2-561] gi|254825711|ref|ZP_05230712.1| predicted protein [Listeria monocytogenes FSL J1-194] gi|254828705|ref|ZP_05233392.1| predicted protein [Listeria monocytogenes FSL N3-165] gi|254831930|ref|ZP_05236585.1| preprotein translocase subunit SecE [Listeria monocytogenes 10403S] gi|254853488|ref|ZP_05242836.1| predicted protein [Listeria monocytogenes FSL R2-503] gi|255026644|ref|ZP_05298630.1| preprotein translocase subunit SecE [Listeria monocytogenes FSL J2-003] gi|255030087|ref|ZP_05302038.1| preprotein translocase subunit SecE [Listeria monocytogenes LO28] gi|255520311|ref|ZP_05387548.1| preprotein translocase subunit SecE [Listeria monocytogenes FSL J1-175] gi|284800539|ref|YP_003412404.1| preprotein translocase subunit SecE [Listeria monocytogenes 08-5578] gi|284993725|ref|YP_003415493.1| preprotein translocase subunit SecE [Listeria monocytogenes 08-5923] gi|300764630|ref|ZP_07074622.1| preprotein translocase, SecE subunit [Listeria monocytogenes FSL N1-017] gi|16409610|emb|CAD00772.1| secE [Listeria monocytogenes EGD-e] gi|258601110|gb|EEW14435.1| predicted protein [Listeria monocytogenes FSL N3-165] gi|258606860|gb|EEW19468.1| predicted protein [Listeria monocytogenes FSL R2-503] gi|284056101|gb|ADB67042.1| preprotein translocase subunit SecE [Listeria monocytogenes 08-5578] gi|284059192|gb|ADB70131.1| preprotein translocase subunit SecE [Listeria monocytogenes 08-5923] gi|293594955|gb|EFG02716.1| predicted protein [Listeria monocytogenes FSL J1-194] gi|300514737|gb|EFK41792.1| preprotein translocase, SecE subunit [Listeria monocytogenes FSL N1-017] Length = 59 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ FF+ V E K+ WP+R E+L + V+I + + ++FF++ID I ++ I+ Sbjct: 3 AIAKFFRNVSSEMHKVTWPTRKELLTYTVTVVITVVLFALFFMLIDFGIEQIIKLIV 59 >gi|162448674|ref|YP_001611041.1| preprotein translocase, SecE subunit [Sorangium cellulosum 'So ce 56'] gi|161159256|emb|CAN90561.1| preprotein translocase, SecE subunit [Sorangium cellulosum 'So ce 56'] Length = 132 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 30/53 (56%) Query: 14 QVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 V E K+ WP++ EV + VVI ++++++ ++D+ ++ + + G G Sbjct: 79 DVAAELAKVKWPTKKEVTNATFVVIATTTVATLYLALLDRFWAFVTNIVYGDG 131 >gi|297569435|ref|YP_003690779.1| preprotein translocase, SecE subunit [Desulfurivibrio alkaliphilus AHT2] gi|296925350|gb|ADH86160.1| preprotein translocase, SecE subunit [Desulfurivibrio alkaliphilus AHT2] Length = 83 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 34/62 (54%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G + F +VR E K+ WP++ + ++S VVI ++ + +++ ID +G L+ Sbjct: 21 GSRLTQIRQFMSEVRQEFGKVVWPAKKQTIMSTTVVIALVIVVAIYLGSIDLVLGKLVGA 80 Query: 62 IL 63 IL Sbjct: 81 IL 82 >gi|257795366|ref|ZP_05644345.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9781] gi|258408947|ref|ZP_05681228.1| preprotein translocase subunit SecE [Staphylococcus aureus A9763] gi|258420415|ref|ZP_05683358.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9719] gi|258422618|ref|ZP_05685524.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9635] gi|282907863|ref|ZP_06315698.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus WW2703/97] gi|282910176|ref|ZP_06317980.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus WBG10049] gi|257789338|gb|EEV27678.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9781] gi|257840298|gb|EEV64761.1| preprotein translocase subunit SecE [Staphylococcus aureus A9763] gi|257843605|gb|EEV68011.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9719] gi|257847190|gb|EEV71198.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9635] gi|282325568|gb|EFB55876.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus WBG10049] gi|282328247|gb|EFB58525.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus WW2703/97] gi|323439805|gb|EGA97522.1| preprotein translocase subunit SecE [Staphylococcus aureus O11] gi|323443093|gb|EGB00713.1| preprotein translocase subunit SecE [Staphylococcus aureus O46] Length = 65 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FFK V+ E +K WP++ E+ ++V+ + VFF +D I L + + G Sbjct: 12 FFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFG 65 >gi|167582636|ref|ZP_02375510.1| preprotein translocase subunit SecE [Burkholderia thailandensis TXDOH] gi|167620750|ref|ZP_02389381.1| preprotein translocase subunit SecE [Burkholderia thailandensis Bt4] gi|257137629|ref|ZP_05585891.1| preprotein translocase subunit SecE [Burkholderia thailandensis E264] gi|83654696|gb|ABC38759.1| preprotein translocase, SecE subunit [Burkholderia thailandensis E264] Length = 110 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 30/59 (50%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 M + + + F K E +K+ WP+R E + +VV + + ++ + D+SI W + Sbjct: 44 MSLPGKSFIAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALLLWISDKSIEWAI 102 >gi|146297209|ref|YP_001180980.1| preprotein translocase, SecE subunit [Caldicellulosiruptor saccharolyticus DSM 8903] gi|145410785|gb|ABP67789.1| protein translocase subunit secE/sec61 gamma [Caldicellulosiruptor saccharolyticus DSM 8903] Length = 89 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM-HFILG 64 + FFK VR E KK+ WPS+ +V+ IVV+ +VF L+ D L+ F+L Sbjct: 28 TKTVKFFKDVRIEMKKVVWPSQKQVIKHTIVVLTFTLFFTVFILLADVIYEQLIFKFLLK 87 Query: 65 I 65 I Sbjct: 88 I 88 >gi|307152581|ref|YP_003887965.1| preprotein translocase subunit SecE [Cyanothece sp. PCC 7822] gi|306982809|gb|ADN14690.1| preprotein translocase, SecE subunit [Cyanothece sp. PCC 7822] Length = 78 Score = 44.8 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 31/60 (51%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + F K+ ++E K+ WPSR +++ VI+M+++ + ++D W+ + Sbjct: 19 QKFQLTEFTKETKEELGKVVWPSRQQLISESAAVILMVTLVATIIYLVDNFFAWVAGKVF 78 >gi|329938258|ref|ZP_08287709.1| preprotein translocase SecE subunit [Streptomyces griseoaurantiacus M045] gi|329302747|gb|EGG46637.1| preprotein translocase SecE subunit [Streptomyces griseoaurantiacus M045] Length = 95 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WPSR+++ VVI ++I VID + ++ G Sbjct: 42 FYRQIVAELRKVVWPSRNQLTSYTTVVIFFVAIMIGLVTVIDYGLNHAAKYVFG 95 >gi|260770574|ref|ZP_05879506.1| preprotein translocase subunit SecE [Vibrio furnissii CIP 102972] gi|260614404|gb|EEX39591.1| preprotein translocase subunit SecE [Vibrio furnissii CIP 102972] gi|315178370|gb|ADT85284.1| preprotein translocase subunit SecE [Vibrio furnissii NCTC 11218] Length = 84 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A + F ++ R E +K+ WP+R E + + ++V+ + + ++ ID + L+ F Sbjct: 23 KGKAAIIFARESRMEVRKVVWPTRQETMQTTLIVLAVSIVMALVLWGIDGIMVRLVAFAT 82 Query: 64 GI 65 G+ Sbjct: 83 GV 84 >gi|225621219|ref|YP_002722477.1| pututative preprotein translocase subunit SecE [Brachyspira hyodysenteriae WA1] gi|225216039|gb|ACN84773.1| pututative preprotein translocase subunit SecE [Brachyspira hyodysenteriae WA1] Length = 106 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Query: 4 NRLAVLNFFKQVRDES-KKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + +++ K+++ E ++ WP+R +V+ +VVII+L ++S F D + +L + Sbjct: 5 KKNNIIDSIKEIKKELFERSVWPTRQDVINQTVVVIILLILASAFLGAADYVVTFLTRAL 64 Query: 63 L 63 L Sbjct: 65 L 65 >gi|313673494|ref|YP_004051605.1| preprotein translocase, sece subunit [Calditerrivibrio nitroreducens DSM 19672] gi|312940250|gb|ADR19442.1| preprotein translocase, SecE subunit [Calditerrivibrio nitroreducens DSM 19672] Length = 60 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 39/56 (69%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +NF K+V++E KKI WP++ E + + VV+I + + ++F V+D ++ ++ FI+G Sbjct: 5 VNFIKEVKEELKKIVWPTKDETIGTTTVVVIFVVLMAIFLGVVDVALSKIIQFIVG 60 >gi|260887711|ref|ZP_05898974.1| preprotein translocase, SecE subunit [Selenomonas sputigena ATCC 35185] gi|330838617|ref|YP_004413197.1| preprotein translocase, SecE subunit [Selenomonas sputigena ATCC 35185] gi|260862591|gb|EEX77091.1| preprotein translocase, SecE subunit [Selenomonas sputigena ATCC 35185] gi|329746381|gb|AEB99737.1| preprotein translocase, SecE subunit [Selenomonas sputigena ATCC 35185] Length = 81 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 25/57 (43%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F +V+ E KK+ WP+ E++ VV + + + V D L IL Sbjct: 24 NLFRFLGEVKAEMKKVTWPTHRELVTYTGVVGVAVVVVCALIWVCDTFFARLFQLIL 80 >gi|270308264|ref|YP_003330322.1| preprotein translocase SecE subunit [Dehalococcoides sp. VS] gi|270154156|gb|ACZ61994.1| preprotein translocase SecE subunit [Dehalococcoides sp. VS] Length = 72 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 26/53 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF + E KK+ WPSR +V+ +V+++ + V+D W + + Sbjct: 18 FFSNLVAELKKVVWPSRPDVIKLTTMVLVVAIAVGIVLGVVDYGFSWFIDNVF 70 >gi|291482472|dbj|BAI83547.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. natto BEST195] Length = 59 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 31/58 (53%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ FFK V E KK+ WP E+ I VI + +FF ++D I L+ FI+ Sbjct: 1 MRIMKFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFVIFFALLDTGISQLIRFIV 58 >gi|77918302|ref|YP_356117.1| putative SecE preprotein translocase subunit [Pelobacter carbinolicus DSM 2380] gi|77544385|gb|ABA87947.1| protein translocase subunit secE/sec61 gamma [Pelobacter carbinolicus DSM 2380] Length = 62 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 29/55 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F V+ E KK+ WPS+ + S + VI+++ + F +D+ + + IL Sbjct: 6 MEFLGNVKVELKKVTWPSKRDGYGSTLAVIVLVLGVTAFLWGVDKLLSSAIGVIL 60 >gi|27467216|ref|NP_763853.1| preprotein translocase subunit SecE [Staphylococcus epidermidis ATCC 12228] gi|57866120|ref|YP_187772.1| preprotein translocase subunit SecE [Staphylococcus epidermidis RP62A] gi|242241867|ref|ZP_04796312.1| preprotein translocase subunit SecE [Staphylococcus epidermidis W23144] gi|251809952|ref|ZP_04824425.1| preprotein translocase subunit SecE [Staphylococcus epidermidis BCM-HMP0060] gi|293367911|ref|ZP_06614549.1| preprotein translocase subunit SecE [Staphylococcus epidermidis M23864:W2(grey)] gi|38605281|sp|Q8CQ86|SECE_STAES RecName: Full=Preprotein translocase subunit secE gi|81675391|sp|Q5HRL7|SECE_STAEQ RecName: Full=Preprotein translocase subunit secE gi|27314758|gb|AAO03895.1|AE016744_298 preprotein translocase subunit [Staphylococcus epidermidis ATCC 12228] gi|57636778|gb|AAW53566.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis RP62A] gi|242234645|gb|EES36957.1| preprotein translocase subunit SecE [Staphylococcus epidermidis W23144] gi|251806495|gb|EES59152.1| preprotein translocase subunit SecE [Staphylococcus epidermidis BCM-HMP0060] gi|291317940|gb|EFE58348.1| preprotein translocase subunit SecE [Staphylococcus epidermidis M23864:W2(grey)] Length = 60 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FFK V+ E +K WP++ E+ I+V+ + VFF +D I L LG Sbjct: 7 FFKGVKSEMEKTSWPTKEELFKYTIIVVSTVIFFLVFFYALDIGINALKQLFLG 60 >gi|256825903|ref|YP_003149863.1| preprotein translocase, SecE subunit [Kytococcus sedentarius DSM 20547] gi|256689296|gb|ACV07098.1| preprotein translocase, SecE subunit [Kytococcus sedentarius DSM 20547] Length = 98 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 AV+ F +QV DE +KI P+R E++ IVVI+ + + F +DQ L+ F+ G Sbjct: 41 AVVLFLQQVIDELRKIVRPTRDELVSYTIVVIVFVVVLMAFVFGLDQLFSRLISFVFG 98 >gi|239918214|ref|YP_002957772.1| protein translocase subunit secE/sec61 gamma [Micrococcus luteus NCTC 2665] gi|281415595|ref|ZP_06247337.1| protein translocase subunit secE/sec61 gamma [Micrococcus luteus NCTC 2665] gi|239839421|gb|ACS31218.1| protein translocase subunit secE/sec61 gamma [Micrococcus luteus NCTC 2665] Length = 83 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 30/59 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + F +QV DE +K+ P+ E+L + VV+ ++ + + +D G + + G G Sbjct: 23 IALFLRQVVDELRKVVTPTSEELLRTTGVVLAFVAFMILLVMGLDWVFGTVAGLLFGAG 81 >gi|73748762|ref|YP_308001.1| preprotein translocase subunit SecE [Dehalococcoides sp. CBDB1] gi|147669528|ref|YP_001214346.1| preprotein translocase subunit SecE [Dehalococcoides sp. BAV1] gi|73660478|emb|CAI83085.1| preprotein translocase, SecE subunit [Dehalococcoides sp. CBDB1] gi|146270476|gb|ABQ17468.1| protein translocase subunit secE/sec61 gamma [Dehalococcoides sp. BAV1] Length = 72 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 26/53 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF + E KK+ WP+R +V+ +V+++ + V+D W + + Sbjct: 18 FFSNLIAELKKVVWPTRPDVIKLTTMVLVVAITVGIVLGVVDYGFSWFIDNVF 70 >gi|167564430|ref|ZP_02357346.1| preprotein translocase subunit SecE [Burkholderia oklahomensis EO147] gi|167571576|ref|ZP_02364450.1| preprotein translocase subunit SecE [Burkholderia oklahomensis C6786] Length = 110 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 28/51 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + F K E +K+ WP+R E + +VV + + ++ + D+SI W++ Sbjct: 52 IAFAKDSYREVRKVVWPTRKEATQTTLVVFGFVLVMALLLWISDKSIEWVI 102 >gi|302671657|ref|YP_003831617.1| preprotein translocase subunit SecE [Butyrivibrio proteoclasticus B316] gi|302396130|gb|ADL35035.1| preprotein translocase subunit SecE [Butyrivibrio proteoclasticus B316] Length = 87 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 31/59 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + +FF V+ E KI WP++ +++ V+++ +I V+D + ++FI I Sbjct: 28 KIADFFSGVKAEFGKIIWPTKDDIIKQTTAVVVVSAICCALIAVLDIVFEYGVNFITSI 86 >gi|227832182|ref|YP_002833889.1| preprotein translocase secE subunit [Corynebacterium aurimucosum ATCC 700975] gi|262183966|ref|ZP_06043387.1| preprotein translocase subunit SecE [Corynebacterium aurimucosum ATCC 700975] gi|227453198|gb|ACP31951.1| preprotein translocase secE subunit [Corynebacterium aurimucosum ATCC 700975] Length = 108 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 28/58 (48%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +V +F +V E KK+ WP+ E+L V+V L + + +D G + IL Sbjct: 50 SVGSFPGEVVSEMKKVVWPTGKEMLQYVLVTFAFLVVLTALVWGVDTLTGLGVEAILA 107 >gi|34112953|gb|AAQ62398.1| predicted preprotein translocase subunit SecE [uncultured marine gamma proteobacterium EBAC31A08] Length = 120 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + ++ R E +K+ WP+R E + +VV + + +FF ++ + +L +LG Sbjct: 63 NAIKLMRESRTEIRKVVWPTRLETTQTFLVVFSAIXVLCLFFWGLESXLTFLTKLVLG 120 >gi|221194843|ref|ZP_03567900.1| preprotein translocase SecE subunit [Atopobium rimae ATCC 49626] gi|221185747|gb|EEE18137.1| preprotein translocase SecE subunit [Atopobium rimae ATCC 49626] Length = 123 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 28/58 (48%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + N+F VR E ++ WP++ E+ + VI M+ + ++D I + G+ Sbjct: 64 IKNYFSGVRTEMHRVVWPTKPELANWSLAVICMVVFFGLMTFLVDTGIVAGLVRFTGL 121 >gi|91791526|ref|YP_561177.1| preprotein translocase subunit SecE [Shewanella denitrificans OS217] gi|91713528|gb|ABE53454.1| protein translocase subunit secE/sec61 gamma [Shewanella denitrificans OS217] Length = 123 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 32/63 (50%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V L F ++ E +K+ WP+R E L + +V++ +I ++ D + L++ I Sbjct: 61 VKGKIALAFAQEAHIEVRKVVWPTRQEALNTTFIVLVATAIVALILWGFDAVLLRLVNLI 120 Query: 63 LGI 65 G+ Sbjct: 121 TGV 123 >gi|116871628|ref|YP_848409.1| preprotein translocase subunit SecE [Listeria welshimeri serovar 6b str. SLCC5334] gi|116740506|emb|CAK19626.1| preprotein translocase, SecE subunit [Listeria welshimeri serovar 6b str. SLCC5334] Length = 59 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ FF+ V E K+ WP+R E+L + V+I + + ++FF++ID I ++ I+ Sbjct: 3 AIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVILFALFFMLIDFGIEQIIKLIM 59 >gi|289705065|ref|ZP_06501476.1| preprotein translocase, SecE subunit [Micrococcus luteus SK58] gi|289558228|gb|EFD51508.1| preprotein translocase, SecE subunit [Micrococcus luteus SK58] Length = 83 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 30/59 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + F +QV DE +K+ P+ E+L + VV+ ++ + + +D G + + G G Sbjct: 23 IALFLRQVVDELRKVVTPTSEELLRTTGVVLAFVAFMILLVMGLDWVFGTVAGLLFGAG 81 >gi|16077168|ref|NP_387981.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. subtilis str. 168] gi|221307912|ref|ZP_03589759.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. subtilis str. 168] gi|221312233|ref|ZP_03594038.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. subtilis str. NCIB 3610] gi|221317167|ref|ZP_03598461.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. subtilis str. JH642] gi|221321430|ref|ZP_03602724.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. subtilis str. SMY] gi|321313771|ref|YP_004206058.1| preprotein translocase subunit SecE [Bacillus subtilis BSn5] gi|549784|sp|Q06799|SECE_BACSU RecName: Full=Preprotein translocase subunit secE gi|285627|dbj|BAA02559.1| E.coli SecE homologous protein [Bacillus subtilis] gi|2632367|emb|CAB11876.1| preprotein translocase subunit [Bacillus subtilis subsp. subtilis str. 168] gi|320020045|gb|ADV95031.1| preprotein translocase subunit SecE [Bacillus subtilis BSn5] Length = 59 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 30/58 (51%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ FFK V E KK+ WP E+ I VI + +FF ++D I L+ I+ Sbjct: 1 MRIMKFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFVIFFALLDTGISQLIRLIV 58 >gi|149376699|ref|ZP_01894458.1| preprotein translocase SecE [Marinobacter algicola DG893] gi|149359072|gb|EDM47537.1| preprotein translocase SecE [Marinobacter algicola DG893] Length = 122 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ R E +K+ WP+R E++ + +V++ + + ++ +D I WL+ ++G Sbjct: 67 ATLLKEARVEIRKVVWPTRPELIQTTAIVVVFVLVVALMLWGMDSLISWLVSGVIG 122 >gi|15923524|ref|NP_371058.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus Mu50] gi|15926212|ref|NP_373745.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus N315] gi|21282219|ref|NP_645307.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus MW2] gi|49482765|ref|YP_039989.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus MRSA252] gi|49485400|ref|YP_042621.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus MSSA476] gi|82750243|ref|YP_415984.1| preprotein translocase subunit SecE [Staphylococcus aureus RF122] gi|148266995|ref|YP_001245938.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus JH9] gi|150393042|ref|YP_001315717.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus JH1] gi|156978863|ref|YP_001441122.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus Mu3] gi|161353533|ref|YP_499089.2| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus NCTC 8325] gi|253315645|ref|ZP_04838858.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus str. CF-Marseille] gi|253731140|ref|ZP_04865305.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus USA300_TCH959] gi|253732543|ref|ZP_04866708.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus TCH130] gi|255005329|ref|ZP_05143930.2| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus Mu50-omega] gi|257424649|ref|ZP_05601076.1| preprotein translocase subunit secE [Staphylococcus aureus subsp. aureus 55/2053] gi|257427317|ref|ZP_05603716.1| preprotein translocase subunit secE [Staphylococcus aureus subsp. aureus 65-1322] gi|257429953|ref|ZP_05606337.1| translocase subunit SecE [Staphylococcus aureus subsp. aureus 68-397] gi|257432655|ref|ZP_05609015.1| translocase subunit secE [Staphylococcus aureus subsp. aureus E1410] gi|257435559|ref|ZP_05611607.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus M876] gi|258439336|ref|ZP_05690268.1| translocase subunit secE [Staphylococcus aureus A9299] gi|258444076|ref|ZP_05692413.1| translocase subunit secE [Staphylococcus aureus A8115] gi|258446344|ref|ZP_05694502.1| preprotein translocase subunit secE [Staphylococcus aureus A6300] gi|258448437|ref|ZP_05696552.1| preprotein translocase, SecE subunit [Staphylococcus aureus A6224] gi|258453793|ref|ZP_05701767.1| preprotein translocase, SecE subunit [Staphylococcus aureus A5937] gi|269202158|ref|YP_003281427.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus ED98] gi|282894970|ref|ZP_06303193.1| preprotein translocase, SecE subunit [Staphylococcus aureus A8117] gi|282903123|ref|ZP_06311014.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus C160] gi|282904913|ref|ZP_06312771.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus Btn1260] gi|282913368|ref|ZP_06321157.1| conserved domain protein [Staphylococcus aureus subsp. aureus M899] gi|282915858|ref|ZP_06323623.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus D139] gi|282918323|ref|ZP_06326060.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus C427] gi|282923285|ref|ZP_06330965.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus C101] gi|282928872|ref|ZP_06336463.1| preprotein translocase, SecE subunit [Staphylococcus aureus A10102] gi|283769691|ref|ZP_06342583.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus H19] gi|283957333|ref|ZP_06374786.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus A017934/97] gi|293500414|ref|ZP_06666265.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus 58-424] gi|293509359|ref|ZP_06668070.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus M809] gi|293523946|ref|ZP_06670633.1| conserved domain protein [Staphylococcus aureus subsp. aureus M1015] gi|295406912|ref|ZP_06816715.1| preprotein translocase [Staphylococcus aureus A8819] gi|295427073|ref|ZP_06819709.1| preprotein translocase [Staphylococcus aureus subsp. aureus EMRSA16] gi|296275781|ref|ZP_06858288.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus MR1] gi|297208751|ref|ZP_06925179.1| preprotein translocase [Staphylococcus aureus subsp. aureus ATCC 51811] gi|297246264|ref|ZP_06930113.1| preprotein translocase [Staphylococcus aureus A8796] gi|297590574|ref|ZP_06949213.1| preprotein translocase [Staphylococcus aureus subsp. aureus MN8] gi|300912841|ref|ZP_07130283.1| preprotein translocase [Staphylococcus aureus subsp. aureus TCH70] gi|60390819|sp|Q6GBV2|SECE_STAAS RecName: Full=Preprotein translocase subunit secE gi|60390826|sp|Q6GJD3|SECE_STAAR RecName: Full=Preprotein translocase subunit secE gi|60409398|sp|P0A0I1|SECE_STAAM RecName: Full=Preprotein translocase subunit secE gi|60409401|sp|P0A0I2|SECE_STAAN RecName: Full=Preprotein translocase subunit secE gi|60409405|sp|P0A0I3|SECE_STAAW RecName: Full=Preprotein translocase subunit secE gi|60409408|sp|P0A0I4|SECE_STAA8 RecName: Full=Preprotein translocase subunit secE gi|2078376|gb|AAB54017.1| SecE [Staphylococcus aureus] gi|13700425|dbj|BAB41723.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus N315] gi|14246302|dbj|BAB56696.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus Mu50] gi|21203655|dbj|BAB94355.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus MW2] gi|49240894|emb|CAG39561.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus MRSA252] gi|49243843|emb|CAG42268.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus MSSA476] gi|82655774|emb|CAI80174.1| preprotein translocase subunit [Staphylococcus aureus RF122] gi|147740064|gb|ABQ48362.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus JH9] gi|149945494|gb|ABR51430.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus JH1] gi|156720998|dbj|BAF77415.1| preprotein translocase subunit [Staphylococcus aureus subsp. aureus Mu3] gi|253725105|gb|EES93834.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus USA300_TCH959] gi|253729472|gb|EES98201.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus TCH130] gi|257272219|gb|EEV04342.1| preprotein translocase subunit secE [Staphylococcus aureus subsp. aureus 55/2053] gi|257275510|gb|EEV06983.1| preprotein translocase subunit secE [Staphylococcus aureus subsp. aureus 65-1322] gi|257279150|gb|EEV09751.1| translocase subunit SecE [Staphylococcus aureus subsp. aureus 68-397] gi|257282070|gb|EEV12205.1| translocase subunit secE [Staphylococcus aureus subsp. aureus E1410] gi|257284750|gb|EEV14869.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus M876] gi|257847673|gb|EEV71672.1| translocase subunit secE [Staphylococcus aureus A9299] gi|257850746|gb|EEV74691.1| translocase subunit secE [Staphylococcus aureus A8115] gi|257854938|gb|EEV77883.1| preprotein translocase subunit secE [Staphylococcus aureus A6300] gi|257858306|gb|EEV81193.1| preprotein translocase, SecE subunit [Staphylococcus aureus A6224] gi|257864049|gb|EEV86803.1| preprotein translocase, SecE subunit [Staphylococcus aureus A5937] gi|262074448|gb|ACY10421.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus ED98] gi|282314153|gb|EFB44543.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus C101] gi|282317457|gb|EFB47829.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus C427] gi|282320154|gb|EFB50499.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus D139] gi|282322400|gb|EFB52722.1| conserved domain protein [Staphylococcus aureus subsp. aureus M899] gi|282331738|gb|EFB61249.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus Btn1260] gi|282589480|gb|EFB94569.1| preprotein translocase, SecE subunit [Staphylococcus aureus A10102] gi|282596078|gb|EFC01039.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus C160] gi|282762652|gb|EFC02789.1| preprotein translocase, SecE subunit [Staphylococcus aureus A8117] gi|283459838|gb|EFC06928.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus H19] gi|283469827|emb|CAQ49038.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus ST398] gi|283790784|gb|EFC29599.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus A017934/97] gi|285816235|gb|ADC36722.1| Preprotein translocase subunit SecE [Staphylococcus aureus 04-02981] gi|290920909|gb|EFD97970.1| conserved domain protein [Staphylococcus aureus subsp. aureus M1015] gi|291095419|gb|EFE25680.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus 58-424] gi|291467456|gb|EFF09971.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus M809] gi|294968143|gb|EFG44169.1| preprotein translocase [Staphylococcus aureus A8819] gi|295128861|gb|EFG58491.1| preprotein translocase [Staphylococcus aureus subsp. aureus EMRSA16] gi|296886696|gb|EFH25601.1| preprotein translocase [Staphylococcus aureus subsp. aureus ATCC 51811] gi|297176862|gb|EFH36120.1| preprotein translocase [Staphylococcus aureus A8796] gi|297576873|gb|EFH95588.1| preprotein translocase [Staphylococcus aureus subsp. aureus MN8] gi|298693866|gb|ADI97088.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus ED133] gi|300885945|gb|EFK81148.1| preprotein translocase [Staphylococcus aureus subsp. aureus TCH70] gi|302332248|gb|ADL22441.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus JKD6159] gi|312439045|gb|ADQ78116.1| preprotein translocase [Staphylococcus aureus subsp. aureus TCH60] gi|312829031|emb|CBX33873.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus ECT-R 2] gi|315128828|gb|EFT84827.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus CGS03] gi|315193899|gb|EFU24293.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus CGS00] gi|329727923|gb|EGG64372.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus 21172] gi|329731028|gb|EGG67401.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus 21189] gi|329731958|gb|EGG68314.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus 21193] Length = 60 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FFK V+ E +K WP++ E+ ++V+ + VFF +D I L + + G Sbjct: 7 FFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFG 60 >gi|299143701|ref|ZP_07036781.1| preprotein translocase, SecE subunit [Peptoniphilus sp. oral taxon 386 str. F0131] gi|298518186|gb|EFI41925.1| preprotein translocase, SecE subunit [Peptoniphilus sp. oral taxon 386 str. F0131] Length = 70 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 34/62 (54%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 ++ +F+ V+ E KK+ WP++ EVL +VI++ + S+ + D+ + L F Sbjct: 9 KTEEKSLSKYFRGVKSEFKKVVWPTKQEVLNYSAIVIVVSILFSLLLALYDKIVLTLFKF 68 Query: 62 IL 63 I+ Sbjct: 69 II 70 >gi|282875014|ref|ZP_06283889.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis SK135] gi|281296342|gb|EFA88861.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis SK135] gi|319399716|gb|EFV87965.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis FRI909] gi|329729441|gb|EGG65844.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis VCU144] gi|329734655|gb|EGG70962.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis VCU028] gi|329738044|gb|EGG74265.1| preprotein translocase, SecE subunit [Staphylococcus epidermidis VCU045] Length = 61 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FFK V+ E +K WP++ E+ I+V+ + VFF +D I L LG Sbjct: 8 FFKGVKSEMEKTSWPTKEELFKYTIIVVSTVIFFLVFFYALDIGINALKQLFLG 61 >gi|171060543|ref|YP_001792892.1| preprotein translocase subunit SecE [Leptothrix cholodnii SP-6] gi|170777988|gb|ACB36127.1| preprotein translocase, SecE subunit [Leptothrix cholodnii SP-6] Length = 127 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 28/52 (53%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 A++ + ++ E +K+ WP+R E V + + ++F + D+++ W+ Sbjct: 66 ALVAYGRESVREMRKVVWPTRKEATQMTGYVFAFVVVMALFLWLTDKTLEWV 117 >gi|148263128|ref|YP_001229834.1| preprotein translocase subunit SecE [Geobacter uraniireducens Rf4] gi|146396628|gb|ABQ25261.1| protein translocase subunit secE/sec61 gamma [Geobacter uraniireducens Rf4] Length = 64 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 33/54 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NF ++V+ E K+ WP+R E + + VV++++ + S++ D + L+ FIL Sbjct: 10 NFLEEVKAELAKVTWPARKETISTAWVVVVIIVLISLYLGACDVVLAKLIRFIL 63 >gi|253701935|ref|YP_003023124.1| preprotein translocase subunit SecE [Geobacter sp. M21] gi|251776785|gb|ACT19366.1| preprotein translocase, SecE subunit [Geobacter sp. M21] Length = 61 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 31/54 (57%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF+ V+ E K+ WP+R E + + VV++++ I S++ D + L+ IL Sbjct: 7 TFFEDVQAELAKVTWPTRKETISTAQVVVVIIVIISLYLGACDVVLTKLIRSIL 60 >gi|307328011|ref|ZP_07607192.1| preprotein translocase, SecE subunit [Streptomyces violaceusniger Tu 4113] gi|306886316|gb|EFN17321.1| preprotein translocase, SecE subunit [Streptomyces violaceusniger Tu 4113] Length = 77 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R ++ VVI+ + I VID + ++ G Sbjct: 24 FYRQIIAELRKVVWPTRGQLSTYTSVVIVFVLIMIGIVTVIDYGFNNAIKYVFG 77 >gi|167627263|ref|YP_001677763.1| preprotein translocase subunit SecE [Francisella philomiragia subsp. philomiragia ATCC 25017] gi|167597264|gb|ABZ87262.1| preprotein translocase, subunit E, membrane protein [Francisella philomiragia subsp. philomiragia ATCC 25017] Length = 141 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 27/56 (48%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+ + E K+ WP+R E + +VI+++ I ++ + + + LG Sbjct: 86 WAFFQASKLELAKVVWPTRKETMTISAMVIVVVIIFALIISLFGVIFESFIQYFLG 141 >gi|241667818|ref|ZP_04755396.1| preprotein translocase subunit SecE [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254876362|ref|ZP_05249072.1| preprotein translocase subunit secE [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254842383|gb|EET20797.1| preprotein translocase subunit secE [Francisella philomiragia subsp. philomiragia ATCC 25015] Length = 141 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 27/56 (48%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+ + E K+ WP+R E + +VI+++ I ++ + + + LG Sbjct: 86 WAFFQASKLELAKVVWPTRKETMTISAMVIVVVIIFALIISLFGVIFESFIQYFLG 141 >gi|71905948|ref|YP_283535.1| preprotein translocase subunit SecE [Dechloromonas aromatica RCB] gi|71845569|gb|AAZ45065.1| protein translocase subunit secE/sec61 gamma [Dechloromonas aromatica RCB] Length = 117 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 12/49 (24%), Positives = 27/49 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 F + E+KK+ WP+R E + + V + + ++F + D+S+ ++ Sbjct: 59 FGNEAVVEAKKVVWPTRKETMQTTGAVFAFVVVMAIFLYLTDKSLEVVL 107 >gi|159896653|ref|YP_001542900.1| preprotein translocase subunit SecE [Herpetosiphon aurantiacus ATCC 23779] gi|159889692|gb|ABX02772.1| preprotein translocase, SecE subunit [Herpetosiphon aurantiacus ATCC 23779] Length = 72 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 24/55 (43%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + FF+ E +K+ WPSR E +VVI + + V D L+ I Sbjct: 17 IAQFFRDAFSEMRKVVWPSREETQRLTLVVIGISLLVGSILAVFDLLFETLVRLI 71 >gi|332178502|gb|AEE14191.1| preprotein translocase, SecE subunit [Thermodesulfobium narugense DSM 14796] Length = 75 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 33/60 (55%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + +F+ +V+ E++K+ WP R V+ + VV+ I +VF ID + +F++ Sbjct: 8 KEKIRSFYSEVKVEARKVSWPDRRTVISATGVVLAFSLIIAVFVGTIDAIFTAIFNFLIS 67 >gi|269793112|ref|YP_003318016.1| preprotein translocase, SecE subunit [Thermanaerovibrio acidaminovorans DSM 6589] gi|269100747|gb|ACZ19734.1| preprotein translocase, SecE subunit [Thermanaerovibrio acidaminovorans DSM 6589] Length = 60 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 33/56 (58%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V++F ++ R E KK+ WP+R +V S +VV+ + S + ++D + L+ ++ Sbjct: 4 VIDFLREARGELKKVAWPTRQQVWYSTLVVLFVTFAVSAYLGLVDAVLTGLLRGVV 59 >gi|289433599|ref|YP_003463471.1| preprotein translocase, SecE subunit [Listeria seeligeri serovar 1/2b str. SLCC3954] gi|289169843|emb|CBH26381.1| preprotein translocase, SecE subunit [Listeria seeligeri serovar 1/2b str. SLCC3954] gi|313635073|gb|EFS01423.1| preprotein translocase, SecE subunit [Listeria seeligeri FSL N1-067] gi|313639749|gb|EFS04502.1| preprotein translocase, SecE subunit [Listeria seeligeri FSL S4-171] Length = 59 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 35/57 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ FF+ V E K+ WP+R E+L + V+I + + +VFF+VID I L+ I+ Sbjct: 3 AIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVILFAVFFMVIDFGIEQLIQLIM 59 >gi|223936441|ref|ZP_03628353.1| preprotein translocase, SecE subunit [bacterium Ellin514] gi|223894959|gb|EEF61408.1| preprotein translocase, SecE subunit [bacterium Ellin514] Length = 85 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 34/53 (64%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 N+ ++ R+E KK WP+ +E+ S +VV+I +++ ++F +V+D + ++ Sbjct: 32 NYIQETREELKKCTWPTWAELKGSTLVVMICIALIAIFTIVVDFVFASFVRWV 84 >gi|150015030|ref|YP_001307284.1| preprotein translocase subunit SecE [Clostridium beijerinckii NCIMB 8052] gi|149901495|gb|ABR32328.1| preprotein translocase, SecE subunit [Clostridium beijerinckii NCIMB 8052] Length = 76 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 30/62 (48%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + + FF++V+ E KKI WPS+ E + + VI+ + ++ +D L I Sbjct: 13 IKSNGLFGFFREVKVEVKKITWPSKDETKKAFVAVIVFTLMYTILVGGLDSIFNNLFKMI 72 Query: 63 LG 64 L Sbjct: 73 LN 74 >gi|294789161|ref|ZP_06754400.1| preprotein translocase, SecE subunit [Simonsiella muelleri ATCC 29453] gi|294482902|gb|EFG30590.1| preprotein translocase, SecE subunit [Simonsiella muelleri ATCC 29453] Length = 72 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ E KK+ WP R E + + V++ +++ F +D I L +FIL Sbjct: 18 YIRESIIEFKKVVWPKRPEAVRMTMFVMVFVAVFGTFIYGVDSLISLLFNFIL 70 >gi|42524389|ref|NP_969769.1| preprotein translocase SecE subunit [Bdellovibrio bacteriovorus HD100] gi|39576598|emb|CAE80762.1| preprotein translocase SecE subunit [Bdellovibrio bacteriovorus HD100] Length = 125 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 30/52 (57%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++V E +K+ WPSR + I ++M+ ISSV D G+L++F++ Sbjct: 74 EEVVSEIRKVVWPSRKDTTAMTIACVVMVLISSVIISSFDLISGFLINFLMK 125 >gi|16799354|ref|NP_469622.1| preprotein translocase subunit SecE [Listeria innocua Clip11262] gi|16412706|emb|CAC95510.1| secE [Listeria innocua Clip11262] gi|313625358|gb|EFR95150.1| preprotein translocase, SecE subunit [Listeria innocua FSL J1-023] Length = 59 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ FF+ V E K+ WP+R E+L + V+I + + ++FF++ID I ++ I+ Sbjct: 3 AIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVILFALFFMLIDFGIEQIIKLIV 59 >gi|46906478|ref|YP_012867.1| preprotein translocase subunit SecE [Listeria monocytogenes str. 4b F2365] gi|47094613|ref|ZP_00232253.1| preprotein translocase, SecE subunit [Listeria monocytogenes str. 4b H7858] gi|217965668|ref|YP_002351346.1| preprotein translocase, SecE subunit [Listeria monocytogenes HCC23] gi|226222873|ref|YP_002756980.1| preprotein translocase subunit [Listeria monocytogenes Clip81459] gi|254900574|ref|ZP_05260498.1| preprotein translocase subunit SecE [Listeria monocytogenes J0161] gi|254913475|ref|ZP_05263487.1| predicted protein [Listeria monocytogenes J2818] gi|254932464|ref|ZP_05265823.1| predicted protein [Listeria monocytogenes HPB2262] gi|254937944|ref|ZP_05269641.1| predicted protein [Listeria monocytogenes F6900] gi|254991755|ref|ZP_05273945.1| preprotein translocase subunit SecE [Listeria monocytogenes FSL J2-064] gi|255022531|ref|ZP_05294517.1| preprotein translocase subunit SecE [Listeria monocytogenes FSL J1-208] gi|290892614|ref|ZP_06555607.1| predicted protein [Listeria monocytogenes FSL J2-071] gi|315274662|ref|ZP_07869501.1| preprotein translocase, SecE subunit [Listeria marthii FSL S4-120] gi|46879742|gb|AAT03044.1| preprotein translocase, SecE subunit [Listeria monocytogenes serotype 4b str. F2365] gi|47017010|gb|EAL07903.1| preprotein translocase, SecE subunit [Listeria monocytogenes str. 4b H7858] gi|217334938|gb|ACK40732.1| preprotein translocase, SecE subunit [Listeria monocytogenes HCC23] gi|225875335|emb|CAS04032.1| Putative preprotein translocase subunit [Listeria monocytogenes serotype 4b str. CLIP 80459] gi|258610553|gb|EEW23161.1| predicted protein [Listeria monocytogenes F6900] gi|290557923|gb|EFD91444.1| predicted protein [Listeria monocytogenes FSL J2-071] gi|293584020|gb|EFF96052.1| predicted protein [Listeria monocytogenes HPB2262] gi|293591483|gb|EFF99817.1| predicted protein [Listeria monocytogenes J2818] gi|307569784|emb|CAR82963.1| preprotein translocase, SecE subunit [Listeria monocytogenes L99] gi|313611162|gb|EFR85987.1| preprotein translocase, SecE subunit [Listeria monocytogenes FSL F2-208] gi|313615708|gb|EFR88997.1| preprotein translocase, SecE subunit [Listeria marthii FSL S4-120] gi|328467854|gb|EGF38894.1| preprotein translocase subunit SecE [Listeria monocytogenes 1816] gi|328476086|gb|EGF46795.1| preprotein translocase subunit SecE [Listeria monocytogenes 220] Length = 59 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ FF+ V E K+ WP+R E+L + V+I + + ++FF++ID I ++ I+ Sbjct: 3 AIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVVLFALFFMLIDFGIEQIIKLIV 59 >gi|87300787|ref|ZP_01083629.1| putative preprotein translocase, SecE subunit [Synechococcus sp. WH 5701] gi|87284658|gb|EAQ76610.1| putative preprotein translocase, SecE subunit [Synechococcus sp. WH 5701] Length = 82 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 27/53 (50%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F +E +K+ WPSR ++ + VI+M+S+S+ +D+ W + Sbjct: 29 FVSSTLEELRKVVWPSRQQLFSESVAVILMVSLSAATIAAVDRFYSWASSQVF 81 >gi|258591303|emb|CBE67602.1| Preprotein translocase subunit secE [NC10 bacterium 'Dutch sediment'] Length = 64 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 22/55 (40%), Positives = 36/55 (65%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F K+VR E K++ WP R EV+ S IVVI+ + I S+F V+D ++ L+ ++ Sbjct: 9 VQFLKEVRTELKRVNWPLRKEVVGSTIVVIVSVFILSLFLGVVDVTLQKLLTLVV 63 >gi|25027041|ref|NP_737095.1| preprotein translocase subunit SecE [Corynebacterium efficiens YS-314] gi|259508476|ref|ZP_05751376.1| SecE subunit of protein translocation complex [Corynebacterium efficiens YS-314] gi|23492321|dbj|BAC17295.1| putative protein translocase SecE [Corynebacterium efficiens YS-314] gi|259163940|gb|EEW48494.1| SecE subunit of protein translocation complex [Corynebacterium efficiens YS-314] Length = 109 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 29/57 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V++F +V E +K+ WP+ +++ IVV++ L I + +D G + L Sbjct: 51 GVVSFLPEVVTEIRKVIWPTARQMVTYTIVVLVFLIILTALVSGVDFIAGLGVEKAL 107 >gi|89902362|ref|YP_524833.1| preprotein translocase subunit SecE [Rhodoferax ferrireducens T118] gi|89347099|gb|ABD71302.1| protein translocase subunit secE/sec61 gamma [Rhodoferax ferrireducens T118] Length = 127 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 27/52 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 A+ F + E KK+ WP+R E + V + + ++F + D+++ WL Sbjct: 66 ALYAFGQDAWREVKKVVWPARKEAIQMTAYVFGFVLLMALFLWLTDKTLEWL 117 >gi|23097560|ref|NP_691026.1| preprotein translocase subunit [Oceanobacillus iheyensis HTE831] gi|22775783|dbj|BAC12061.1| preprotein translocase subunit [Oceanobacillus iheyensis HTE831] Length = 57 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 27/52 (51%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 F + V E KK+ WP E+ +VVI + +VFF V+D I L++ Sbjct: 2 FKFLRNVSREMKKVSWPKGKELRNYTVVVISTVIFMAVFFFVVDLGISQLLN 53 >gi|229824603|ref|ZP_04450672.1| hypothetical protein GCWU000282_01950 [Catonella morbi ATCC 51271] gi|229785974|gb|EEP22088.1| hypothetical protein GCWU000282_01950 [Catonella morbi ATCC 51271] Length = 57 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 29/55 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + K V E K++ WPS EV VIIM+ + ++F ID + L+++ + Sbjct: 3 YIKNVGKEMKRVTWPSLGEVNKYTWTVIIMVVLLGLYFGGIDFGLSNLLNYFYAL 57 >gi|296333097|ref|ZP_06875551.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305672799|ref|YP_003864470.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. spizizenii str. W23] gi|296149713|gb|EFG90608.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305411042|gb|ADM36160.1| preprotein translocase subunit SecE [Bacillus subtilis subsp. spizizenii str. W23] Length = 59 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 30/58 (51%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ FFK V E KK+ WP E+ I VI + +FF ++D I L+ I+ Sbjct: 1 MRIMRFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFILFFALLDTGISQLIRLIV 58 >gi|124024463|ref|YP_001018770.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. MIT 9303] gi|123964749|gb|ABM79505.1| putative preprotein translocase, SecE subunit [Prochlorococcus marinus str. MIT 9303] Length = 90 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 25/53 (47%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F +E + WPSR ++ I VI+M+S+S+ F + + W I Sbjct: 37 FLAATYEELSLVVWPSRQQLFSESIAVILMVSLSAAFIAAVSRFYSWASSQIF 89 >gi|157690883|ref|YP_001485345.1| preprotein translocase subunit SecE [Bacillus pumilus SAFR-032] gi|194017439|ref|ZP_03056050.1| preprotein translocase, SecE subunit [Bacillus pumilus ATCC 7061] gi|157679641|gb|ABV60785.1| Sec family Type II general secretory pathway preprotein translocase SecE [Bacillus pumilus SAFR-032] gi|194010711|gb|EDW20282.1| preprotein translocase, SecE subunit [Bacillus pumilus ATCC 7061] Length = 58 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 33/57 (57%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + +++F K V E KK+ WP ++E++ I VI+ + ++FF +D I L+ I Sbjct: 1 MRIISFLKSVGKEMKKVSWPKKNEMIRYTITVILTVVFFAIFFSFLDIGISQLIELI 57 >gi|322418351|ref|YP_004197574.1| preprotein translocase subunit SecE [Geobacter sp. M18] gi|320124738|gb|ADW12298.1| preprotein translocase, SecE subunit [Geobacter sp. M18] Length = 61 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 30/54 (55%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF+ V+ E K+ WP+R E + VV++++ + S++ D + L+ IL Sbjct: 7 TFFEDVQAELAKVTWPTRKETFSTAQVVVVIIVLISLYLGACDVVLTKLIRSIL 60 >gi|315917858|ref|ZP_07914098.1| predicted protein [Fusobacterium gonidiaformans ATCC 25563] gi|317059455|ref|ZP_07923940.1| predicted protein [Fusobacterium sp. 3_1_5R] gi|313685131|gb|EFS21966.1| predicted protein [Fusobacterium sp. 3_1_5R] gi|313691733|gb|EFS28568.1| predicted protein [Fusobacterium gonidiaformans ATCC 25563] Length = 78 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 34/62 (54%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + +++ F+ VR E K+ WP + +++ S + V++M I S++ V D L+ ++ Sbjct: 14 RKGELMSLFQDVRKEYSKVQWPKKKDIISSTVWVVVMAVILSIYLGVFDLIATRLLKNLV 73 Query: 64 GI 65 + Sbjct: 74 SL 75 >gi|15607136|ref|NP_214325.1| preprotein translocase subunit SecE [Aquifex aeolicus VF5] gi|215794646|pdb|3DL8|C Chain C, Structure Of The Complex Of Aquifex Aeolicus Secyeg And Bacillus Subtilis Seca gi|215794647|pdb|3DL8|D Chain D, Structure Of The Complex Of Aquifex Aeolicus Secyeg And Bacillus Subtilis Seca Length = 65 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 32/56 (57%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K VRDE K++ WPSR V+ + I VII V+ ++D + ++ FIL + Sbjct: 6 EFLKGVRDELKRVVWPSRELVVKATISVIIFSLAIGVYLWILDLTFTKIISFILSL 61 >gi|134298079|ref|YP_001111575.1| preprotein translocase subunit SecE [Desulfotomaculum reducens MI-1] gi|134050779|gb|ABO48750.1| protein translocase subunit secE/sec61 gamma [Desulfotomaculum reducens MI-1] Length = 122 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 32/58 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +V + + V++E KK+ WP+R EV+ VV+ +++ + V+D + + IL Sbjct: 65 SVSKYLRGVQNELKKVHWPTRKEVVTYTAVVLASVAVVAAVIWVLDSLLSLGVSAILS 122 >gi|288818177|ref|YP_003432525.1| preprotein translocase SecE subunit [Hydrogenobacter thermophilus TK-6] gi|288787577|dbj|BAI69324.1| preprotein translocase SecE subunit [Hydrogenobacter thermophilus TK-6] gi|308751778|gb|ADO45261.1| preprotein translocase, SecE subunit [Hydrogenobacter thermophilus TK-6] Length = 64 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 30/58 (51%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + +F K VR E ++ WP R V + I VII + V+ ++D ++H +L + Sbjct: 4 IKSFIKGVRQEVDRVTWPDRKLVTKATISVIIFSLLIGVYLWLLDVGFTRMIHLLLSL 61 >gi|152980358|ref|YP_001355116.1| preprotein translocase SecE subunit [Janthinobacterium sp. Marseille] gi|151280435|gb|ABR88845.1| preprotein translocase SecE subunit [Janthinobacterium sp. Marseille] Length = 127 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 31/55 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 LNF K+ E+KK+ WP+R E L +V + + ++F D+ + +++ ++ Sbjct: 68 LNFSKEAVRETKKVVWPTRKEALQMTAIVFGFVLVMALFLWGTDKLLEVVLYDLI 122 >gi|288573183|ref|ZP_06391540.1| preprotein translocase, SecE subunit [Dethiosulfovibrio peptidovorans DSM 11002] gi|288568924|gb|EFC90481.1| preprotein translocase, SecE subunit [Dethiosulfovibrio peptidovorans DSM 11002] Length = 60 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 33/58 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V F ++ R E KK+ WP + +V S +VVI + + +V+ ++D ++ + ++G Sbjct: 3 KVFGFIREARAELKKVTWPGKQQVWYSTLVVIFVTLLVAVYLGIVDMALTGIFSRVIG 60 >gi|229821643|ref|YP_002883169.1| preprotein translocase, SecE subunit [Beutenbergia cavernae DSM 12333] gi|229567556|gb|ACQ81407.1| preprotein translocase, SecE subunit [Beutenbergia cavernae DSM 12333] Length = 87 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 33/57 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QV E KK+ P+RSE++ VVI+ + ++ V+D IG L+ ++ G Sbjct: 27 IALFVRQVIAELKKVVRPTRSELMTYTAVVIVFVLAVMLYVGVLDFGIGKLVLWVFG 83 >gi|83591290|ref|YP_431299.1| preprotein translocase subunit SecE [Moorella thermoacetica ATCC 39073] gi|83574204|gb|ABC20756.1| protein translocase subunit secE/sec61 gamma [Moorella thermoacetica ATCC 39073] Length = 79 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K E KK+ WP+R E++ VV++ + I + V D + +L+ ++ Sbjct: 24 KFLKGSWAELKKVHWPTRRELVTYTTVVLVSVLIVAALLSVFDSAFSFLLGKLI 77 >gi|315301177|ref|ZP_07872441.1| preprotein translocase, SecE subunit [Listeria ivanovii FSL F6-596] gi|313630447|gb|EFR98316.1| preprotein translocase, SecE subunit [Listeria ivanovii FSL F6-596] Length = 59 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 34/57 (59%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ FF+ V E K+ WP+R E+L + V+I + + ++FF+ ID I L+ I+ Sbjct: 3 AIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVILFALFFMFIDFGIEQLIKLIM 59 >gi|284042785|ref|YP_003393125.1| preprotein translocase, SecE subunit [Conexibacter woesei DSM 14684] gi|283947006|gb|ADB49750.1| preprotein translocase, SecE subunit [Conexibacter woesei DSM 14684] Length = 187 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 26/55 (47%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 LNF + E +++ WP R +V + VVI + +S F D ++ I+ Sbjct: 133 LNFLRGSWRELQRVQWPDRKQVTSATAVVIGFVLLSGAFLGAADWVSSRIVDLIV 187 >gi|300871170|ref|YP_003786042.1| putative preprotein translocase subunit SecE [Brachyspira pilosicoli 95/1000] gi|300688870|gb|ADK31541.1| pututative preprotein translocase, subunit SecE [Brachyspira pilosicoli 95/1000] Length = 106 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Query: 4 NRLAVLNFFKQVRDES-KKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + + N ++++ E ++ WP+R EVL +VV+I+L +S+ F D + +L + Sbjct: 5 KKNKLFNSLEEIKKELFERSVWPTRQEVLNQTVVVVILLILSAAFLGAADYIVTFLTRAL 64 Query: 63 L 63 L Sbjct: 65 L 65 >gi|317968195|ref|ZP_07969585.1| preprotein translocase subunit SecE [Synechococcus sp. CB0205] Length = 88 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 26/53 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F E +K+ WPSR ++ + VI+M++IS+ +D+ W + Sbjct: 35 FVADTVAELRKVVWPSRQQLFGESVAVILMVTISAFAIAAVDRFYSWGSSQVF 87 >gi|308233404|ref|ZP_07664141.1| preprotein translocase, SecE subunit [Atopobium vaginae DSM 15829] gi|328943540|ref|ZP_08241005.1| preprotein translocase subunit SecE [Atopobium vaginae DSM 15829] gi|327491509|gb|EGF23283.1| preprotein translocase subunit SecE [Atopobium vaginae DSM 15829] Length = 121 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 28/64 (43%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 N + +FK V+ E ++ WPS+ E+ VI L + + ++D L+ Sbjct: 56 KANGGRIKTYFKAVKTEMHRVVWPSKPELKNYSGAVICALVVCGLAIWLVDTGFVALLVS 115 Query: 62 ILGI 65 G+ Sbjct: 116 FTGL 119 >gi|194333126|ref|YP_002014986.1| preprotein translocase subunit SecE [Prosthecochloris aestuarii DSM 271] gi|194310944|gb|ACF45339.1| preprotein translocase, SecE subunit [Prosthecochloris aestuarii DSM 271] Length = 63 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 30/54 (55%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ V +E +K+ WPSR EV +VV+ + +VF V+D +I + +L Sbjct: 10 RYYHDVLNEMRKVSWPSRDEVKDLTLVVLTVSGALAVFTFVVDWAITSFISQLL 63 >gi|218767187|ref|YP_002341699.1| preprotein translocase subunit SecE [Neisseria meningitidis Z2491] gi|121051195|emb|CAM07466.1| putative preprotein translocase SECE subunit [Neisseria meningitidis Z2491] gi|319411392|emb|CBY91803.1| preprotein translocase SecE subunit [Neisseria meningitidis WUE 2594] Length = 92 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 26/50 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 +F E KK+ WP R + + + VI+ +++ S+F D +I WL Sbjct: 33 FAYFSNSWFEFKKVVWPKREDAVRMTVFVIVFVAVLSIFIYAADTAISWL 82 >gi|302337465|ref|YP_003802671.1| preprotein translocase, SecE subunit [Spirochaeta smaragdinae DSM 11293] gi|301634650|gb|ADK80077.1| preprotein translocase, SecE subunit [Spirochaeta smaragdinae DSM 11293] Length = 59 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 30/57 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +L FFK E +++ WPSR EV+ S VVI+ + ++ ++D + + I Sbjct: 3 KILQFFKNSYAELRRVVWPSREEVISSTKVVIVSTVLFALVLGIVDFLLLKGIDLIF 59 >gi|219871897|ref|YP_002476272.1| preprotein translocase subunit SecE [Haemophilus parasuis SH0165] gi|219692101|gb|ACL33324.1| preprotein translocase subunit SecE [Haemophilus parasuis SH0165] Length = 136 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 29/55 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K R E +KI WP+R E + ++V+ M + ++ ID I ++ F+ + Sbjct: 80 FIKDSRQELRKIIWPNRQETTQTTLMVVAMCVVVALALWGIDSIIVLIIDFLTNL 134 >gi|313903165|ref|ZP_07836559.1| protein translocase subunit secE/sec61 gamma [Thermaerobacter subterraneus DSM 13965] gi|313466667|gb|EFR62187.1| protein translocase subunit secE/sec61 gamma [Thermaerobacter subterraneus DSM 13965] Length = 65 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 29/56 (51%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V FF+Q E +++ WP+R + + VV+ ++ + V+D I ++ +L Sbjct: 8 VARFFRQTVAELRRVVWPNRQQTVTYTAVVLGTVAFLAALIWVVDFVIRQVIQLVL 63 >gi|304439414|ref|ZP_07399325.1| preprotein translocase [Peptoniphilus duerdenii ATCC BAA-1640] gi|304372110|gb|EFM25705.1| preprotein translocase [Peptoniphilus duerdenii ATCC BAA-1640] Length = 71 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 33/55 (60%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + V+ E KK+ WP++ +V+ VVI++ +S++ D+ + +++ I+G Sbjct: 16 KYLRGVKSEFKKVVWPTKEQVIKYSTVVIVVSILSALVLSAYDEIVYFIIKLIVG 70 >gi|260222523|emb|CBA32171.1| hypothetical protein Csp_D30790 [Curvibacter putative symbiont of Hydra magnipapillata] Length = 127 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 27/51 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 ++ F + E KK+ WP+R E + V + I +VF + D+++ WL Sbjct: 67 LIAFGRDAWREVKKVVWPARKEAIQITAYVFGFVLIMAVFLWLTDKTLEWL 117 >gi|190572931|ref|YP_001970776.1| preprotein translocase subunit SecE [Stenotrophomonas maltophilia K279a] gi|190010853|emb|CAQ44462.1| putative transmembrane preprotein translocase subunit [Stenotrophomonas maltophilia K279a] Length = 137 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F + R E +K+ WP+R E + VV+++++I S+ D I WL+ L Sbjct: 82 EFLSESRFELRKVVWPTRQEAIRMTWVVMVVVTILSLLLGGFDYVIQWLVQLFLS 136 >gi|164686514|ref|ZP_02210542.1| hypothetical protein CLOBAR_00081 [Clostridium bartlettii DSM 16795] gi|164604383|gb|EDQ97848.1| hypothetical protein CLOBAR_00081 [Clostridium bartlettii DSM 16795] Length = 74 Score = 43.3 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 10/61 (16%), Positives = 30/61 (49%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R +++ + K+ E K++ W ++ E+L + +V+ + ++ +D + + I+ Sbjct: 14 KRFSLVAYIKETIAELKRVTWSTKKELLKNTGIVLATIISFTILAWALDTLLSGALALII 73 Query: 64 G 64 Sbjct: 74 K 74 >gi|167855962|ref|ZP_02478709.1| translocase [Haemophilus parasuis 29755] gi|167852899|gb|EDS24166.1| translocase [Haemophilus parasuis 29755] Length = 136 Score = 43.3 bits (101), Expect = 0.010, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 29/55 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K R E +KI WP+R E + ++V+ M + ++ ID I ++ F+ + Sbjct: 80 FIKDSRQELRKIIWPNRQETTQTTLMVVAMCVVVALALWGIDSIIVLIIDFLTNL 134 >gi|260437418|ref|ZP_05791234.1| preprotein translocase subunit SecE [Butyrivibrio crossotus DSM 2876] gi|292810050|gb|EFF69255.1| preprotein translocase subunit SecE [Butyrivibrio crossotus DSM 2876] Length = 95 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 26/62 (41%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G + + FF ++ E KKI WP+R + + V++ + + +D I Sbjct: 32 GRKKSEKVGFFASMKAEFKKIIWPNRQSLGRQTLAVLVCTVVLGLIIFGLDFVISTGFDK 91 Query: 62 IL 63 I Sbjct: 92 IF 93 >gi|309389946|gb|ADO77826.1| preprotein translocase, SecE subunit [Halanaerobium praevalens DSM 2228] Length = 67 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 33/58 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FFK V+ E KK+ WP++ ++ + +VVI+ + F VID ++ ++ ++ Sbjct: 10 KISKFFKSVKSELKKVNWPNKEDITSNTLVVIVTVVALISFIGVIDFALANIITPLIS 67 >gi|312880653|ref|ZP_07740453.1| preprotein translocase, SecE subunit [Aminomonas paucivorans DSM 12260] gi|310783944|gb|EFQ24342.1| preprotein translocase, SecE subunit [Aminomonas paucivorans DSM 12260] Length = 61 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 31/57 (54%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V +F ++ R E KK+ WP++ +V S +VV+ + S + ++D + + I+ Sbjct: 4 NVSSFLREARAELKKVAWPTKQQVWYSTLVVLFVTFAVSAYLGLVDVVLTGIFSKII 60 >gi|238927917|ref|ZP_04659677.1| hypothetical protein HMPREF0908_1817 [Selenomonas flueggei ATCC 43531] gi|238884250|gb|EEQ47888.1| hypothetical protein HMPREF0908_1817 [Selenomonas flueggei ATCC 43531] Length = 61 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 25/57 (43%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ F ++V E KK+ W +R E+ VV I + + + D + IL Sbjct: 3 KIVKFLREVVAEMKKVSWSTRRELATYTGVVGIAIIVVCALIWICDTIFARIFQVIL 59 >gi|33864350|ref|NP_895910.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. MIT 9313] gi|33641130|emb|CAE22260.1| putative preprotein translocase, SecE subunit [Prochlorococcus marinus str. MIT 9313] Length = 90 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 25/53 (47%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F +E + WPSR ++ I VI+M+S+S+ F + + W I Sbjct: 37 FLAATYEELSLVVWPSRQQLFSESIAVILMVSLSAAFIAAVSRFYSWASSQIF 89 >gi|237736025|ref|ZP_04566506.1| predicted protein [Fusobacterium mortiferum ATCC 9817] gi|229421839|gb|EEO36886.1| predicted protein [Fusobacterium mortiferum ATCC 9817] Length = 81 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 +N F+ ++ E K+ WP++ EV S + VI M I S++ V D L+ ++ + Sbjct: 22 MNLFQGIKTEYSKVQWPNKEEVKNSTLWVIAMSLILSIYLGVFDLIASRLLKILVSL 78 >gi|315639709|ref|ZP_07894848.1| preprotein translocase subunit SecE [Enterococcus italicus DSM 15952] gi|315484486|gb|EFU74943.1| preprotein translocase subunit SecE [Enterococcus italicus DSM 15952] Length = 56 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 31/56 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F + VR+E KK+ WPS ++ +VVI I +V F ++D I L +IL Sbjct: 1 MKFIRSVREEMKKVTWPSGKQLRKDTLVVIETSLIFAVLFFLMDTGIQQLFAWILK 56 >gi|229815831|ref|ZP_04446155.1| hypothetical protein COLINT_02879 [Collinsella intestinalis DSM 13280] gi|229808526|gb|EEP44304.1| hypothetical protein COLINT_02879 [Collinsella intestinalis DSM 13280] Length = 84 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 27/55 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + VR E K++ WP+++E++ + V L + V ++D IG + + Sbjct: 28 YLASVRSEMKRVVWPTKNELVNYTVAVCASLFVVGVAIALLDLVIGQGLVLFASL 82 >gi|148653839|ref|YP_001280932.1| preprotein translocase subunit SecE [Psychrobacter sp. PRwf-1] gi|148572923|gb|ABQ94982.1| protein translocase subunit secE/sec61 gamma [Psychrobacter sp. PRwf-1] Length = 157 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 27/53 (50%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K E +++ WPS++E + ++++ I +V ++D WL+ +G Sbjct: 105 LKDASIELRRVTWPSKNETIQYTWQSLLVIGIVAVIVWLLDNLFNWLVGIFIG 157 >gi|284034042|ref|YP_003383973.1| preprotein translocase subunit SecE [Kribbella flavida DSM 17836] gi|283813335|gb|ADB35174.1| preprotein translocase, SecE subunit [Kribbella flavida DSM 17836] Length = 80 Score = 43.3 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 32/57 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +L F++QV E +K+ WP+R ++ +VV+ + F V+D + GW M I G Sbjct: 24 LLRFYRQVVAELRKVVWPTRKQLSTYFVVVLTFVVFVIAFVSVLDLAFGWAMFKIFG 80 >gi|237749503|ref|ZP_04579983.1| preprotein translocase subunit SecE [Oxalobacter formigenes OXCC13] gi|229380865|gb|EEO30956.1| preprotein translocase subunit SecE [Oxalobacter formigenes OXCC13] Length = 122 Score = 43.3 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM-HFILG 64 + F K+ E++K+ WP R++ + +V + + ++F D+ + +++ +FILG Sbjct: 63 IAFAKESYRETRKVVWPPRNDAIRLTGIVFGFVLMIAIFLWGTDKVLEFVLYNFILG 119 >gi|218296036|ref|ZP_03496805.1| preprotein translocase, SecE subunit [Thermus aquaticus Y51MC23] gi|218243413|gb|EED09942.1| preprotein translocase, SecE subunit [Thermus aquaticus Y51MC23] Length = 60 Score = 43.3 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 29/55 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +L +F++ R E ++ WP+R +V+ ++I ++ V + D +L+ + Sbjct: 5 ILRYFQEARAELARVTWPTREQVVEGTQAILIFTLVAMVILGLYDLVFRFLIGLL 59 >gi|257880336|ref|ZP_05659989.1| preprotein translocase [Enterococcus faecium 1,230,933] gi|257882190|ref|ZP_05661843.1| preprotein translocase [Enterococcus faecium 1,231,502] gi|257885383|ref|ZP_05665036.1| preprotein translocase [Enterococcus faecium 1,231,501] gi|257890995|ref|ZP_05670648.1| preprotein translocase [Enterococcus faecium 1,231,410] gi|257894249|ref|ZP_05673902.1| preprotein translocase [Enterococcus faecium 1,231,408] gi|258614713|ref|ZP_05712483.1| preprotein translocase, SecE subunit [Enterococcus faecium DO] gi|260562360|ref|ZP_05832874.1| preprotein translocase [Enterococcus faecium C68] gi|261209265|ref|ZP_05923657.1| preprotein translocase [Enterococcus faecium TC 6] gi|289566014|ref|ZP_06446452.1| preprotein translocase, SecE subunit [Enterococcus faecium D344SRF] gi|293557115|ref|ZP_06675670.1| preprotein translocase, SecE subunit [Enterococcus faecium E1039] gi|293559847|ref|ZP_06676361.1| preprotein translocase, SecE subunit [Enterococcus faecium E1162] gi|293568367|ref|ZP_06679688.1| preprotein translocase, SecE subunit [Enterococcus faecium E1071] gi|294616182|ref|ZP_06695979.1| preprotein translocase, SecE subunit [Enterococcus faecium E1636] gi|294618924|ref|ZP_06698431.1| preprotein translocase, SecE subunit [Enterococcus faecium E1679] gi|294623150|ref|ZP_06702036.1| preprotein translocase, SecE subunit [Enterococcus faecium U0317] gi|314937978|ref|ZP_07845289.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133a04] gi|314941597|ref|ZP_07848481.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133C] gi|314948418|ref|ZP_07851806.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0082] gi|314951394|ref|ZP_07854446.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133A] gi|314991323|ref|ZP_07856802.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133B] gi|314995339|ref|ZP_07860445.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133a01] gi|257814564|gb|EEV43322.1| preprotein translocase [Enterococcus faecium 1,230,933] gi|257817848|gb|EEV45176.1| preprotein translocase [Enterococcus faecium 1,231,502] gi|257821239|gb|EEV48369.1| preprotein translocase [Enterococcus faecium 1,231,501] gi|257827355|gb|EEV53981.1| preprotein translocase [Enterococcus faecium 1,231,410] gi|257830628|gb|EEV57235.1| preprotein translocase [Enterococcus faecium 1,231,408] gi|260073284|gb|EEW61625.1| preprotein translocase [Enterococcus faecium C68] gi|260076811|gb|EEW64546.1| preprotein translocase [Enterococcus faecium TC 6] gi|289162212|gb|EFD10074.1| preprotein translocase, SecE subunit [Enterococcus faecium D344SRF] gi|291588888|gb|EFF20715.1| preprotein translocase, SecE subunit [Enterococcus faecium E1071] gi|291590937|gb|EFF22649.1| preprotein translocase, SecE subunit [Enterococcus faecium E1636] gi|291594840|gb|EFF26210.1| preprotein translocase, SecE subunit [Enterococcus faecium E1679] gi|291597519|gb|EFF28684.1| preprotein translocase, SecE subunit [Enterococcus faecium U0317] gi|291600736|gb|EFF31033.1| preprotein translocase, SecE subunit [Enterococcus faecium E1039] gi|291606183|gb|EFF35603.1| preprotein translocase, SecE subunit [Enterococcus faecium E1162] gi|313590432|gb|EFR69277.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133a01] gi|313594096|gb|EFR72941.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133B] gi|313596452|gb|EFR75297.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133A] gi|313599617|gb|EFR78460.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133C] gi|313642653|gb|EFS07233.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0133a04] gi|313645143|gb|EFS09723.1| preprotein translocase, SecE subunit [Enterococcus faecium TX0082] Length = 56 Score = 43.3 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F K V+DE K++ WPSR ++ +VVI I + F V+D +I L +IL Sbjct: 1 MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK 56 >gi|289209342|ref|YP_003461408.1| preprotein translocase, SecE subunit [Thioalkalivibrio sp. K90mix] gi|288944973|gb|ADC72672.1| preprotein translocase, SecE subunit [Thioalkalivibrio sp. K90mix] Length = 121 Score = 43.3 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 31/62 (50%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F R E +K+ WP+R E + ++VI ++ I +F ++D +GW + Sbjct: 60 AKGHQLAAFMGNARTEVRKMVWPTRVETTQTTLIVIAVVIIIGIFLWLLDMFLGWSISRF 119 Query: 63 LG 64 +G Sbjct: 120 IG 121 >gi|54027091|ref|YP_121333.1| preprotein translocase subunit SecE [Nocardia farcinica IFM 10152] gi|54018599|dbj|BAD59969.1| putative preprotein translocase [Nocardia farcinica IFM 10152] Length = 133 Score = 43.3 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 31/57 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ F ++V E +K+ WP+R +++ VV++ + F +D + ++++ G Sbjct: 77 LIKFLREVIAELRKVIWPNRKQMVTYTSVVLVFVVFMVAFISGLDLAFIKGVNWLFG 133 >gi|302036652|ref|YP_003796974.1| preprotein translocase subunit SecE [Candidatus Nitrospira defluvii] gi|300604716|emb|CBK41048.1| Preprotein translocase, subunit SecE [Candidatus Nitrospira defluvii] Length = 64 Score = 43.3 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 35/57 (61%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ F VR E KK+ +PS++E + + VVI+ + S++ ++D +GWLM ++ Sbjct: 8 SIREFIDGVRGELKKVSFPSKAETIGATTVVIVFCILMSLYLSMMDSVLGWLMRKVI 64 >gi|295698614|ref|YP_003603269.1| preprotein translocase SecE subunit [Candidatus Riesia pediculicola USDA] gi|291157358|gb|ADD79803.1| preprotein translocase SecE subunit [Candidatus Riesia pediculicola USDA] Length = 129 Score = 43.3 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 34/64 (53%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 R + F + V E +KI WPS E L + ++++++ SS F +ID+ + + + Sbjct: 64 KKRRKKLFEFLEDVFLEMRKINWPSLQETLQTTFIILMIVIFSSFAFWMIDKILVYTISS 123 Query: 62 ILGI 65 I+ + Sbjct: 124 IITL 127 >gi|257462551|ref|ZP_05626962.1| protein translocase subunit SecE [Fusobacterium sp. D12] gi|317060204|ref|ZP_07924689.1| predicted protein [Fusobacterium sp. D12] gi|313685880|gb|EFS22715.1| predicted protein [Fusobacterium sp. D12] Length = 60 Score = 43.3 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 30/54 (55%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F+ VR E K+ WP + E++ S + V++M I S++ V D L+ ++ + Sbjct: 4 FQDVRKEYSKVQWPKKKEIISSTVWVVVMAVILSIYLGVFDLIATRLLKNLVSL 57 >gi|309812260|ref|ZP_07706015.1| preprotein translocase, SecE subunit [Dermacoccus sp. Ellin185] gi|308433565|gb|EFP57442.1| preprotein translocase, SecE subunit [Dermacoccus sp. Ellin185] Length = 83 Score = 43.3 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +L F +QV E +K+ +P+R E+ I V++ L++ + +D + ++ G Sbjct: 25 ILLFIRQVIGEMRKVVYPTRDELTTYTIAVLVFLAVIMAYVNGLDWLFTRAVSWVFG 81 >gi|221141028|ref|ZP_03565521.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus str. JKD6009] Length = 63 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK V+ E +K WP++ E+ ++V+ + VFF +D I L + + Sbjct: 10 FFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLF 62 >gi|297159566|gb|ADI09278.1| preprotein translocase subunit SecE [Streptomyces bingchenggensis BCW-1] Length = 77 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R ++ VVI+ + I VID + ++ G Sbjct: 24 FYRQIVAELRKVVWPTRGQLSTYTTVVIVFVLIMIGIVTVIDYGFNQAIKYVFG 77 >gi|294101323|ref|YP_003553181.1| preprotein translocase, SecE subunit [Aminobacterium colombiense DSM 12261] gi|293616303|gb|ADE56457.1| preprotein translocase, SecE subunit [Aminobacterium colombiense DSM 12261] Length = 60 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 31/58 (53%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +L+F ++ + E KK+ WP + +V S +VVI + + ++D ++ + I+ Sbjct: 3 KILSFVREAKAELKKVTWPGKKQVWYSTLVVIAFTLFVAAYLGIVDLALTGIFTKIIS 60 >gi|284992893|ref|YP_003411447.1| preprotein translocase subunit SecE [Geodermatophilus obscurus DSM 43160] gi|284066138|gb|ADB77076.1| preprotein translocase, SecE subunit [Geodermatophilus obscurus DSM 43160] Length = 210 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 27/61 (44%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R + F ++V E +K+ WP R E++ VVI+ ++ +D + + Sbjct: 150 QRRNLRRFLREVVAELRKVIWPGRRELITYTTVVIVFVAFIVALVAGLDLLFAQGVLAVF 209 Query: 64 G 64 G Sbjct: 210 G 210 >gi|310777977|ref|YP_003966310.1| protein translocase subunit secE/sec61 gamma [Ilyobacter polytropus DSM 2926] gi|309747300|gb|ADO81962.1| protein translocase subunit secE/sec61 gamma [Ilyobacter polytropus DSM 2926] Length = 60 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 29/56 (51%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F ++++ E K+ WP++ EV + I+V M SV+ V D L+ ++ Sbjct: 1 MKFIEEIKMEYAKVTWPNKEEVKHATIIVAAMSVALSVYLGVFDLIASRLLDMLVS 56 >gi|227552593|ref|ZP_03982642.1| preprotein translocase, SecE subunit [Enterococcus faecium TX1330] gi|257888178|ref|ZP_05667831.1| preprotein translocase [Enterococcus faecium 1,141,733] gi|257896931|ref|ZP_05676584.1| preprotein translocase [Enterococcus faecium Com12] gi|257899608|ref|ZP_05679261.1| preprotein translocase [Enterococcus faecium Com15] gi|293379126|ref|ZP_06625277.1| preprotein translocase, SecE subunit [Enterococcus faecium PC4.1] gi|293571553|ref|ZP_06682575.1| preprotein translocase, SecE subunit [Enterococcus faecium E980] gi|227178219|gb|EEI59191.1| preprotein translocase, SecE subunit [Enterococcus faecium TX1330] gi|257824232|gb|EEV51164.1| preprotein translocase [Enterococcus faecium 1,141,733] gi|257833496|gb|EEV59917.1| preprotein translocase [Enterococcus faecium Com12] gi|257837520|gb|EEV62594.1| preprotein translocase [Enterococcus faecium Com15] gi|291608359|gb|EFF37659.1| preprotein translocase, SecE subunit [Enterococcus faecium E980] gi|292642267|gb|EFF60426.1| preprotein translocase, SecE subunit [Enterococcus faecium PC4.1] Length = 56 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F K V+DE K++ WP+R ++ +VVI + + F V+D +I L +IL Sbjct: 1 MKFLKSVKDEIKQVTWPNRKQLRKDTLVVIETSILFGLMFYVMDTAIQSLFGWILK 56 >gi|148284112|ref|YP_001248202.1| preprotein translocase subunit SecE [Orientia tsutsugamushi str. Boryong] gi|146739551|emb|CAM79280.1| preprotein translocase subunit [Orientia tsutsugamushi str. Boryong] Length = 69 Score = 42.9 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 20/67 (29%), Positives = 41/67 (61%), Gaps = 2/67 (2%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + V R+ + F KQV+ E+ ++ W EV +SV+VV++ + + S+ +++D I ++ Sbjct: 5 LKVKRM--IEFCKQVKSEAMRVVWVDIREVWMSVLVVLVAVGLFSILCVMLDYGIYNIVQ 62 Query: 61 FILGIGR 67 +L IG+ Sbjct: 63 LLLNIGK 69 >gi|116514974|ref|YP_802603.1| hypothetical protein BCc_025 [Buchnera aphidicola str. Cc (Cinara cedri)] gi|116256828|gb|ABJ90510.1| preprotein translocase IISP family, membrane subunit [Buchnera aphidicola str. Cc (Cinara cedri)] Length = 128 Score = 42.9 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 30/56 (53%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L F ++ E I WP+ E L +++++ ++S+F ++D I ++ ++L Sbjct: 69 TLKFIHSIKIELSHIIWPNYKETLKITGIILLLTILTSIFLWLLDGIILRIISWVL 124 >gi|22087315|gb|AAM90926.1|AF502176_2 preprotein translocase SecE subunit [Rickettsia typhi] Length = 37 Score = 42.9 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 14/35 (40%), Positives = 24/35 (68%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVI 38 + FF+QV+ E+ K+FWP+R E++ S +VV+ Sbjct: 3 REYKIYKFFEQVKQETYKVFWPNRKELIASTLVVV 37 >gi|325972674|ref|YP_004248865.1| preprotein translocase, SecE subunit [Spirochaeta sp. Buddy] gi|324027912|gb|ADY14671.1| preprotein translocase, SecE subunit [Spirochaeta sp. Buddy] Length = 59 Score = 42.9 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 31/55 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +FK+ E KK+ WPSR V+ S VV++ I +VF ++D + + F+L Sbjct: 5 FKYFKESHQELKKVVWPSREAVISSTKVVLVSTVIVAVFLGLVDFLLLKGVLFVL 59 >gi|57651411|ref|YP_185467.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus COL] gi|87161634|ref|YP_493223.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus USA300_FPR3757] gi|151220709|ref|YP_001331531.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus str. Newman] gi|161508775|ref|YP_001574434.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus USA300_TCH1516] gi|258452732|ref|ZP_05700730.1| preprotein translocase, SecE subunit [Staphylococcus aureus A5948] gi|262049577|ref|ZP_06022446.1| preprotein translocase subunit [Staphylococcus aureus D30] gi|262052422|ref|ZP_06024622.1| preprotein translocase subunit [Staphylococcus aureus 930918-3] gi|282924449|ref|ZP_06332121.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9765] gi|294850311|ref|ZP_06791045.1| preprotein translocase [Staphylococcus aureus A9754] gi|304381866|ref|ZP_07364513.1| preprotein translocase [Staphylococcus aureus subsp. aureus ATCC BAA-39] gi|81695158|sp|Q5HIE0|SECE_STAAC RecName: Full=Preprotein translocase subunit secE gi|13183702|gb|AAK15309.1|AF327733_6 SecE [Staphylococcus aureus subsp. aureus str. Newman] gi|57285597|gb|AAW37691.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus COL] gi|87127608|gb|ABD22122.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus USA300_FPR3757] gi|150373509|dbj|BAF66769.1| membrane translocase subunit SecE [Staphylococcus aureus subsp. aureus str. Newman] gi|160367584|gb|ABX28555.1| possible Sec family Type I general secretory pathway preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus USA300_TCH1516] gi|257859605|gb|EEV82455.1| preprotein translocase, SecE subunit [Staphylococcus aureus A5948] gi|259159668|gb|EEW44712.1| preprotein translocase subunit [Staphylococcus aureus 930918-3] gi|259162317|gb|EEW46890.1| preprotein translocase subunit [Staphylococcus aureus D30] gi|269940108|emb|CBI48484.1| preprotein translocase SecE subunit [Staphylococcus aureus subsp. aureus TW20] gi|282592860|gb|EFB97864.1| preprotein translocase, SecE subunit [Staphylococcus aureus A9765] gi|294822823|gb|EFG39258.1| preprotein translocase [Staphylococcus aureus A9754] gi|302750426|gb|ADL64603.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus str. JKD6008] gi|304339652|gb|EFM05599.1| preprotein translocase [Staphylococcus aureus subsp. aureus ATCC BAA-39] gi|315196653|gb|EFU27000.1| preprotein translocase subunit SecE [Staphylococcus aureus subsp. aureus CGS01] gi|320141600|gb|EFW33439.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus MRSA131] gi|320141771|gb|EFW33599.1| preprotein translocase, SecE subunit [Staphylococcus aureus subsp. aureus MRSA177] gi|329313255|gb|AEB87668.1| Preprotein translocase subunit secE [Staphylococcus aureus subsp. aureus T0131] Length = 60 Score = 42.9 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK V+ E +K WP++ E+ ++V+ + VFF +D I L + + Sbjct: 7 FFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLF 59 >gi|309792763|ref|ZP_07687208.1| preprotein translocase, SecE subunit [Oscillochloris trichoides DG6] gi|308225215|gb|EFO78998.1| preprotein translocase, SecE subunit [Oscillochloris trichoides DG6] Length = 75 Score = 42.9 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 27/65 (41%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + AV ++ R E +K+ WP R E +VVI + + + D +L Sbjct: 9 LEQQENAVGRIVRETRSELRKVVWPDREETTRLTVVVIAISVTIGLILFIGDSIFLFLYT 68 Query: 61 FILGI 65 ++ + Sbjct: 69 QLVSL 73 >gi|168830298|gb|ACA34395.1| SecE [uncultured bacterium pTW2] Length = 127 Score = 42.9 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 27/62 (43%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F + R E +K+ WP+R E S VVI ++ + S+ D + + + Sbjct: 65 HKGVQTREFLSEARFELRKVVWPTRQEATRSTWVVIAVVILISLVLAFFDVIVQTAVKWF 124 Query: 63 LG 64 L Sbjct: 125 LA 126 >gi|117927502|ref|YP_872053.1| preprotein translocase subunit SecE [Acidothermus cellulolyticus 11B] gi|117647965|gb|ABK52067.1| preprotein translocase, SecE subunit [Acidothermus cellulolyticus 11B] Length = 87 Score = 42.9 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 26/53 (49%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++Q+ E +K+ WP+R E++ IV ++ + +D W + I G Sbjct: 35 YRQIVAEMRKVIWPTRRELVTYTIVTVVFAVVMIAIVAGLDYGANWAVLKIFG 87 >gi|301059229|ref|ZP_07200166.1| preprotein translocase, SecE subunit [delta proteobacterium NaphS2] gi|300446664|gb|EFK10492.1| preprotein translocase, SecE subunit [delta proteobacterium NaphS2] Length = 125 Score = 42.9 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 34/54 (62%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F +Q + E KK+ WP+R E++ S +VVI++ + S + +ID + ++ ++G Sbjct: 72 FLRQAKVELKKVKWPTRKELIASTVVVIVLTILVSFYLGLIDLGLIKIIKHVIG 125 >gi|228470311|ref|ZP_04055215.1| preprotein translocase, SecE subunit [Porphyromonas uenonis 60-3] gi|228308054|gb|EEK16929.1| preprotein translocase, SecE subunit [Porphyromonas uenonis 60-3] Length = 66 Score = 42.9 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 27/48 (56%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 K+ WP+RSE++ S +VV+I I ++F +D LM + G+ Sbjct: 19 VHKVSWPTRSELINSTVVVMIASVIIAIFVAGVDFVFQQLMQLVYGLA 66 >gi|153869596|ref|ZP_01999149.1| Preprotein translocase secE subunit [Beggiatoa sp. PS] gi|152073937|gb|EDN70850.1| Preprotein translocase secE subunit [Beggiatoa sp. PS] Length = 126 Score = 42.5 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 34/63 (53%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A ++F ++ E +++ WP+R E + VV++M+ + ++ +D + WL+ + Sbjct: 63 KGKATISFLRESHLEVRRVVWPTRQETIQMTGVVLLMVVLVALIIWSLDSFLLWLVRLLT 122 Query: 64 GIG 66 G G Sbjct: 123 GQG 125 >gi|289548404|ref|YP_003473392.1| preprotein translocase, SecE subunit [Thermocrinis albus DSM 14484] gi|289182021|gb|ADC89265.1| preprotein translocase, SecE subunit [Thermocrinis albus DSM 14484] Length = 64 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 32/55 (58%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K V+ E K+ WP++ V+ + + VII ++ ++ V+D + L+ F+L + Sbjct: 7 FLKGVKQELGKVSWPTKDLVVRATVGVIIFSLLTGLYLWVVDLAFTRLISFLLAL 61 >gi|302869989|ref|YP_003838626.1| preprotein translocase subunit SecE [Micromonospora aurantiaca ATCC 27029] gi|315501450|ref|YP_004080337.1| preprotein translocase, sece subunit [Micromonospora sp. L5] gi|302572848|gb|ADL49050.1| preprotein translocase, SecE subunit [Micromonospora aurantiaca ATCC 27029] gi|315408069|gb|ADU06186.1| preprotein translocase, SecE subunit [Micromonospora sp. L5] Length = 130 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FF++V E +K+ WP+R E+L VV+ +++ +D + ++ G Sbjct: 71 IARFFREVVAELRKVIWPTRKELLTYTAVVVTFVAVMLAIVAGLDYGFAKAVLWVFG 127 >gi|147676639|ref|YP_001210854.1| preprotein translocase subunit SecE [Pelotomaculum thermopropionicum SI] gi|146272736|dbj|BAF58485.1| hypothetical membrane protein [Pelotomaculum thermopropionicum SI] Length = 131 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF+ E KK+ WP+R E ++ VV++ + + V V D + ++ I+ Sbjct: 76 KFFRGSLSELKKVHWPNRRETIIYTSVVMVAVVVVGVLIWVFDSVLSTILKLIM 129 >gi|296120708|ref|YP_003628486.1| preprotein translocase, SecE subunit [Planctomyces limnophilus DSM 3776] gi|296013048|gb|ADG66287.1| preprotein translocase, SecE subunit [Planctomyces limnophilus DSM 3776] Length = 160 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 25/54 (46%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +F +V E ++ WP R E++ + VV+ + S+ D W++ I Sbjct: 100 ADFLIEVESEMSRVTWPERPELMKATGVVLFVTISLSLVLFGFDLFWQWVLGLI 153 >gi|238922784|ref|YP_002936297.1| hypothetical protein EUBREC_0372 [Eubacterium rectale ATCC 33656] gi|238874456|gb|ACR74163.1| Hypothetical protein EUBREC_0372 [Eubacterium rectale ATCC 33656] gi|291523704|emb|CBK89291.1| protein translocase subunit secE/sec61 gamma [Eubacterium rectale DSM 17629] gi|291528834|emb|CBK94420.1| protein translocase subunit secE/sec61 gamma [Eubacterium rectale M104/1] Length = 71 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 33/64 (51%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 V + ++F ++ E +KI WP + V+ I V+ + ++ + ++D I + F Sbjct: 6 KVEKAPKTSWFSGLKAEFQKIIWPEKQSVIRQTIAVLAVSVVTGLIIALLDWGIQQGVDF 65 Query: 62 ILGI 65 ++G+ Sbjct: 66 LIGL 69 >gi|78170019|gb|ABB27116.1| protein translocase subunit secE/sec61 gamma [Synechococcus sp. CC9902] Length = 79 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 25/61 (40%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F E K + WPSR ++ I VI+M+S+S+ + + GW + Sbjct: 18 AESTRPGGFLADTVQELKLVVWPSRQQLFSESIAVILMVSLSAATIAAVSRFFGWASSQV 77 Query: 63 L 63 Sbjct: 78 F 78 >gi|154684618|ref|YP_001419779.1| preprotein translocase subunit SecE [Bacillus amyloliquefaciens FZB42] gi|308171991|ref|YP_003918696.1| preprotein translocase subunit [Bacillus amyloliquefaciens DSM 7] gi|311070747|ref|YP_003975670.1| preprotein translocase subunit SecE [Bacillus atrophaeus 1942] gi|154350469|gb|ABS72548.1| SecE [Bacillus amyloliquefaciens FZB42] gi|307604855|emb|CBI41226.1| preprotein translocase subunit [Bacillus amyloliquefaciens DSM 7] gi|310871264|gb|ADP34739.1| preprotein translocase subunit SecE [Bacillus atrophaeus 1942] gi|328551801|gb|AEB22293.1| preprotein translocase subunit SecE [Bacillus amyloliquefaciens TA208] gi|328910062|gb|AEB61658.1| preprotein translocase subunit SecE [Bacillus amyloliquefaciens LL3] Length = 59 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 31/58 (53%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + +++FFK V E KK+ WP E+ I VI + +FF ++D I L+ I+ Sbjct: 1 MRMMSFFKDVGKEMKKVSWPKGKELTRYTITVISTVIFFVIFFALLDTGISQLIRLIV 58 >gi|282860791|ref|ZP_06269857.1| preprotein translocase, SecE subunit [Streptomyces sp. ACTE] gi|282564527|gb|EFB70063.1| preprotein translocase, SecE subunit [Streptomyces sp. ACTE] Length = 94 Score = 42.5 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+RS++ VVI + + VID ++ ++ G Sbjct: 41 FYRQIVAELRKVVWPTRSQLTTYTTVVIAFVVVMIGLVTVIDFGFARVIKYVFG 94 >gi|282857084|ref|ZP_06266330.1| preprotein translocase, SecE subunit [Pyramidobacter piscolens W5455] gi|282585019|gb|EFB90341.1| preprotein translocase, SecE subunit [Pyramidobacter piscolens W5455] Length = 60 Score = 42.5 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 28/53 (52%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ R E KI WP + +V S +VVI + + + + ++D + + ILG Sbjct: 8 LREARAELNKITWPGKQQVWYSTLVVIFVTLLVATYLGIVDLILTGVFSKILG 60 >gi|237747353|ref|ZP_04577833.1| preprotein translocase subunit SecE [Oxalobacter formigenes HOxBLS] gi|229378704|gb|EEO28795.1| preprotein translocase subunit SecE [Oxalobacter formigenes HOxBLS] Length = 127 Score = 42.5 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 30/53 (56%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F ++ E+KK+ WP+R++ + +V + + + F D+ + ++++ I+ Sbjct: 70 FARESVRETKKVVWPARNDAIRLTGIVFGFVLLMAAFLWGADKVLEFVLYNII 122 >gi|238061138|ref|ZP_04605847.1| preprotein translocase subunit secE [Micromonospora sp. ATCC 39149] gi|237882949|gb|EEP71777.1| preprotein translocase subunit secE [Micromonospora sp. ATCC 39149] Length = 131 Score = 42.5 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FF++V E +K+ WP+R E+L VV+ +++ +D + + ++ G Sbjct: 72 IARFFREVVAELRKVIWPTRKELLTYTAVVVTFVAVMLTIVAGLDFAFAKGVLWVFG 128 >gi|91790281|ref|YP_551233.1| preprotein translocase subunit SecE [Polaromonas sp. JS666] gi|91699506|gb|ABE46335.1| protein translocase subunit secE/sec61 gamma [Polaromonas sp. JS666] Length = 127 Score = 42.5 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 12/50 (24%), Positives = 26/50 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 + F + E KK+ WP+R E + V + + ++F + D+++ W+ Sbjct: 68 VAFGRDSWREVKKVVWPARKEAIQMTAYVFGFVVVMALFLWLTDKTLEWV 117 >gi|319787938|ref|YP_004147413.1| preprotein translocase subunit SecE [Pseudoxanthomonas suwonensis 11-1] gi|317466450|gb|ADV28182.1| preprotein translocase, SecE subunit [Pseudoxanthomonas suwonensis 11-1] Length = 137 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 28/67 (41%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + F + R E +K+ WP+R E VV+ ++ + S+ D + W + Sbjct: 71 LSAKGRDFREFLSESRFELRKVVWPTRQEATRMTWVVVAVVVVLSLILAGFDFFVKWAIE 130 Query: 61 FILGIGR 67 L GR Sbjct: 131 LFLNFGR 137 >gi|189184707|ref|YP_001938492.1| preprotein translocase subunit SecE [Orientia tsutsugamushi str. Ikeda] gi|189181478|dbj|BAG41258.1| preprotein translocase SecE subunit [Orientia tsutsugamushi str. Ikeda] Length = 66 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 20/67 (29%), Positives = 41/67 (61%), Gaps = 2/67 (2%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + V R+ + F KQV+ E+ ++ W EV +SV+VV++ + + S+ +++D I ++ Sbjct: 2 LKVKRM--IEFCKQVKSEAMRVVWVDIREVWMSVLVVLVAVGLFSILCVILDYGIYNVVQ 59 Query: 61 FILGIGR 67 +L IG+ Sbjct: 60 LLLNIGK 66 >gi|227487149|ref|ZP_03917465.1| preprotein translocase subunit SecE [Corynebacterium glucuronolyticum ATCC 51867] gi|227092807|gb|EEI28119.1| preprotein translocase subunit SecE [Corynebacterium glucuronolyticum ATCC 51867] Length = 102 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 29/57 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ +V ++ KK+ WP+ ++L ++V + L + ++ D + ++L Sbjct: 44 GIKSYIPEVIEQMKKVIWPTGKQMLNYTLIVFLFLIVMTIVVWGTDILTAKGVQWLL 100 >gi|282882513|ref|ZP_06291134.1| preprotein translocase, SecE subunit [Peptoniphilus lacrimalis 315-B] gi|300814670|ref|ZP_07094921.1| preprotein translocase, SecE subunit [Peptoniphilus sp. oral taxon 836 str. F0141] gi|281297655|gb|EFA90130.1| preprotein translocase, SecE subunit [Peptoniphilus lacrimalis 315-B] gi|300511289|gb|EFK38538.1| preprotein translocase, SecE subunit [Peptoniphilus sp. oral taxon 836 str. F0141] Length = 71 Score = 42.5 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 33/59 (55%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + + +F+ V+ E KK+ WPS+ +++ ++VI + ++ + D+ I +L+ I Sbjct: 12 KKGGLGKYFRGVKSEFKKVVWPSKKQIVQYSLIVIGVSIACALLLSLYDRFIVFLLKPI 70 >gi|258513626|ref|YP_003189848.1| preprotein translocase subunit SecE [Desulfotomaculum acetoxidans DSM 771] gi|257777331|gb|ACV61225.1| preprotein translocase, SecE subunit [Desulfotomaculum acetoxidans DSM 771] Length = 123 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 34/57 (59%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ FFK V +E KK+ WP+R E+ + +VV++ + +V V D ++ L+ IL Sbjct: 65 SLQKFFKGVYNELKKVHWPNRREIAIYTLVVLVSVVFVAVLIWVFDSALSQLLKLIL 121 >gi|227541684|ref|ZP_03971733.1| preprotein translocase subunit SecE [Corynebacterium glucuronolyticum ATCC 51866] gi|227182499|gb|EEI63471.1| preprotein translocase subunit SecE [Corynebacterium glucuronolyticum ATCC 51866] Length = 108 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 29/57 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ +V ++ KK+ WP+ ++L ++V + L + ++ D + ++L Sbjct: 50 GIKSYIPEVIEQMKKVIWPTGKQMLNYTLIVFLFLIVMTIVVWGTDILTAKGVQWLL 106 >gi|157412564|ref|YP_001483430.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. MIT 9215] gi|157387139|gb|ABV49844.1| putative preprotein translocase, SecE subunit [Prochlorococcus marinus str. MIT 9215] Length = 80 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF+ DE K + WP++ ++ + VIIM++ S+ + + GW I G Sbjct: 26 NFFRSTYDELKLVVWPNKQQLFSESVAVIIMVTFSAAAIASVSRFYGWAASQIFG 80 >gi|118579106|ref|YP_900356.1| preprotein translocase subunit SecE [Pelobacter propionicus DSM 2379] gi|118501816|gb|ABK98298.1| protein translocase subunit secE/sec61 gamma [Pelobacter propionicus DSM 2379] Length = 60 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 32/54 (59%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F + V+ E K+ WP+R E + + VV++++ + S++ V D + LM ILG Sbjct: 7 FLESVKIELAKVTWPTRKETVATTGVVVVIIVLISLYLGVCDLVLAKLMRLILG 60 >gi|237786434|ref|YP_002907139.1| preprotein translocase subunit SecE [Corynebacterium kroppenstedtii DSM 44385] gi|237759346|gb|ACR18596.1| preprotein translocase subunit [Corynebacterium kroppenstedtii DSM 44385] Length = 107 Score = 42.5 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 29/58 (50%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++++F+ V E +K+ WP+ ++ V VV++ L + +D G + + L Sbjct: 48 TQIVDYFRGVIAEMRKVIWPTWRQMGVYTGVVLLFLIVVIGIVSGVDFLAGKGVEWTL 105 >gi|169634600|ref|YP_001708336.1| preprotein translocase subunit SecE [Acinetobacter baumannii SDF] gi|169153392|emb|CAP02519.1| preprotein translocase IISP family, membrane subunit [Acinetobacter baumannii] Length = 146 Score = 42.5 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + K R E +++ WP++ E + + V++++ ++S+ D +GWL+ I+G Sbjct: 91 VRLLKDARVELRRVTWPTKQETVTTSWQVLLVVVVASLVLWCFDYGLGWLIKLIIG 146 >gi|326203306|ref|ZP_08193171.1| preprotein translocase, SecE subunit [Clostridium papyrosolvens DSM 2782] gi|325986564|gb|EGD47395.1| preprotein translocase, SecE subunit [Clostridium papyrosolvens DSM 2782] Length = 76 Score = 42.1 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 12/63 (19%), Positives = 30/63 (47%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + + ++ +++++ E KK+ WP+R++++ + V+I I V D L Sbjct: 12 LKKSGQGIVKLYREIKAELKKVIWPNRTQLINNTATVLIFCLIVGAIIWVADFGFTKLAE 71 Query: 61 FIL 63 + Sbjct: 72 VVF 74 >gi|332108099|gb|EGJ09323.1| preprotein translocase subunit SecE [Rubrivivax benzoatilyticus JA2] Length = 128 Score = 42.1 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 29/53 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F ++ E KK+ WP+R E + V + ++F + D+++ W+++ ++ Sbjct: 71 FGRESVKEVKKVVWPTRKEAGQMTLYVFAFVVTMALFMFLTDKTLEWVLYDLI 123 >gi|188996252|ref|YP_001930503.1| preprotein translocase, SecE subunit [Sulfurihydrogenibium sp. YO3AOP1] gi|188931319|gb|ACD65949.1| preprotein translocase, SecE subunit [Sulfurihydrogenibium sp. YO3AOP1] Length = 61 Score = 42.1 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 34/55 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 LNF K+V +E KK+ WPS++ V + I VI++ I +++ +D ++ FI+ Sbjct: 5 LNFLKEVFEELKKVTWPSKNLVKTATIAVIVLTLIMALYLWSLDILFTKIIAFIM 59 >gi|302390945|ref|YP_003826765.1| preprotein translocase, SecE subunit [Acetohalobium arabaticum DSM 5501] gi|302203022|gb|ADL11700.1| preprotein translocase, SecE subunit [Acetohalobium arabaticum DSM 5501] Length = 67 Score = 42.1 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 31/57 (54%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF++V+ E KK+ WP++S +L VVI+ + +F +D ++ ++ Sbjct: 9 KIKKFFREVKAELKKVNWPNQSVLLSYTTVVIVTVLAVMLFIGGVDLIFSRIITPLI 65 >gi|257452913|ref|ZP_05618212.1| protein translocase subunit SecE [Fusobacterium sp. 3_1_5R] gi|257466706|ref|ZP_05631017.1| protein translocase subunit SecE [Fusobacterium gonidiaformans ATCC 25563] Length = 60 Score = 42.1 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 30/54 (55%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F+ VR E K+ WP + +++ S + V++M I S++ V D L+ ++ + Sbjct: 4 FQDVRKEYSKVQWPKKKDIISSTVWVVVMAVILSIYLGVFDLIATRLLKNLVSL 57 >gi|312144261|ref|YP_003995707.1| preprotein translocase, SecE subunit [Halanaerobium sp. 'sapolanicus'] gi|311904912|gb|ADQ15353.1| preprotein translocase, SecE subunit [Halanaerobium sp. 'sapolanicus'] Length = 67 Score = 42.1 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 34/57 (59%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F KQVR E KK+ WP++ E+ + +VVI+ + +F ++D ++ ++ ++ Sbjct: 10 KITKFIKQVRGELKKVNWPNKKELTSNTLVVILTIIALIIFIGILDLTLANIITPLI 66 >gi|78213981|ref|YP_382760.1| preprotein translocase subunit SecE [Synechococcus sp. CC9605] gi|78198440|gb|ABB36205.1| SecE subunit of protein translocation complex [Synechococcus sp. CC9605] Length = 96 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 27/62 (43%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + F DE K + WPSR ++ I VI+M+S+S+ + + GW Sbjct: 34 AADSTKSGGFLADTVDELKLVVWPSRQQLFSESIAVILMVSLSAATIAAVSRLFGWASSQ 93 Query: 62 IL 63 + Sbjct: 94 VF 95 >gi|313204186|ref|YP_004042843.1| preprotein translocase, sece subunit [Paludibacter propionicigenes WB4] gi|312443502|gb|ADQ79858.1| preprotein translocase, SecE subunit [Paludibacter propionicigenes WB4] Length = 63 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 6 LAVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + ++N+ K+ E +K+ WPS+SE+ S IVV+I I ++ ++D S +M FI G Sbjct: 1 MKIINYIKESYSELVQKVSWPSKSELTNSAIVVLIASIILALIVWLMDVSFERIMKFIYG 60 Query: 65 I 65 + Sbjct: 61 L 61 >gi|293610084|ref|ZP_06692385.1| preprotein translocase IISP family protein [Acinetobacter sp. SH024] gi|292827316|gb|EFF85680.1| preprotein translocase IISP family protein [Acinetobacter sp. SH024] gi|325124249|gb|ADY83772.1| preprotein translocase subunit SecE [Acinetobacter calcoaceticus PHEA-2] Length = 146 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + K R E +++ WP++ E + + V++++ ++S+ D +GWL+ I+G Sbjct: 91 VRLLKDARVELRRVTWPTKQETVTTSWQVLLVVVVASLVLWCFDYGLGWLIKLIIG 146 >gi|220927764|ref|YP_002504673.1| preprotein translocase, SecE subunit [Clostridium cellulolyticum H10] gi|219998092|gb|ACL74693.1| preprotein translocase, SecE subunit [Clostridium cellulolyticum H10] Length = 76 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 31/63 (49%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + + ++ +K++R E KK+ WP+R++++ + + V+I I V D L Sbjct: 12 LKKSGQGIVRLYKEIRAELKKVIWPNRTQLINNTVTVLIFCLIVGTIIWVADFGFTKLAE 71 Query: 61 FIL 63 + Sbjct: 72 VVF 74 >gi|123967761|ref|YP_001008619.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. AS9601] gi|123197871|gb|ABM69512.1| putative preprotein translocase, SecE subunit [Prochlorococcus marinus str. AS9601] Length = 80 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF+ DE K + WP++ ++ + VIIM+S S+ + + GW I G Sbjct: 26 NFFRSTYDELKLVVWPNKQQLFSESVAVIIMVSFSAAAIASVSRFYGWAASQIFG 80 >gi|302523948|ref|ZP_07276290.1| hypothetical protein SSMG_00330 [Streptomyces sp. AA4] gi|302432843|gb|EFL04659.1| hypothetical protein SSMG_00330 [Streptomyces sp. AA4] Length = 146 Score = 42.1 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 26/55 (47%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F ++V E +K+ WP+R +++ VV++ + +D L+ + G Sbjct: 92 RFIREVWAELRKVIWPNRKQMVTYTAVVLVFVVFMVALVSGLDLGFKELVGLVFG 146 >gi|254526722|ref|ZP_05138774.1| preprotein translocase, SecE subunit [Prochlorococcus marinus str. MIT 9202] gi|221538146|gb|EEE40599.1| preprotein translocase, SecE subunit [Prochlorococcus marinus str. MIT 9202] Length = 80 Score = 42.1 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF+ DE K + WP++ ++ + VIIM++ S+ + + GW I G Sbjct: 26 NFFRSTYDELKLVVWPNKQQLFSESVAVIIMVTFSAAAIASVSRFYGWAASQIFG 80 >gi|121606534|ref|YP_983863.1| preprotein translocase subunit SecE [Polaromonas naphthalenivorans CJ2] gi|120595503|gb|ABM38942.1| protein translocase subunit secE/sec61 gamma [Polaromonas naphthalenivorans CJ2] Length = 127 Score = 42.1 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 26/50 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 L F + E KK+ WP+R E + V + + ++F + D+++ W+ Sbjct: 68 LAFGRDSVREVKKVVWPARREAIQMTAYVFGFVVVMALFLWLTDKTLEWV 117 >gi|312897641|ref|ZP_07757058.1| preprotein translocase, SecE subunit [Megasphaera micronuciformis F0359] gi|310621274|gb|EFQ04817.1| preprotein translocase, SecE subunit [Megasphaera micronuciformis F0359] Length = 78 Score = 42.1 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 25/53 (47%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F + V+ E KK+ WP+R E++ ++VI+ + V D L + Sbjct: 21 RFLQGVKTEMKKVIWPTRKELINYTVMVIVATLVVMAIIAVSDAVFAELFQLL 73 >gi|299771837|ref|YP_003733863.1| preprotein translocase subunit SecE [Acinetobacter sp. DR1] gi|298701925|gb|ADI92490.1| preprotein translocase subunit SecE [Acinetobacter sp. DR1] Length = 146 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + K R E +++ WP++ E + + V++++ ++S+ D +GWL+ I+G Sbjct: 91 VRLLKDARVELRRVTWPTKQETVTTSWQVLLVVVVASLVLWCFDYGLGWLIKLIIG 146 >gi|325982738|ref|YP_004295140.1| preprotein translocase, SecE subunit [Nitrosomonas sp. AL212] gi|325532257|gb|ADZ26978.1| preprotein translocase, SecE subunit [Nitrosomonas sp. AL212] Length = 114 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 31/58 (53%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F K+ +E KK+ WPSR E L + VV + + ++F +ID ++ L+ ++ Sbjct: 54 NFYAFCKESSEEIKKVVWPSRKESLQTSGVVFAFVVVMALFLWLIDAALMSLVKLMMN 111 >gi|162286752|ref|YP_001083353.2| IISP family preprotein translocase membrane subunit [Acinetobacter baumannii ATCC 17978] gi|169797459|ref|YP_001715252.1| preprotein translocase subunit SecE [Acinetobacter baumannii AYE] gi|184156617|ref|YP_001844956.1| preprotein translocase subunit SecE [Acinetobacter baumannii ACICU] gi|213155727|ref|YP_002317772.1| preprotein translocase, SecE subunit [Acinetobacter baumannii AB0057] gi|215484896|ref|YP_002327135.1| preprotein translocase, SecE subunit [Acinetobacter baumannii AB307-0294] gi|239500984|ref|ZP_04660294.1| preprotein translocase subunit SecE [Acinetobacter baumannii AB900] gi|260556351|ref|ZP_05828570.1| preprotein translocase subunit SecE [Acinetobacter baumannii ATCC 19606] gi|294838492|ref|ZP_06783175.1| preprotein translocase subunit SecE [Acinetobacter sp. 6013113] gi|294840900|ref|ZP_06785583.1| preprotein translocase subunit SecE [Acinetobacter sp. 6014059] gi|294859136|ref|ZP_06796905.1| preprotein translocase subunit SecE [Acinetobacter sp. 6013150] gi|301346454|ref|ZP_07227195.1| preprotein translocase subunit SecE [Acinetobacter baumannii AB056] gi|301512020|ref|ZP_07237257.1| preprotein translocase subunit SecE [Acinetobacter baumannii AB058] gi|301597214|ref|ZP_07242222.1| preprotein translocase subunit SecE [Acinetobacter baumannii AB059] gi|169150386|emb|CAM88283.1| preprotein translocase IISP family, membrane subunit [Acinetobacter baumannii AYE] gi|183208211|gb|ACC55609.1| Preprotein translocase subunit SecE [Acinetobacter baumannii ACICU] gi|193076138|gb|ABO10751.2| preprotein translocase IISP family membrane subunit [Acinetobacter baumannii ATCC 17978] gi|213054887|gb|ACJ39789.1| preprotein translocase, SecE subunit [Acinetobacter baumannii AB0057] gi|213987689|gb|ACJ57988.1| preprotein translocase, SecE subunit [Acinetobacter baumannii AB307-0294] gi|260410406|gb|EEX03705.1| preprotein translocase subunit SecE [Acinetobacter baumannii ATCC 19606] gi|322506504|gb|ADX01958.1| secE [Acinetobacter baumannii 1656-2] gi|323516383|gb|ADX90764.1| preprotein translocase subunit SecE [Acinetobacter baumannii TCDC-AB0715] Length = 146 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + K R E +++ WP++ E + + V++++ ++S+ D +GWL+ I+G Sbjct: 91 VRLLKDARVELRRVTWPTKQETVTTSWQVLLVVVVASLVLWCFDYGLGWLIKLIIG 146 >gi|227497152|ref|ZP_03927400.1| preprotein translocase SecE [Actinomyces urogenitalis DSM 15434] gi|226833409|gb|EEH65792.1| preprotein translocase SecE [Actinomyces urogenitalis DSM 15434] Length = 80 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+QV DE +K+ WP+R E+ +VV++ + + ++D ++ ++ Sbjct: 27 FFRQVIDELRKVVWPTRKELWTYFLVVVVFIVAIMAYTGILDFIFDRIVMWVFA 80 >gi|315925317|ref|ZP_07921528.1| preprotein translocase subunit SecE [Pseudoramibacter alactolyticus ATCC 23263] gi|315621218|gb|EFV01188.1| preprotein translocase subunit SecE [Pseudoramibacter alactolyticus ATCC 23263] Length = 171 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ FFK+V E KK+ W + E++ S VV ++ ++ + D G L LG Sbjct: 114 IVLFFKEVVVELKKVNWLTTDELVKSTSVVAGIVVAFTLLTWIADTGFGALAALFLG 170 >gi|116333235|ref|YP_794762.1| preprotein translocase subunit SecE [Lactobacillus brevis ATCC 367] gi|116098582|gb|ABJ63731.1| protein translocase subunit secE/sec61 gamma [Lactobacillus brevis ATCC 367] Length = 58 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 30/57 (52%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + ++ FFK V E K++ WP + V+ + + S+FF V+D + + + F+ Sbjct: 1 MHLIRFFKSVGAEMKQVSWPGVKQTRHDTGTVVGISILFSIFFAVVDWIVQFGLKFL 57 >gi|88812770|ref|ZP_01128016.1| preprotein translocase, SecE subunit [Nitrococcus mobilis Nb-231] gi|88790008|gb|EAR21129.1| preprotein translocase, SecE subunit [Nitrococcus mobilis Nb-231] Length = 125 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 33/59 (55%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 V F + R E +K+ WP++ E L S +VV++++ + VF ++D W + +L G Sbjct: 66 VWAFARDSRQELRKVVWPTKQESLQSTLVVLVVVVLVGVFLWLLDTFFLWAIQLLLHPG 124 >gi|224542349|ref|ZP_03682888.1| hypothetical protein CATMIT_01528 [Catenibacterium mitsuokai DSM 15897] gi|224524731|gb|EEF93836.1| hypothetical protein CATMIT_01528 [Catenibacterium mitsuokai DSM 15897] Length = 100 Score = 42.1 bits (98), Expect = 0.029, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 25/61 (40%), Gaps = 5/61 (8%) Query: 7 AVLNF-----FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 L F K +R E K + W ++ E+ VV+ + V+F D I ++ Sbjct: 37 NPLKFKEWFSLKGIRQEIKNVHWLTKKELARDAFVVLAFTVVLGVYFYGADALIALILKT 96 Query: 62 I 62 + Sbjct: 97 L 97 >gi|313896703|ref|ZP_07830251.1| preprotein translocase, SecE subunit [Selenomonas sp. oral taxon 137 str. F0430] gi|320530077|ref|ZP_08031147.1| preprotein translocase, SecE subunit [Selenomonas artemidis F0399] gi|312974620|gb|EFR40087.1| preprotein translocase, SecE subunit [Selenomonas sp. oral taxon 137 str. F0430] gi|320137510|gb|EFW29422.1| preprotein translocase, SecE subunit [Selenomonas artemidis F0399] Length = 61 Score = 41.7 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 25/57 (43%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ F ++V E KK+ W ++ E+ VV I + I + D + IL Sbjct: 3 KIVKFLREVVAEMKKVSWSTKRELATYTGVVGIAIVIVCALIWICDTIFARVFQVIL 59 >gi|116625379|ref|YP_827535.1| preprotein translocase, SecE subunit [Candidatus Solibacter usitatus Ellin6076] gi|116228541|gb|ABJ87250.1| preprotein translocase, SecE subunit [Candidatus Solibacter usitatus Ellin6076] Length = 72 Score = 41.7 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 31/54 (57%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++F +++ E +++ WP+R +V + VVI + + +F ++D + + +L Sbjct: 14 DYFNELKLEMRRVTWPNRKQVEGTTAVVIFSVFAFAGYFAIVDSVLTKGVKAVL 67 >gi|262280706|ref|ZP_06058489.1| preprotein translocase IISP family membrane subunit [Acinetobacter calcoaceticus RUH2202] gi|262257606|gb|EEY76341.1| preprotein translocase IISP family membrane subunit [Acinetobacter calcoaceticus RUH2202] Length = 146 Score = 41.7 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 31/53 (58%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K R E +++ WP++ E + + V++++ ++S+ D +GWL+ I+G Sbjct: 94 LKDARVELRRVTWPTKQETVTTSWQVLLVVVVASLVLWCFDYGLGWLIKLIIG 146 >gi|313887244|ref|ZP_07820938.1| preprotein translocase, SecE subunit [Porphyromonas asaccharolytica PR426713P-I] gi|312923297|gb|EFR34112.1| preprotein translocase, SecE subunit [Porphyromonas asaccharolytica PR426713P-I] gi|332177001|gb|AEE12691.1| preprotein translocase, SecE subunit [Porphyromonas asaccharolytica DSM 20707] Length = 66 Score = 41.7 bits (97), Expect = 0.029, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 27/47 (57%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 K+ WP+RSE++ S +VV+I I ++F +D LM + G+ Sbjct: 19 VHKVSWPTRSELINSTVVVMIASVIIAIFVAGVDFIFQQLMQLVYGL 65 >gi|330953211|gb|EGH53471.1| preprotein translocase subunit SecE [Pseudomonas syringae Cit 7] Length = 98 Score = 41.7 bits (97), Expect = 0.030, Method: Composition-based stats. Identities = 9/27 (33%), Positives = 17/27 (62%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVII 39 K+ R E +K+ WP+R E + ++V+ Sbjct: 71 KEARAEIRKVVWPTRQETTQTTLIVVA 97 >gi|313620926|gb|EFR92100.1| preprotein translocase, SecE subunit [Listeria innocua FSL S4-378] Length = 51 Score = 41.7 bits (97), Expect = 0.030, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 31/49 (63%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 A+ FF+ V E K+ WP+R E+L + V+I + + ++FF++ID I Sbjct: 3 AIARFFRNVSSEMHKVTWPTRKELLTYTVTVVITVILFALFFMLIDFGI 51 >gi|281358731|ref|ZP_06245207.1| preprotein translocase, SecE subunit [Victivallis vadensis ATCC BAA-548] gi|281314758|gb|EFA98795.1| preprotein translocase, SecE subunit [Victivallis vadensis ATCC BAA-548] Length = 84 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 29/55 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F + E + WP+R ++ S ++V++ ++I ++F +D+ ++ + Sbjct: 25 IRRFISETMAELGRCTWPNRQQLFESTVLVVVAIAILALFVAGVDEVARIVIRLV 79 >gi|227431257|ref|ZP_03913311.1| protein translocase subunit secE/sec61 gamma [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] gi|227353019|gb|EEJ43191.1| protein translocase subunit secE/sec61 gamma [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] Length = 73 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 28/61 (45%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++N+FK V E K + W + + I VI + I ++F +D + +F+L Sbjct: 12 KGFKMINYFKNVAQEMKNVTWLTGEQTSKETITVITVSIIFALFLGGVDWLLQQGFNFLL 71 Query: 64 G 64 Sbjct: 72 A 72 >gi|260550470|ref|ZP_05824680.1| preprotein translocase subunit SecE [Acinetobacter sp. RUH2624] gi|260406385|gb|EEW99867.1| preprotein translocase subunit SecE [Acinetobacter sp. RUH2624] Length = 146 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + K R E +++ WP++ E + + V++++ ++S+ D +GWL+ I+G Sbjct: 91 VRLLKDARVELRRVTWPTKQETVTTSWQVLLVVVVASLVLWCFDYGLGWLIKLIIG 146 >gi|255019486|ref|ZP_05291582.1| Preprotein translocase subunit SecE [Acidithiobacillus caldus ATCC 51756] gi|254971081|gb|EET28547.1| Preprotein translocase subunit SecE [Acidithiobacillus caldus ATCC 51756] Length = 116 Score = 41.7 bits (97), Expect = 0.033, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 38/58 (65%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A++ FF++ E K+ WP+R EVL S V+++++ + ++F ++D ++ ++ F LG Sbjct: 56 ALVLFFREAYVELLKVVWPTRREVLRSTGVILLLIIVIAIFLWLVDIALLAIVRFALG 113 >gi|229827805|ref|ZP_04453874.1| hypothetical protein GCWU000182_03197 [Abiotrophia defectiva ATCC 49176] gi|229788004|gb|EEP24118.1| hypothetical protein GCWU000182_03197 [Abiotrophia defectiva ATCC 49176] Length = 69 Score = 41.7 bits (97), Expect = 0.033, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F ++V+ E KKI WPS+ + + VI + +ID I +L++ +L Sbjct: 17 FSQEVKSEFKKIIWPSKESLTKESVAVIATTIVLGAVVALIDLGIQYLINGVL 69 >gi|326333422|ref|ZP_08199667.1| preprotein translocase SecE subunit [Nocardioidaceae bacterium Broad-1] gi|325948783|gb|EGD40878.1| preprotein translocase SecE subunit [Nocardioidaceae bacterium Broad-1] Length = 91 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 34/61 (55%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R ++ F++QV E +K+ WP+++++ IVV++ + + +D G LM ++ Sbjct: 27 KRTSLPTFYRQVVAELRKVVWPTQNQLTTYFIVVLVFVLVMMAITAGLDLGFGKLMFWVF 86 Query: 64 G 64 G Sbjct: 87 G 87 >gi|283780332|ref|YP_003371087.1| preprotein translocase SecE subunit [Pirellula staleyi DSM 6068] gi|283438785|gb|ADB17227.1| preprotein translocase, SecE subunit [Pirellula staleyi DSM 6068] Length = 146 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 30/57 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 +F V E K+ WPSR+E++ S VVII++ ++ D L+ ++L + Sbjct: 88 ADFLIAVEAEMNKVSWPSRTELVRSSTVVIIVIFGLTIVLFAYDSIWQALLKYVLQV 144 >gi|170077652|ref|YP_001734290.1| preprotein translocase, SecE subunit [Synechococcus sp. PCC 7002] gi|169885321|gb|ACA99034.1| preprotein translocase, SecE subunit [Synechococcus sp. PCC 7002] Length = 75 Score = 41.7 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 27/54 (50%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + ++E K+ WPSR +++ VI+M+ + + V+D ++ + Sbjct: 22 KYANETKEELAKVVWPSRQQLISESAAVILMVILVATVIYVVDNLFIFVSGAVF 75 >gi|163847739|ref|YP_001635783.1| preprotein translocase subunit SecE [Chloroflexus aurantiacus J-10-fl] gi|222525602|ref|YP_002570073.1| preprotein translocase subunit SecE [Chloroflexus sp. Y-400-fl] gi|163669028|gb|ABY35394.1| preprotein translocase, SecE subunit [Chloroflexus aurantiacus J-10-fl] gi|222449481|gb|ACM53747.1| preprotein translocase, SecE subunit [Chloroflexus sp. Y-400-fl] Length = 75 Score = 41.7 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 28/54 (51%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F++ R E +++ WPSR E + ++VI + + + + D +L ++ + Sbjct: 20 FRETRSELRQVVWPSREETIRLTMLVIAVSIVIGLLLFIGDTIFTFLYTSLVSL 73 >gi|320352904|ref|YP_004194243.1| preprotein translocase subunit SecE [Desulfobulbus propionicus DSM 2032] gi|320121406|gb|ADW16952.1| preprotein translocase, SecE subunit [Desulfobulbus propionicus DSM 2032] Length = 90 Score = 41.7 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +V+ E +KI WP + V++++ + S++ +D +G L+ ++L Sbjct: 33 GIRQFILEVQSEFRKIVWPGKKPTAGLTGFVVLLVVLISLYLGSVDLLLGKLVSYVLN 90 >gi|330432327|gb|AEC17386.1| preprotein translocase subunit SecE [Gallibacterium anatis UMN179] Length = 139 Score = 41.7 bits (97), Expect = 0.037, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 31/56 (55%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K+ R E +KI WP+R E + +VV+ + + S+ +D I L++FI + Sbjct: 82 TFLKESRIELRKIIWPTRQEATQTTLVVMGVTVVVSLILWGLDSIIVSLINFITNL 137 >gi|126695564|ref|YP_001090450.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. MIT 9301] gi|126542607|gb|ABO16849.1| putative preprotein translocase, SecE subunit [Prochlorococcus marinus str. MIT 9301] Length = 80 Score = 41.3 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF+ DE K + WP++ ++ + VIIM+S S+ + + GW I G Sbjct: 26 NFFRSTYDELKLVVWPNKQQLFSESVAVIIMVSFSAAAIASVSRFYGWAASQIFG 80 >gi|78778594|ref|YP_396706.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. MIT 9312] gi|78712093|gb|ABB49270.1| protein translocase subunit secE/sec61 gamma [Prochlorococcus marinus str. MIT 9312] Length = 80 Score = 41.3 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF+ DE K + WP++ ++ + VIIM+S S+ + + GW I G Sbjct: 26 NFFRSTYDELKLVVWPNKQQLFSESVAVIIMVSFSAAAIASVSRFYGWAASQIFG 80 >gi|330718910|ref|ZP_08313510.1| protein translocase subunit secE/sec61 gamma [Leuconostoc fallax KCTC 3537] Length = 58 Score = 41.3 bits (96), Expect = 0.038, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 26/56 (46%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + +FK V E K++ WP++ + + VI + I + F D + ++L Sbjct: 2 ITYFKNVAKEMKRVTWPTQEQASRETVTVIAVSIIFAAFLGGADWLLQNGFGWLLA 57 >gi|32475089|ref|NP_868083.1| SecE protein [Rhodopirellula baltica SH 1] gi|32445629|emb|CAD75635.1| hypothetical protein-putative SecE protein [Rhodopirellula baltica SH 1] gi|327542510|gb|EGF28985.1| SecE protein [Rhodopirellula baltica WH47] Length = 152 Score = 41.3 bits (96), Expect = 0.039, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 28/54 (51%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +F V E K+ WPS+ E++ + +VVI + ++ + D ++ +FI Sbjct: 95 ADFLIAVEAEMNKVTWPSKDELIRASVVVIFTIFFLAITLFLFDVLWQFIFNFI 148 >gi|329118707|ref|ZP_08247407.1| preprotein translocase [Neisseria bacilliformis ATCC BAA-1200] gi|327465142|gb|EGF11427.1| preprotein translocase [Neisseria bacilliformis ATCC BAA-1200] Length = 130 Score = 41.3 bits (96), Expect = 0.041, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 31/60 (51%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 N ++ + ++ E KK+ WP +S + V++ ++I + F +D + W++ +L Sbjct: 69 NFYRLIRYIRESITELKKVVWPEKSYTIRMTGFVLVFVAILATFIYGVDTMVSWVLFDLL 128 >gi|325283115|ref|YP_004255656.1| preprotein translocase, SecE subunit [Deinococcus proteolyticus MRP] gi|324314924|gb|ADY26039.1| preprotein translocase, SecE subunit [Deinococcus proteolyticus MRP] Length = 59 Score = 41.3 bits (96), Expect = 0.041, Method: Composition-based stats. Identities = 11/58 (18%), Positives = 30/58 (51%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + + ++ R+E ++ WP+R++V V++ L ++ ++D L+ +L Sbjct: 1 MNLSQYLQESREELSRVSWPTRAQVWEGTQAVLLFLVALTLIVYLMDLVFTGLIQAVL 58 >gi|330721676|gb|EGG99684.1| Preprotein translocase subunit SecE [gamma proteobacterium IMCC2047] Length = 122 Score = 41.3 bits (96), Expect = 0.042, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 29/62 (46%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 K R E +K+ WP+++E + ++V+ ++ + + +D + ++ I Sbjct: 61 AKGRNFWQLLKDARAEVRKVVWPTKAETRQTTLIVMAVVVMVGLLLWALDSLLSLIVSGI 120 Query: 63 LG 64 +G Sbjct: 121 IG 122 >gi|229497067|ref|ZP_04390771.1| preprotein translocase, SecE subunit [Porphyromonas endodontalis ATCC 35406] gi|229315992|gb|EEN81921.1| preprotein translocase, SecE subunit [Porphyromonas endodontalis ATCC 35406] Length = 67 Score = 41.3 bits (96), Expect = 0.042, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Query: 7 AVLNFFKQVRDESK-KIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + FK +E K+ WP+RSE+ S +VV+I I +V +D + M I + Sbjct: 6 KIGKAFKDSYNELAHKVSWPTRSELTNSAVVVMIASVIIAVCIFAVDTVFNFGMEQIYKL 65 >gi|167749971|ref|ZP_02422098.1| hypothetical protein EUBSIR_00939 [Eubacterium siraeum DSM 15702] gi|167656992|gb|EDS01122.1| hypothetical protein EUBSIR_00939 [Eubacterium siraeum DSM 15702] gi|291557876|emb|CBL34993.1| preprotein translocase, SecE subunit, bacterial [Eubacterium siraeum V10Sc8a] Length = 97 Score = 41.3 bits (96), Expect = 0.042, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 34/61 (55%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + +++ +FK ++ E KK+ WPS+ V + +VV++ L +S + +D L+ L Sbjct: 33 KKSIVKYFKDLKSEFKKVVWPSKKTVFNNTVVVLVTLVVSGICVWGLDTLFATLLRLALN 92 Query: 65 I 65 + Sbjct: 93 M 93 >gi|253577164|ref|ZP_04854484.1| preprotein translocase, SecE subunit [Paenibacillus sp. oral taxon 786 str. D14] gi|251843408|gb|EES71436.1| preprotein translocase, SecE subunit [Paenibacillus sp. oral taxon 786 str. D14] Length = 63 Score = 41.3 bits (96), Expect = 0.042, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 29/47 (61%) Query: 17 DESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 E KK+ WP+R E+ ++V+ +++ +++F V+D I ++ I+ Sbjct: 17 AELKKVRWPNRKELTNYTLIVLGTITVVAIYFWVLDIGISAVIEAII 63 >gi|258647514|ref|ZP_05734983.1| preprotein translocase, SecE subunit [Prevotella tannerae ATCC 51259] gi|260852287|gb|EEX72156.1| preprotein translocase, SecE subunit [Prevotella tannerae ATCC 51259] Length = 64 Score = 41.3 bits (96), Expect = 0.043, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + K+ +E + K WP+R E+ + IVV++ + ++ V+D + +LM FI Sbjct: 4 GIITYCKESYEELAYKTTWPTRRELTHTAIVVLVASIVIALMVFVMDTAFDYLMKFI 60 >gi|121534745|ref|ZP_01666566.1| preprotein translocase, SecE subunit [Thermosinus carboxydivorans Nor1] gi|121306765|gb|EAX47686.1| preprotein translocase, SecE subunit [Thermosinus carboxydivorans Nor1] Length = 78 Score = 41.3 bits (96), Expect = 0.044, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 28/55 (50%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F + VR E KK+ WP++ E++ VV + + + ++ VID L+ + Sbjct: 24 RFLRDVRAELKKVSWPNKQELVSYTGVVFVSVLVVALLIWVIDTGFSELLRLFIK 78 >gi|320333436|ref|YP_004170147.1| preprotein translocase subunit SecE [Deinococcus maricopensis DSM 21211] gi|319754725|gb|ADV66482.1| preprotein translocase, SecE subunit [Deinococcus maricopensis DSM 21211] Length = 60 Score = 41.3 bits (96), Expect = 0.045, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 30/57 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ +F++ R E ++ WP+R +VL V+I + ++ + D+ L+ +L Sbjct: 3 GIVRYFQEARLELLRVTWPTRQQVLEGTQAVLIFVIALTLITFLYDKVFQVLVKLVL 59 >gi|227873028|ref|ZP_03991323.1| hypothetical protein HMPREF6123_1262 [Oribacterium sinus F0268] gi|227841103|gb|EEJ51438.1| hypothetical protein HMPREF6123_1262 [Oribacterium sinus F0268] Length = 66 Score = 41.3 bits (96), Expect = 0.045, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 29/60 (48%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F ++ E KKI +P+R EV+ + I++ + + +D ++ W + IL Sbjct: 5 KKSGGAGFIAGLKSEFKKIVFPTRQEVIKHSVATIVLSVLVGLLITGLDIAMKWGLGLIL 64 >gi|83648865|ref|YP_437300.1| preprotein translocase subunit SecE [Hahella chejuensis KCTC 2396] gi|83636908|gb|ABC32875.1| preprotein translocase, SecE subunit [Hahella chejuensis KCTC 2396] Length = 124 Score = 41.3 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 35/61 (57%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+L K R E +K+ WP+R E+ + ++V++ + + ++ VID I WL+ ++ Sbjct: 64 KGKALLVLLKDARMEIRKVVWPTRPELTQTTLIVVVFVLVVALLLWVIDSLISWLVSGLI 123 Query: 64 G 64 G Sbjct: 124 G 124 >gi|323703916|ref|ZP_08115548.1| preprotein translocase, SecE subunit [Desulfotomaculum nigrificans DSM 574] gi|323531132|gb|EGB21039.1| preprotein translocase, SecE subunit [Desulfotomaculum nigrificans DSM 574] Length = 117 Score = 41.3 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 32/58 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +V + + V++E KK+ WP+R EV+ VV++ ++ + V+D + + I+ Sbjct: 60 SVRRYLRGVQNELKKVHWPTRKEVVTYTAVVLVSVAAVAAVIWVLDSLLSLGVSAIVS 117 >gi|302553508|ref|ZP_07305850.1| preprotein translocase, SecE subunit [Streptomyces viridochromogenes DSM 40736] gi|302471126|gb|EFL34219.1| preprotein translocase, SecE subunit [Streptomyces viridochromogenes DSM 40736] Length = 94 Score = 41.3 bits (96), Expect = 0.048, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+++ VVII + I VID + ++ G Sbjct: 41 FYRQIIAELRKVVWPTRNQLTTYTTVVIIFVVIMIGLVTVIDYGLSHAAKYVFG 94 >gi|237756124|ref|ZP_04584697.1| preprotein translocase, SecE subunit [Sulfurihydrogenibium yellowstonense SS-5] gi|237691709|gb|EEP60744.1| preprotein translocase, SecE subunit [Sulfurihydrogenibium yellowstonense SS-5] Length = 61 Score = 41.3 bits (96), Expect = 0.048, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 34/55 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 L+F K+V +E KK+ WPS++ V + I VI++ I +++ +D ++ FI+ Sbjct: 5 LSFLKEVFEELKKVTWPSKNLVKTATIAVIVLTLIMALYLWSLDILFTKIIAFIM 59 >gi|71066448|ref|YP_265175.1| preprotein translocase subunit SecE [Psychrobacter arcticus 273-4] gi|71039433|gb|AAZ19741.1| protein translocase subunit secE/sec61 gamma [Psychrobacter arcticus 273-4] Length = 162 Score = 41.3 bits (96), Expect = 0.048, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 23/53 (43%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K E +++ WP + E I+M+++ + ++D W + +G Sbjct: 110 LKDAAVELRRVTWPGKDETFQYTWQTIVMIAVVGLLVWLLDNFFNWFVGIFIG 162 >gi|219666472|ref|YP_002456907.1| preprotein translocase subunit SecE [Desulfitobacterium hafniense DCB-2] gi|219536732|gb|ACL18471.1| preprotein translocase, SecE subunit [Desulfitobacterium hafniense DCB-2] Length = 72 Score = 41.0 bits (95), Expect = 0.050, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 32/55 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +FK V E KK+ WP R ++L VV++ ++I +V V+D + LM ILG Sbjct: 18 EYFKGVWSELKKVHWPDRKQLLTYTGVVLVAVAIVAVMLWVVDSGLSILMTKILG 72 >gi|206890191|ref|YP_002249162.1| preprotein translocase, SecE subunit [Thermodesulfovibrio yellowstonii DSM 11347] gi|206742129|gb|ACI21186.1| preprotein translocase, SecE subunit [Thermodesulfovibrio yellowstonii DSM 11347] Length = 61 Score = 41.0 bits (95), Expect = 0.051, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 34/55 (61%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFF +V+ E+KK+ +P + EV+ S VVI+ + + S F +ID + ++ +G Sbjct: 7 NFFNEVKIEAKKVNYPKKDEVIASTWVVIVTVVLISFFLGLIDLVLSRIISAFIG 61 >gi|118468481|ref|YP_885731.1| preprotein translocase subunit SecE [Mycobacterium smegmatis str. MC2 155] gi|118169768|gb|ABK70664.1| translocase [Mycobacterium smegmatis str. MC2 155] Length = 144 Score = 41.0 bits (95), Expect = 0.051, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V+N+ KQV E +K+ WP+R +++ VV++ L D + L+ + G Sbjct: 87 VVNYLKQVVAELRKVIWPNRKQMVSYTTVVLVFLVFMVALIAGADYGLARLVSLVFG 143 >gi|320161302|ref|YP_004174526.1| preprotein translocase SecE subunit [Anaerolinea thermophila UNI-1] gi|319995155|dbj|BAJ63926.1| preprotein translocase SecE subunit [Anaerolinea thermophila UNI-1] Length = 108 Score = 41.0 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 29/53 (54%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ E +K+ WP+ E ++V+I++ ++S+ ++D L+ ++ + Sbjct: 56 RETIGELRKVTWPTLPEARRLTVIVLIVVGVTSLALGLLDWVFSRLIALLISL 108 >gi|94677054|ref|YP_588931.1| preprotein translocase, SecE subunit [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] gi|94220204|gb|ABF14363.1| preprotein translocase, SecE subunit [Baumannia cicadellinicola str. Hc (Homalodisca coagulata)] Length = 127 Score = 41.0 bits (95), Expect = 0.052, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 27/57 (47%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L F + E +KI WP+ E + +++ + + S+ +D + ++ FI + Sbjct: 69 LRFISEAYIEMRKIIWPTSQETFYTTLIIAVTTILMSLVIWGLDIFLVNIISFITSL 125 >gi|93007007|ref|YP_581444.1| preprotein translocase subunit SecE [Psychrobacter cryohalolentis K5] gi|92394685|gb|ABE75960.1| protein translocase subunit secE/sec61 gamma [Psychrobacter cryohalolentis K5] Length = 162 Score = 41.0 bits (95), Expect = 0.054, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 23/53 (43%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K E +++ WP + E I+M+++ + ++D W + +G Sbjct: 110 LKDAAVELRRVTWPGKDETFQYTWQTIVMIAVVGLLVWLLDNFFNWFVGIFIG 162 >gi|294791362|ref|ZP_06756519.1| preprotein translocase, SecE subunit [Scardovia inopinata F0304] gi|294457833|gb|EFG26187.1| preprotein translocase, SecE subunit [Scardovia inopinata F0304] Length = 76 Score = 41.0 bits (95), Expect = 0.056, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 32/59 (54%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + F KQV DE +K+ PS E+L + V I + + +F ID +G LM F+ G Sbjct: 18 MRIGQFIKQVLDEMRKVVAPSGLELLKWSLAVFIFVLLLMLFTTGIDFGLGKLMLFLFG 76 >gi|71892332|ref|YP_278066.1| preprotein translocase subunit SecE [Candidatus Blochmannia pennsylvanicus str. BPEN] gi|71796438|gb|AAZ41189.1| preprotein translocase, membrane component [Candidatus Blochmannia pennsylvanicus str. BPEN] Length = 115 Score = 41.0 bits (95), Expect = 0.056, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 30/58 (51%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ F + R E +K+ WP+ + L + ++V + I S+ +D + ++ F L + Sbjct: 58 IIIFGNESRTECRKVVWPTYQDGLNTTLIVTGVTIIMSLLLWGLDTILVHVISFGLRL 115 >gi|21223028|ref|NP_628807.1| preprotein translocase subunit SecE [Streptomyces coelicolor A3(2)] gi|256785874|ref|ZP_05524305.1| preprotein translocase subunit SecE [Streptomyces lividans TK24] gi|289769766|ref|ZP_06529144.1| preprotein translocase subunit secE [Streptomyces lividans TK24] gi|61252183|sp|P0A4G8|SECE_STRCO RecName: Full=Preprotein translocase subunit secE gi|7248340|emb|CAB77420.1| preprotein translocase SecE subunit [Streptomyces coelicolor A3(2)] gi|289699965|gb|EFD67394.1| preprotein translocase subunit secE [Streptomyces lividans TK24] Length = 94 Score = 41.0 bits (95), Expect = 0.058, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WPSR+++ VVII + I +ID ++ G Sbjct: 41 FYRQIVAELRKVVWPSRNQLTTYTTVVIIFVVIMIGLVTLIDYGFSHAAKYVFG 94 >gi|317499075|ref|ZP_07957355.1| preprotein translocase [Lachnospiraceae bacterium 5_1_63FAA] gi|316893651|gb|EFV15853.1| preprotein translocase [Lachnospiraceae bacterium 5_1_63FAA] Length = 65 Score = 41.0 bits (95), Expect = 0.058, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 32/63 (50%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 N+ ++FK+++ E +I WP++ + VV+I I V V+D I + + Sbjct: 3 KTNKAKKPSWFKELKAEFNRIIWPTKERIAKETAVVVICAIIIGVIVAVLDVGIQYGIQA 62 Query: 62 ILG 64 ++G Sbjct: 63 LVG 65 >gi|169630974|ref|YP_001704623.1| preprotein translocase subunit SecE [Mycobacterium abscessus ATCC 19977] gi|169242941|emb|CAM63969.1| Probable preprotein translocase SecE subunit [Mycobacterium abscessus] Length = 139 Score = 41.0 bits (95), Expect = 0.058, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F +QV E +K+ WP+R +++ VV++ L VID + L+ + G Sbjct: 86 FLQQVVAELRKVIWPNRKQMVSYTSVVLVFLVFMVTLIGVIDLGLARLVMLVFG 139 >gi|313819204|gb|EFS56918.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL046PA2] Length = 216 Score = 41.0 bits (95), Expect = 0.059, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 31/63 (49%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G R+ + F KQ E +K+ WPS E+ +VV++ + + + +D GW + Sbjct: 153 GKQRIGPVTFTKQSVAELRKVKWPSGDELGQYFLVVLVFVLLIIAYVSGLDVVFGWGVIK 212 Query: 62 ILG 64 + G Sbjct: 213 LFG 215 >gi|296138473|ref|YP_003645716.1| preprotein translocase, SecE subunit [Tsukamurella paurometabola DSM 20162] gi|296026607|gb|ADG77377.1| preprotein translocase, SecE subunit [Tsukamurella paurometabola DSM 20162] Length = 125 Score = 41.0 bits (95), Expect = 0.060, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A+ F +QV E +K+ WP+RS+++ I+V++ + + + F ++D LM + G Sbjct: 68 AIWLFLRQVVAELRKVIWPTRSQMINYTIIVLVFVVVLTAFVSLLDLGFAKLMLWAFG 125 >gi|116071968|ref|ZP_01469236.1| SecE subunit of protein translocation complex [Synechococcus sp. BL107] gi|116065591|gb|EAU71349.1| SecE subunit of protein translocation complex [Synechococcus sp. BL107] Length = 99 Score = 41.0 bits (95), Expect = 0.062, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 26/53 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F + E K + WPSR ++ I VI+M+S+S+ + + GW + Sbjct: 46 FLAETVQELKLVVWPSRQQLFSESIAVILMVSLSAATIAAVSRFFGWASSQVF 98 >gi|154508675|ref|ZP_02044317.1| hypothetical protein ACTODO_01180 [Actinomyces odontolyticus ATCC 17982] gi|153798309|gb|EDN80729.1| hypothetical protein ACTODO_01180 [Actinomyces odontolyticus ATCC 17982] Length = 98 Score = 41.0 bits (95), Expect = 0.063, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 32/58 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FFKQV DE KK+ +P+ SE +VV++ ++ +F ++D G L I G Sbjct: 41 GIWLFFKQVIDEMKKVTYPTGSETWTYFLVVVVFVAAIMLFAGLLDFGFGKLSALIFG 98 >gi|294787326|ref|ZP_06752579.1| preprotein translocase, SecE subunit [Parascardovia denticolens F0305] gi|315227114|ref|ZP_07868901.1| preprotein translocase [Parascardovia denticolens DSM 10105] gi|294484682|gb|EFG32317.1| preprotein translocase, SecE subunit [Parascardovia denticolens F0305] gi|315119564|gb|EFT82697.1| preprotein translocase [Parascardovia denticolens DSM 10105] Length = 76 Score = 40.6 bits (94), Expect = 0.064, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 31/59 (52%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + F KQV DE +K+ PS E+ + V I + + +F ID +G LM F+ G Sbjct: 18 MRIGLFIKQVVDEMRKVVAPSGFELFKWSVAVFIFVLLLMLFTFGIDYGLGKLMLFLFG 76 >gi|256827386|ref|YP_003151345.1| preprotein translocase, SecE subunit [Cryptobacterium curtum DSM 15641] gi|256583529|gb|ACU94663.1| preprotein translocase, SecE subunit [Cryptobacterium curtum DSM 15641] Length = 144 Score = 40.6 bits (94), Expect = 0.066, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIML 41 F QVR E K++ WP+R +VL VV+ L Sbjct: 87 FIAQVRSEMKRVTWPTRQDVLRWSGVVVAAL 117 >gi|260905751|ref|ZP_05914073.1| preprotein translocase subunit SecE [Brevibacterium linens BL2] Length = 91 Score = 40.6 bits (94), Expect = 0.066, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 33/57 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +L FF++V E KK+ P+R +++ +VV+ + + +V+D G L+ F+ G Sbjct: 27 ILQFFREVIAELKKVVTPTRKQLVNYTLVVLGFILFMMLLVVVLDLVFGKLVGFVFG 83 >gi|293189018|ref|ZP_06607750.1| preprotein translocase, SecE subunit [Actinomyces odontolyticus F0309] gi|292822049|gb|EFF80976.1| preprotein translocase, SecE subunit [Actinomyces odontolyticus F0309] Length = 98 Score = 40.6 bits (94), Expect = 0.067, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 32/58 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FFKQV DE KK+ +P+ SE +VV++ ++ +F ++D G L I G Sbjct: 41 GIWLFFKQVIDEMKKVTYPTGSETWTYFLVVVVFVAAIMLFAGLLDFGFGKLSALIFG 98 >gi|256848159|ref|ZP_05553603.1| preprotein translocase, SecE subunit [Lactobacillus coleohominis 101-4-CHN] gi|256715219|gb|EEU30196.1| preprotein translocase, SecE subunit [Lactobacillus coleohominis 101-4-CHN] Length = 59 Score = 40.6 bits (94), Expect = 0.067, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 23/54 (42%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 + + F K V E K+ WP+ E VVI + +FF + D I M Sbjct: 1 MHLFRFLKSVVQEMHKVVWPTWKENRRDTGVVISLTIFFVIFFALADWIIQAGM 54 >gi|294056231|ref|YP_003549889.1| preprotein translocase, SecE subunit [Coraliomargarita akajimensis DSM 45221] gi|293615564|gb|ADE55719.1| preprotein translocase, SecE subunit [Coraliomargarita akajimensis DSM 45221] Length = 67 Score = 40.6 bits (94), Expect = 0.068, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 32/62 (51%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M ++ F+K+ E KK WP+++E+ S +VV++ +I F + D S+ + Sbjct: 1 MKNPFSSIRLFYKETLTELKKASWPTKTELRDSTVVVLLATAILGSFIALTDFSLMNGVE 60 Query: 61 FI 62 + Sbjct: 61 LL 62 >gi|308070991|ref|YP_003872596.1| preprotein translocase, SecE subunit [Paenibacillus polymyxa E681] gi|310644220|ref|YP_003948979.1| preprotein translocase, sece subunit [Paenibacillus polymyxa SC2] gi|305860270|gb|ADM72058.1| preprotein translocase, SecE subunit [Paenibacillus polymyxa E681] gi|309249171|gb|ADO58738.1| Preprotein translocase, SecE subunit [Paenibacillus polymyxa SC2] Length = 63 Score = 40.6 bits (94), Expect = 0.069, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 28/47 (59%) Query: 17 DESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 E KK+ WP+R E+ ++VI ++ +++F V+D I ++ I+ Sbjct: 17 AELKKVRWPNRKELTNYTLIVIGTIAFVTIYFWVLDIGISAVIEAII 63 >gi|238916243|ref|YP_002929760.1| hypothetical protein EUBELI_00277 [Eubacterium eligens ATCC 27750] gi|238871603|gb|ACR71313.1| Hypothetical protein EUBELI_00277 [Eubacterium eligens ATCC 27750] Length = 67 Score = 40.6 bits (94), Expect = 0.069, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 28/55 (50%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 N+FK ++ E KI WP R + + V+ + + V V+D + + + FI+ Sbjct: 13 NWFKGLKAEFSKIIWPDRQSLTKETVAVLAVSVLLGVIIAVVDLIVRFGIEFIVK 67 >gi|298346272|ref|YP_003718959.1| preprotein translocase subunit SecE [Mobiluncus curtisii ATCC 43063] gi|304389962|ref|ZP_07371919.1| preprotein translocase [Mobiluncus curtisii subsp. curtisii ATCC 35241] gi|315654867|ref|ZP_07907772.1| preprotein translocase [Mobiluncus curtisii ATCC 51333] gi|315657213|ref|ZP_07910097.1| preprotein translocase [Mobiluncus curtisii subsp. holmesii ATCC 35242] gi|298236333|gb|ADI67465.1| preprotein translocase subunit SecE [Mobiluncus curtisii ATCC 43063] gi|304326855|gb|EFL94096.1| preprotein translocase [Mobiluncus curtisii subsp. curtisii ATCC 35241] gi|315490828|gb|EFU80448.1| preprotein translocase [Mobiluncus curtisii ATCC 51333] gi|315492316|gb|EFU81923.1| preprotein translocase [Mobiluncus curtisii subsp. holmesii ATCC 35242] Length = 86 Score = 40.6 bits (94), Expect = 0.070, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 31/57 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ FF+QV DE KK+ +P+ E+ +VVI+ ++I ++D G L I Sbjct: 30 IVQFFRQVVDEMKKVVYPTSEELWRYFLVVIVFVAIIMTAVGLMDLGFGALTDVIFS 86 >gi|71899979|ref|ZP_00682125.1| SecE subunit of protein translocation complex [Xylella fastidiosa Ann-1] gi|71730266|gb|EAO32351.1| SecE subunit of protein translocation complex [Xylella fastidiosa Ann-1] Length = 66 Score = 40.6 bits (94), Expect = 0.071, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F + R E +K+ WP+R EV+ VVI+M++I S+ D I L + L Sbjct: 12 FLYESRFELRKVVWPTRHEVIRMTWVVIVMITILSLLLGGFDFVIQKLTQWFLS 65 >gi|331701824|ref|YP_004398783.1| preprotein translocase subunit SecE [Lactobacillus buchneri NRRL B-30929] gi|329129167|gb|AEB73720.1| preprotein translocase, SecE subunit [Lactobacillus buchneri NRRL B-30929] Length = 58 Score = 40.6 bits (94), Expect = 0.072, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + ++NFFK+V E K + WP+ S+ VI I ++F ++D + W + F+ Sbjct: 1 MRLINFFKKVAQEMKVVTWPNASQTRTDTSTVIGTSIIMAIFLGLVDWIVQWALQFL 57 >gi|313115118|ref|ZP_07800605.1| preprotein translocase, SecE subunit [Faecalibacterium cf. prausnitzii KLE1255] gi|310622558|gb|EFQ06026.1| preprotein translocase, SecE subunit [Faecalibacterium cf. prausnitzii KLE1255] Length = 83 Score = 40.6 bits (94), Expect = 0.072, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 36/56 (64%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+ + E KK+ WPS+ +V + +VV++ ++I++V +++D G ++ I+G Sbjct: 27 AKFFRDTKSELKKVVWPSKEDVKTNTVVVLVTVAIAAVVMILLDAIFGGILGLIIG 82 >gi|189499293|ref|YP_001958763.1| preprotein translocase subunit SecE [Chlorobium phaeobacteroides BS1] gi|189494734|gb|ACE03282.1| preprotein translocase, SecE subunit [Chlorobium phaeobacteroides BS1] Length = 63 Score = 40.6 bits (94), Expect = 0.073, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ V +E KK+ WPS + +VV+ + + ++F V+D I + +L Sbjct: 11 YYHDVVNEMKKVAWPSPEDTRDLTVVVLTVSGLLTLFTFVVDWVINSFIGKLL 63 >gi|18311401|ref|NP_563335.1| preprotein translocase subunit SecE [Clostridium perfringens str. 13] gi|110799456|ref|YP_697108.1| preprotein translocase subunit SecE [Clostridium perfringens ATCC 13124] gi|18146085|dbj|BAB82125.1| probable protein translocase [Clostridium perfringens str. 13] gi|110674103|gb|ABG83090.1| preprotein translocase, SecE subunit [Clostridium perfringens ATCC 13124] Length = 74 Score = 40.6 bits (94), Expect = 0.074, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 29/64 (45%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + FF+ V+ E K+I WP + E ++I VI+ IS V+D L Sbjct: 10 KSRGFGITKFFRGVKAEIKRITWPPKEEAKKAIIAVIVFTVISIALIGVMDFVFKNLFEL 69 Query: 62 ILGI 65 + G+ Sbjct: 70 VFGL 73 >gi|91200654|emb|CAJ73704.1| similar to preprotein translocase SecE subunit [Candidatus Kuenenia stuttgartiensis] Length = 153 Score = 40.6 bits (94), Expect = 0.074, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 33/54 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F + ++E +K+ WP+R E++ S IVVII + I F L +D + + M +I Sbjct: 97 VEFLVETQNELQKVSWPTRYELVGSTIVVIISVVIIGFFILGVDWVVSFFMEYI 150 >gi|317509042|ref|ZP_07966673.1| preprotein translocase [Segniliparus rugosus ATCC BAA-974] gi|316252697|gb|EFV12136.1| preprotein translocase [Segniliparus rugosus ATCC BAA-974] Length = 161 Score = 40.6 bits (94), Expect = 0.076, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 33/57 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V+ FF++V E K+ WP R +++ ++VII +++ F ++D L ++LG Sbjct: 105 VVQFFREVIAELSKVIWPQRRQMVSYTVIVIIFVAVVVSFVALLDIGFAKLALWLLG 161 >gi|307243196|ref|ZP_07525369.1| preprotein translocase, SecE subunit [Peptostreptococcus stomatis DSM 17678] gi|306493457|gb|EFM65437.1| preprotein translocase, SecE subunit [Peptostreptococcus stomatis DSM 17678] Length = 68 Score = 40.6 bits (94), Expect = 0.077, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F K E +K+ WP+ E+ VV+ ++ +S++F ++D + + ++ Sbjct: 15 FIKGTGQELRKVTWPTVGELAGKTGVVLGVVIVSTLFVWLVDLGLSKALSLLIK 68 >gi|255282703|ref|ZP_05347258.1| preprotein translocase, SecE subunit [Bryantella formatexigens DSM 14469] gi|255266724|gb|EET59929.1| preprotein translocase, SecE subunit [Bryantella formatexigens DSM 14469] Length = 69 Score = 40.6 bits (94), Expect = 0.078, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 29/61 (47%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + V ++ ++ E KI WP + ++ VVI++ + VID + + + F++ Sbjct: 9 KKTPVKSWIDGLKSEFHKIIWPDKKDLTKQTGVVIVVSVLLGAIIAVIDVIMQYGIDFLI 68 Query: 64 G 64 Sbjct: 69 K 69 >gi|13880187|gb|AAK44892.1| preprotein translocase SecE subunit [Mycobacterium tuberculosis CDC1551] Length = 80 Score = 40.6 bits (94), Expect = 0.078, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 28/57 (49%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 V N+ KQV E +K+ WP+R ++L VV+ L+ D + L+ + G Sbjct: 24 VYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVAGADLGLTKLVMLVFG 80 >gi|317495155|ref|ZP_07953525.1| preprotein translocase [Gemella moribillum M424] gi|316914577|gb|EFV36053.1| preprotein translocase [Gemella moribillum M424] Length = 57 Score = 40.6 bits (94), Expect = 0.080, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 32/52 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 L FFK+V E KK+ WP+ +E++ ++VI+++ I +F V+D I + Sbjct: 2 LRFFKKVVSEMKKVSWPTFNELVRKTLIVIVVVGILMLFSYVVDLGITAGIR 53 >gi|187935592|ref|YP_001884460.1| preprotein translocase subunit SecE [Clostridium botulinum B str. Eklund 17B] gi|187723745|gb|ACD24966.1| preprotein translocase, SecE subunit [Clostridium botulinum B str. Eklund 17B] Length = 76 Score = 40.6 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 27/61 (44%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +L+FF++V+ E K I WPS+ E + + V + I + +D L I Sbjct: 14 KNSGLLSFFREVKAELKIITWPSKDETKKAFVAVGVFAIIYIILVGGLDFIFKNLFEMIF 73 Query: 64 G 64 Sbjct: 74 N 74 >gi|313124311|ref|YP_004034570.1| protein translocase subunit sece/sec61 gamma [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|312280874|gb|ADQ61593.1| Protein translocase subunit secE/sec61 gamma [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|325685660|gb|EGD27742.1| preprotein translocase subunit SecE [Lactobacillus delbrueckii subsp. lactis DSM 20072] Length = 56 Score = 40.6 bits (94), Expect = 0.083, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 26/55 (47%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FFK V E K + WPS E V++ + ++F +D + L+ +L Sbjct: 2 IKFFKSVGQEMKLVHWPSAKENRRDTANVVVTSLLYAIFLGALDWAFAKLIQLVL 56 >gi|291447026|ref|ZP_06586416.1| secretory protein SecE [Streptomyces roseosporus NRRL 15998] gi|291349973|gb|EFE76877.1| secretory protein SecE [Streptomyces roseosporus NRRL 15998] Length = 123 Score = 40.2 bits (93), Expect = 0.084, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+RS++ VVI+ + + V+D ++ ++ G Sbjct: 70 FYRQIVAELRKVVWPTRSQLTTYTSVVIVFVVVMIGLVTVLDMGFARVVKYVFG 123 >gi|160947355|ref|ZP_02094522.1| hypothetical protein PEPMIC_01289 [Parvimonas micra ATCC 33270] gi|158446489|gb|EDP23484.1| hypothetical protein PEPMIC_01289 [Parvimonas micra ATCC 33270] Length = 68 Score = 40.2 bits (93), Expect = 0.084, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 27/53 (50%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F + VR E KKI WPS+ V + V+ + ISS +D + L+ I+ Sbjct: 15 FMRGVRHEFKKIVWPSKKSVFYYSLAVVTISIISSTMIWGLDNILKRLLGLII 67 >gi|29377207|ref|NP_816361.1| preprotein translocase, SecE subunit [Enterococcus faecalis V583] gi|227519485|ref|ZP_03949534.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0104] gi|227554215|ref|ZP_03984262.1| preprotein translocase, SecE subunit [Enterococcus faecalis HH22] gi|229544888|ref|ZP_04433613.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1322] gi|229549154|ref|ZP_04437879.1| preprotein translocase, SecE subunit [Enterococcus faecalis ATCC 29200] gi|255971872|ref|ZP_05422458.1| predicted protein [Enterococcus faecalis T1] gi|255974867|ref|ZP_05425453.1| predicted protein [Enterococcus faecalis T2] gi|256616770|ref|ZP_05473616.1| predicted protein [Enterococcus faecalis ATCC 4200] gi|256763354|ref|ZP_05503934.1| predicted protein [Enterococcus faecalis T3] gi|256854028|ref|ZP_05559393.1| preprotein translocase [Enterococcus faecalis T8] gi|256957956|ref|ZP_05562127.1| predicted protein [Enterococcus faecalis DS5] gi|256961024|ref|ZP_05565195.1| predicted protein [Enterococcus faecalis Merz96] gi|256963834|ref|ZP_05568005.1| predicted protein [Enterococcus faecalis HIP11704] gi|257079894|ref|ZP_05574255.1| predicted protein [Enterococcus faecalis JH1] gi|257081707|ref|ZP_05576068.1| preprotein translocase, SecE subunit [Enterococcus faecalis E1Sol] gi|257084304|ref|ZP_05578665.1| preprotein translocase, SecE subunit [Enterococcus faecalis Fly1] gi|257087697|ref|ZP_05582058.1| predicted protein [Enterococcus faecalis D6] gi|257090915|ref|ZP_05585276.1| preprotein translocase secE [Enterococcus faecalis CH188] gi|257416899|ref|ZP_05593893.1| predicted protein [Enterococcus faecalis AR01/DG] gi|257420121|ref|ZP_05597115.1| predicted protein [Enterococcus faecalis T11] gi|257421658|ref|ZP_05598648.1| preprotein translocase subunit secE [Enterococcus faecalis X98] gi|293384586|ref|ZP_06630452.1| preprotein translocase, SecE subunit [Enterococcus faecalis R712] gi|293386815|ref|ZP_06631386.1| preprotein translocase, SecE subunit [Enterococcus faecalis S613] gi|294779910|ref|ZP_06745292.1| preprotein translocase, SecE subunit [Enterococcus faecalis PC1.1] gi|300860433|ref|ZP_07106520.1| preprotein translocase, SecE subunit [Enterococcus faecalis TUSoD Ef11] gi|307269241|ref|ZP_07550595.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX4248] gi|307271781|ref|ZP_07553052.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0855] gi|307276966|ref|ZP_07558076.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX2134] gi|307278723|ref|ZP_07559790.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0860] gi|307288651|ref|ZP_07568632.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0109] gi|307290266|ref|ZP_07570182.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0411] gi|312900091|ref|ZP_07759407.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0470] gi|312902554|ref|ZP_07761760.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0635] gi|312906412|ref|ZP_07765420.1| preprotein translocase, SecE subunit [Enterococcus faecalis DAPTO 512] gi|312951904|ref|ZP_07770792.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0102] gi|312979429|ref|ZP_07791117.1| preprotein translocase, SecE subunit [Enterococcus faecalis DAPTO 516] gi|29344673|gb|AAO82431.1| preprotein translocase, SecE subunit [Enterococcus faecalis V583] gi|227073097|gb|EEI11060.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0104] gi|227176662|gb|EEI57634.1| preprotein translocase, SecE subunit [Enterococcus faecalis HH22] gi|229305708|gb|EEN71704.1| preprotein translocase, SecE subunit [Enterococcus faecalis ATCC 29200] gi|229309989|gb|EEN75976.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1322] gi|255962890|gb|EET95366.1| predicted protein [Enterococcus faecalis T1] gi|255967739|gb|EET98361.1| predicted protein [Enterococcus faecalis T2] gi|256596297|gb|EEU15473.1| predicted protein [Enterococcus faecalis ATCC 4200] gi|256684605|gb|EEU24300.1| predicted protein [Enterococcus faecalis T3] gi|256710971|gb|EEU26014.1| preprotein translocase [Enterococcus faecalis T8] gi|256948452|gb|EEU65084.1| predicted protein [Enterococcus faecalis DS5] gi|256951520|gb|EEU68152.1| predicted protein [Enterococcus faecalis Merz96] gi|256954330|gb|EEU70962.1| predicted protein [Enterococcus faecalis HIP11704] gi|256987924|gb|EEU75226.1| predicted protein [Enterococcus faecalis JH1] gi|256989737|gb|EEU77039.1| preprotein translocase, SecE subunit [Enterococcus faecalis E1Sol] gi|256992334|gb|EEU79636.1| preprotein translocase, SecE subunit [Enterococcus faecalis Fly1] gi|256995727|gb|EEU83029.1| predicted protein [Enterococcus faecalis D6] gi|256999727|gb|EEU86247.1| preprotein translocase secE [Enterococcus faecalis CH188] gi|257158727|gb|EEU88687.1| predicted protein [Enterococcus faecalis ARO1/DG] gi|257161949|gb|EEU91909.1| predicted protein [Enterococcus faecalis T11] gi|257163482|gb|EEU93442.1| preprotein translocase subunit secE [Enterococcus faecalis X98] gi|291078132|gb|EFE15496.1| preprotein translocase, SecE subunit [Enterococcus faecalis R712] gi|291083818|gb|EFE20781.1| preprotein translocase, SecE subunit [Enterococcus faecalis S613] gi|294453022|gb|EFG21442.1| preprotein translocase, SecE subunit [Enterococcus faecalis PC1.1] gi|295113672|emb|CBL32309.1| protein translocase subunit secE/sec61 gamma [Enterococcus sp. 7L76] gi|300849472|gb|EFK77222.1| preprotein translocase, SecE subunit [Enterococcus faecalis TUSoD Ef11] gi|306498687|gb|EFM68188.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0411] gi|306500405|gb|EFM69741.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0109] gi|306504584|gb|EFM73787.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0860] gi|306506389|gb|EFM75549.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX2134] gi|306511659|gb|EFM80658.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0855] gi|306514460|gb|EFM83021.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX4248] gi|310627566|gb|EFQ10849.1| preprotein translocase, SecE subunit [Enterococcus faecalis DAPTO 512] gi|310630093|gb|EFQ13376.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0102] gi|310634224|gb|EFQ17507.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0635] gi|311287800|gb|EFQ66356.1| preprotein translocase, SecE subunit [Enterococcus faecalis DAPTO 516] gi|311292726|gb|EFQ71282.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0470] gi|315025504|gb|EFT37436.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX2137] gi|315030450|gb|EFT42382.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX4000] gi|315032578|gb|EFT44510.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0017] gi|315035101|gb|EFT47033.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0027] gi|315143880|gb|EFT87896.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX2141] gi|315148691|gb|EFT92707.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX4244] gi|315151765|gb|EFT95781.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0012] gi|315154306|gb|EFT98322.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0031] gi|315155592|gb|EFT99608.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0043] gi|315159601|gb|EFU03618.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0312] gi|315162107|gb|EFU06124.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0645] gi|315165298|gb|EFU09315.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1302] gi|315170472|gb|EFU14489.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1342] gi|315174936|gb|EFU18953.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1346] gi|315573768|gb|EFU85959.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0309B] gi|315579637|gb|EFU91828.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0630] gi|315580282|gb|EFU92473.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX0309A] gi|323481652|gb|ADX81091.1| preprotein translocase, SecE subunit [Enterococcus faecalis 62] gi|327535946|gb|AEA94780.1| preprotein translocase [Enterococcus faecalis OG1RF] gi|329578048|gb|EGG59462.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1467] Length = 56 Score = 40.2 bits (93), Expect = 0.084, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 30/56 (53%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FF+ V DE K++ WP++ ++ +VVI + + F ++D I +IL Sbjct: 1 MKFFRSVADEMKQVTWPTKKQLRKDTLVVIETSILFAALFFIMDTVIQTAFGWILK 56 >gi|110801669|ref|YP_699677.1| preprotein translocase subunit SecE [Clostridium perfringens SM101] gi|110682170|gb|ABG85540.1| preprotein translocase, SecE subunit [Clostridium perfringens SM101] Length = 74 Score = 40.2 bits (93), Expect = 0.085, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 29/64 (45%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + FF+ V+ E K+I WP + E ++I VI+ IS V+D L Sbjct: 10 KSRGFGITKFFRGVKAEIKRITWPPKEEAKKAIIAVIVFTVISIALIGVMDFVFKNLFEL 69 Query: 62 ILGI 65 + G+ Sbjct: 70 VFGL 73 >gi|320449271|ref|YP_004201367.1| preprotein translocase subunit SecE [Thermus scotoductus SA-01] gi|320149440|gb|ADW20818.1| preprotein translocase, subunit SecE [Thermus scotoductus SA-01] Length = 60 Score = 40.2 bits (93), Expect = 0.086, Method: Composition-based stats. Identities = 9/57 (15%), Positives = 28/57 (49%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ +F++ R E ++ WP+R +++ +++ ++ V D +L+ + Sbjct: 3 TRIVRYFQEARAELARVTWPTREQIVEGTQAILVFTVVAMVILGFYDLVFRFLIGLV 59 >gi|257126640|ref|YP_003164754.1| preprotein translocase, SecE subunit [Leptotrichia buccalis C-1013-b] gi|257050579|gb|ACV39763.1| preprotein translocase, SecE subunit [Leptotrichia buccalis C-1013-b] Length = 71 Score = 40.2 bits (93), Expect = 0.086, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 35/59 (59%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + F +R+E KKI+WP + EV ++VI+M + +++ L+ D + +++ I Sbjct: 2 SKFNLKEAFGNLREEYKKIYWPDKIEVYHVTVIVILMTAFIAIYTLLFDTAFNFVLAKI 60 >gi|254391411|ref|ZP_05006614.1| preprotein translocase subunit secE [Streptomyces clavuligerus ATCC 27064] gi|294814453|ref|ZP_06773096.1| Secretory protein SecE [Streptomyces clavuligerus ATCC 27064] gi|326442842|ref|ZP_08217576.1| preprotein translocase subunit SecE [Streptomyces clavuligerus ATCC 27064] gi|109942285|emb|CAJ84541.1| SecE protein [Streptomyces clavuligerus ATCC 27064] gi|197705101|gb|EDY50913.1| preprotein translocase subunit secE [Streptomyces clavuligerus ATCC 27064] gi|294327052|gb|EFG08695.1| Secretory protein SecE [Streptomyces clavuligerus ATCC 27064] Length = 92 Score = 40.2 bits (93), Expect = 0.087, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+++ VVII + I VID + ++ G Sbjct: 39 FYRQIIAELRKVVWPTRNQLTTYTTVVIIFVVIMIGLVTVIDYGFQEAVSYVFG 92 >gi|56459450|ref|YP_154731.1| preprotein translocase subunit SecE [Idiomarina loihiensis L2TR] gi|56178460|gb|AAV81182.1| Preprotein translocase subunit SecE [Idiomarina loihiensis L2TR] Length = 126 Score = 40.2 bits (93), Expect = 0.087, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 33/57 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L+F K+ R E +K+ WPSR E + ++V++ + ++ +D + ++ F+ G+ Sbjct: 68 LSFAKESRTEVRKVVWPSRQEATQTTLIVVVATVVVALILWGLDGILVRVVGFLTGL 124 >gi|315077101|gb|EFT49176.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL053PA2] Length = 216 Score = 40.2 bits (93), Expect = 0.089, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 32/63 (50%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G R+ + F KQ E +K+ WPS E+ +VV++ + + + +D GW++ Sbjct: 153 GKQRIGPVTFTKQSVAELRKVKWPSGDELGQYFLVVLVFVLLIIAYVSGLDVVFGWVVIK 212 Query: 62 ILG 64 + G Sbjct: 213 LFG 215 >gi|282855234|ref|ZP_06264566.1| preprotein translocase, SecE subunit [Propionibacterium acnes J139] gi|282581822|gb|EFB87207.1| preprotein translocase, SecE subunit [Propionibacterium acnes J139] gi|314983093|gb|EFT27185.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL110PA3] gi|315090637|gb|EFT62613.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL110PA4] Length = 216 Score = 40.2 bits (93), Expect = 0.089, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 32/63 (50%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G R+ + F KQ E +K+ WPS E+ +VV++ + + + +D GW++ Sbjct: 153 GKQRIGPVTFTKQSVAELRKVKWPSGDELGQYFLVVLVFVLLIIAYVSGLDVVFGWVVIK 212 Query: 62 ILG 64 + G Sbjct: 213 LFG 215 >gi|315104067|gb|EFT76043.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL050PA2] Length = 216 Score = 40.2 bits (93), Expect = 0.092, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 32/63 (50%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G R+ + F KQ E +K+ WPS E+ +VV++ + + + +D GW++ Sbjct: 153 GKQRIGPVTFTKQSVAELRKVKWPSGDELGQYFLVVLVFVLLIIAYVSGLDVVFGWVVIK 212 Query: 62 ILG 64 + G Sbjct: 213 LFG 215 >gi|228989304|ref|ZP_04149295.1| preprotein translocase subunit SecE [Bacillus pseudomycoides DSM 12442] gi|228995486|ref|ZP_04155154.1| preprotein translocase subunit SecE [Bacillus mycoides Rock3-17] gi|229003109|ref|ZP_04160958.1| preprotein translocase subunit SecE [Bacillus mycoides Rock1-4] gi|228758145|gb|EEM07341.1| preprotein translocase subunit SecE [Bacillus mycoides Rock1-4] gi|228764215|gb|EEM13094.1| preprotein translocase subunit SecE [Bacillus mycoides Rock3-17] gi|228770382|gb|EEM18955.1| preprotein translocase subunit SecE [Bacillus pseudomycoides DSM 12442] Length = 59 Score = 40.2 bits (93), Expect = 0.092, Method: Composition-based stats. Identities = 24/59 (40%), Positives = 33/59 (55%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + NFF V E KK+ WP + E+L S VI + +VFF V+D I L+ ILG Sbjct: 1 MRLTNFFGDVGREMKKVSWPKKDELLRSTATVIATVVFFAVFFAVVDMGISSLIRLILG 59 >gi|320095593|ref|ZP_08027256.1| preprotein translocase [Actinomyces sp. oral taxon 178 str. F0338] gi|319977501|gb|EFW09181.1| preprotein translocase [Actinomyces sp. oral taxon 178 str. F0338] Length = 112 Score = 40.2 bits (93), Expect = 0.093, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F QV E +K+ +P+RSE +VV++ ++ F ++D G L I G Sbjct: 59 FLTQVVAEMRKVTYPTRSETWTYFVVVVVFVTAIMAFTGLLDFGFGKLSALIFG 112 >gi|314988837|gb|EFT32928.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL005PA3] Length = 216 Score = 40.2 bits (93), Expect = 0.094, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 32/63 (50%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G R+ + F KQ E +K+ WPS E+ +VV++ + + + +D GW++ Sbjct: 153 GKQRIGPVTFTKQSVAELRKVKWPSGDELGQYFLVVLVFVLLIIAYVSGLDVVFGWVVIK 212 Query: 62 ILG 64 + G Sbjct: 213 LFG 215 >gi|296131822|ref|YP_003639069.1| preprotein translocase, SecE subunit [Thermincola sp. JR] gi|296030400|gb|ADG81168.1| preprotein translocase, SecE subunit [Thermincola potens JR] Length = 118 Score = 40.2 bits (93), Expect = 0.094, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 25/55 (45%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F + E KK+ W R E++ VV++ + I V+D + ++ ++ Sbjct: 64 KFLRGAWTELKKVNWLGRKELVAFTGVVLVSVFIVGSAIFVVDTLLSKVLSLVIK 118 >gi|50843344|ref|YP_056571.1| putative SecE/Sec61-gamma subunit of protein translocation complex [Propionibacterium acnes KPA171202] gi|289424793|ref|ZP_06426575.1| preprotein translocase, SecE subunit [Propionibacterium acnes SK187] gi|289427595|ref|ZP_06429307.1| preprotein translocase, SecE subunit [Propionibacterium acnes J165] gi|295131415|ref|YP_003582078.1| preprotein translocase, SecE subunit [Propionibacterium acnes SK137] gi|50840946|gb|AAT83613.1| putative SecE/Sec61-gamma subunit of protein translocation complex [Propionibacterium acnes KPA171202] gi|289154756|gb|EFD03439.1| preprotein translocase, SecE subunit [Propionibacterium acnes SK187] gi|289159086|gb|EFD07278.1| preprotein translocase, SecE subunit [Propionibacterium acnes J165] gi|291375967|gb|ADD99821.1| preprotein translocase, SecE subunit [Propionibacterium acnes SK137] gi|313763078|gb|EFS34442.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL013PA1] gi|313773028|gb|EFS38994.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL074PA1] gi|313794085|gb|EFS42107.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL110PA1] gi|313802423|gb|EFS43648.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL110PA2] gi|313807844|gb|EFS46328.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL087PA2] gi|313812043|gb|EFS49757.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL083PA1] gi|313812130|gb|EFS49844.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL025PA1] gi|313819757|gb|EFS57471.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL036PA1] gi|313823874|gb|EFS61588.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL036PA2] gi|313827235|gb|EFS64949.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL063PA1] gi|313828435|gb|EFS66149.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL063PA2] gi|313831108|gb|EFS68822.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL007PA1] gi|313833489|gb|EFS71203.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL056PA1] gi|313838123|gb|EFS75837.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL086PA1] gi|314914563|gb|EFS78394.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL005PA4] gi|314919193|gb|EFS83024.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL050PA1] gi|314920627|gb|EFS84458.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL050PA3] gi|314924046|gb|EFS87877.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL001PA1] gi|314925734|gb|EFS89565.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL036PA3] gi|314931463|gb|EFS95294.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL067PA1] gi|314957023|gb|EFT01129.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL027PA1] gi|314957837|gb|EFT01940.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL002PA1] gi|314960678|gb|EFT04779.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL002PA2] gi|314963366|gb|EFT07466.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL082PA1] gi|314969739|gb|EFT13837.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL037PA1] gi|314974290|gb|EFT18386.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL053PA1] gi|314976939|gb|EFT21034.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL045PA1] gi|314979898|gb|EFT23992.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL072PA2] gi|314985804|gb|EFT29896.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL005PA1] gi|314988413|gb|EFT32504.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL005PA2] gi|315079792|gb|EFT51768.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL078PA1] gi|315084900|gb|EFT56876.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL027PA2] gi|315087232|gb|EFT59208.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL002PA3] gi|315088965|gb|EFT60941.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL072PA1] gi|315096812|gb|EFT68788.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL038PA1] gi|315100573|gb|EFT72549.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL046PA1] gi|315106014|gb|EFT77990.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL030PA1] gi|315109345|gb|EFT81321.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL030PA2] gi|327325646|gb|EGE67444.1| putative SecE/Sec61-gamma subunit of protein translocation complex [Propionibacterium acnes HL096PA2] gi|327328240|gb|EGE70007.1| putative SecE/Sec61-gamma subunit of protein translocation complex [Propionibacterium acnes HL096PA3] gi|327333164|gb|EGE74891.1| putative SecE/Sec61-gamma subunit of protein translocation complex [Propionibacterium acnes HL097PA1] gi|327445316|gb|EGE91970.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL043PA1] gi|327446957|gb|EGE93611.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL043PA2] gi|327449047|gb|EGE95701.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL013PA2] gi|327451393|gb|EGE98047.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL092PA1] gi|327452607|gb|EGE99261.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL087PA3] gi|327457650|gb|EGF04305.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL083PA2] gi|328751909|gb|EGF65525.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL087PA1] gi|328756945|gb|EGF70561.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL020PA1] gi|328759042|gb|EGF72658.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL025PA2] gi|328762257|gb|EGF75749.1| putative SecE/Sec61-gamma subunit of protein translocation complex [Propionibacterium acnes HL099PA1] Length = 216 Score = 40.2 bits (93), Expect = 0.094, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 32/63 (50%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G R+ + F KQ E +K+ WPS E+ +VV++ + + + +D GW++ Sbjct: 153 GKQRIGPVTFTKQSVAELRKVKWPSGDELGQYFLVVLVFVLLIIAYVSGLDVVFGWVVIK 212 Query: 62 ILG 64 + G Sbjct: 213 LFG 215 >gi|56477581|ref|YP_159170.1| preprotein translocase subunit SecE [Aromatoleum aromaticum EbN1] gi|56313624|emb|CAI08269.1| Preprotein translocase subunit SecE [Aromatoleum aromaticum EbN1] Length = 115 Score = 40.2 bits (93), Expect = 0.095, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 34/55 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F ++ E+KK+ WPSR E + + +V + + +VF V D+S+ W+++ ++ Sbjct: 57 VAFARESITETKKVVWPSRKETVQTTGLVFAFVVVMAVFLWVTDKSLEWVLYDLI 111 >gi|315605094|ref|ZP_07880146.1| preprotein translocase [Actinomyces sp. oral taxon 180 str. F0310] gi|315313201|gb|EFU61266.1| preprotein translocase [Actinomyces sp. oral taxon 180 str. F0310] Length = 98 Score = 40.2 bits (93), Expect = 0.096, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 32/57 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FFKQV DE KK+ +P+ SE +VV++ ++ +F ++D G L I G Sbjct: 42 IWLFFKQVIDEMKKVTYPTASETWTYFVVVVVFVAAIMLFAGLLDFGFGKLSALIFG 98 >gi|323358912|ref|YP_004225308.1| preprotein translocase subunit SecE [Microbacterium testaceum StLB037] gi|323275283|dbj|BAJ75428.1| preprotein translocase subunit SecE [Microbacterium testaceum StLB037] Length = 91 Score = 40.2 bits (93), Expect = 0.097, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 27/58 (46%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F +QV E +K+ P+R E++ VV+ + + +D WL + G+ Sbjct: 28 IALFIRQVFTELRKVVTPTRQELIKFTAVVLGFVVVMMALVYGLDLLFVWLTSAVFGV 85 >gi|313816876|gb|EFS54590.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL059PA1] gi|315100102|gb|EFT72078.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL059PA2] Length = 216 Score = 40.2 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 32/63 (50%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G R+ + F KQ E +K+ WPS E+ +VV++ + + + +D GW++ Sbjct: 153 GKQRIGPVTFTKQSVAELRKVKWPSGDELGQYFLVVLVFVLLIIAYVSGLDVVFGWVVIK 212 Query: 62 ILG 64 + G Sbjct: 213 LFG 215 >gi|311744841|ref|ZP_07718637.1| preprotein translocase [Aeromicrobium marinum DSM 15272] gi|311311958|gb|EFQ81879.1| preprotein translocase [Aeromicrobium marinum DSM 15272] Length = 71 Score = 40.2 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 31/61 (50%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +R A + F +QV E +K+ WP+R +V+ VV++ + + +D G M I Sbjct: 11 SRTAPVVFLRQVVAELRKVVWPTRPQVVTYFFVVLVFVMFMMAYVAGLDFVFGQAMFKIF 70 Query: 64 G 64 G Sbjct: 71 G 71 >gi|167768206|ref|ZP_02440259.1| hypothetical protein CLOSS21_02762 [Clostridium sp. SS2/1] gi|167709730|gb|EDS20309.1| hypothetical protein CLOSS21_02762 [Clostridium sp. SS2/1] gi|291560225|emb|CBL39025.1| preprotein translocase, SecE subunit, bacterial [butyrate-producing bacterium SSC/2] Length = 65 Score = 40.2 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 32/63 (50%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 N+ ++FK+++ E +I WP++ + VV+I I V V+D I + + Sbjct: 3 KTNKAKKTSWFKELKAEFNRIIWPTKERIAKETAVVVICAIIIGVIVAVLDVGIQYGIQA 62 Query: 62 ILG 64 ++G Sbjct: 63 LVG 65 >gi|110833233|ref|YP_692092.1| preprotein translocase subunit SecE [Alcanivorax borkumensis SK2] gi|110646344|emb|CAL15820.1| preprotein translocase, SecE subunit [Alcanivorax borkumensis SK2] Length = 128 Score = 40.2 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 32/52 (61%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K E +KI WP+R E L + ++V++ + I ++ V+D +G LM +++G Sbjct: 77 KDSLVELRKIVWPTRQETLQTTLIVLVFVVIVALLLFVLDWILGGLMSWVIG 128 >gi|51244963|ref|YP_064847.1| preprotein translocase secE subunit (partial length) [Desulfotalea psychrophila LSv54] gi|50876000|emb|CAG35840.1| related to preprotein translocase secE subunit (partial length) [Desulfotalea psychrophila LSv54] Length = 84 Score = 40.2 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF V+ E +I WP + L +V+++ S++ +D +G ++ ++LG Sbjct: 30 QFFLDVKTEFFRIAWPDKKMTLGLAGIVVVLTGAISLYLGSVDFILGEIVSYVLG 84 >gi|162606358|ref|XP_001713209.1| preprotein translocase secE subunit [Guillardia theta] gi|12580675|emb|CAC26993.1| preprotein translocase secE subunit [Guillardia theta] Length = 146 Score = 40.2 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 26/57 (45%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +L F ++ E K I WPS + +VVII L S F +D G+L + Sbjct: 87 NLLTFITEISYEIKNIEWPSFERLFRQFVVVIISLVFSGFFIYSVDGIFGYLSRTLF 143 >gi|159902765|ref|YP_001550109.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. MIT 9211] gi|159887941|gb|ABX08155.1| putative preprotein translocase, SecE subunit [Prochlorococcus marinus str. MIT 9211] Length = 80 Score = 40.2 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 26/53 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F DE K + WP+R ++ I VI+M+++S+ + + GW I Sbjct: 27 FLGSTIDELKLVVWPTRQQLFSESIAVILMVTLSAAAIAAVSRFYGWGASHIF 79 >gi|194476831|ref|YP_002049010.1| Preprotein translocase subunit SecE [Paulinella chromatophora] gi|171191838|gb|ACB42800.1| Preprotein translocase subunit SecE [Paulinella chromatophora] Length = 96 Score = 40.2 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF +E K + WPSR +++ +VV+ ++ +S++ +D GW + Sbjct: 43 FFVSTLEELKLVVWPSRQQIISEAVVVMAIVGLSTLAIAAVDNFYGWGSQQVF 95 >gi|116629025|ref|YP_814197.1| preprotein translocase subunit SecE [Lactobacillus gasseri ATCC 33323] gi|238853592|ref|ZP_04643961.1| preprotein translocase, SecE subunit [Lactobacillus gasseri 202-4] gi|282852729|ref|ZP_06262071.1| preprotein translocase, SecE subunit [Lactobacillus gasseri 224-1] gi|300362325|ref|ZP_07058501.1| preprotein translocase [Lactobacillus gasseri JV-V03] gi|311111180|ref|ZP_07712577.1| preprotein translocase, SecE subunit [Lactobacillus gasseri MV-22] gi|116094607|gb|ABJ59759.1| protein translocase subunit secE/sec61 gamma [Lactobacillus gasseri ATCC 33323] gi|238833736|gb|EEQ26004.1| preprotein translocase, SecE subunit [Lactobacillus gasseri 202-4] gi|282556471|gb|EFB62091.1| preprotein translocase, SecE subunit [Lactobacillus gasseri 224-1] gi|300353316|gb|EFJ69188.1| preprotein translocase [Lactobacillus gasseri JV-V03] gi|311066334|gb|EFQ46674.1| preprotein translocase, SecE subunit [Lactobacillus gasseri MV-22] Length = 56 Score = 40.2 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 22/55 (40%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK V K+ WP+ + VV+I + + ++D +L L Sbjct: 2 FKFFKSVNQTMAKVSWPTWKQNRRDTGVVVISSILFGAYLGLLDLLFSYLTQLFL 56 >gi|46200038|ref|YP_005705.1| preprotein translocase subunit SecE [Thermus thermophilus HB27] gi|55980218|ref|YP_143515.1| preprotein translocase subunit SecE [Thermus thermophilus HB8] gi|62297348|sp|P38383|SECE_THET8 RecName: Full=Preprotein translocase subunit secE gi|209447388|pdb|2ZJS|E Chain E, Crystal Structure Of Secye Translocon From Thermus Thermophilus With A Fab Fragment gi|209447404|pdb|2ZQP|E Chain E, Crystal Structure Of Secye Translocon From Thermus Thermophilus gi|21624297|dbj|BAC01133.1| preprotein translocase SecE subunit [Thermus thermophilus] gi|46197666|gb|AAS82078.1| protein translocase subunit secE [Thermus thermophilus HB27] gi|55771631|dbj|BAD70072.1| preprotein translocase SecE subunit [Thermus thermophilus HB8] Length = 60 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 26/54 (48%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + +F++ R E ++ WP+R +V+ +++ V + D +L+ + Sbjct: 6 IRYFQEARAELARVTWPTREQVVEGTQAILLFTLAFMVILGLYDTVFRFLIGLL 59 >gi|302521300|ref|ZP_07273642.1| preprotein translocase, SecE subunit [Streptomyces sp. SPB78] gi|318056664|ref|ZP_07975387.1| preprotein translocase subunit SecE [Streptomyces sp. SA3_actG] gi|318079222|ref|ZP_07986554.1| preprotein translocase subunit SecE [Streptomyces sp. SA3_actF] gi|302430195|gb|EFL02011.1| preprotein translocase, SecE subunit [Streptomyces sp. SPB78] Length = 92 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++QV E +K+ WP+R+++ VVI+ + I VID ++ G Sbjct: 39 FYRQVIAELRKVVWPTRNQLSTYTTVVIVFVVIMIGLVTVIDYGFSQAAKYVFG 92 >gi|315168711|gb|EFU12728.1| preprotein translocase, SecE subunit [Enterococcus faecalis TX1341] Length = 56 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 30/56 (53%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FF+ V DE K++ WP++ ++ +VVI + + F ++D I +IL Sbjct: 1 MKFFRSVTDEMKQVTWPTKKQLRKDTLVVIETSILFAALFFIMDTVIQTAFGWILK 56 >gi|254449087|ref|ZP_05062539.1| preprotein translocase, SecE subunit [gamma proteobacterium HTCC5015] gi|198261279|gb|EDY85572.1| preprotein translocase, SecE subunit [gamma proteobacterium HTCC5015] Length = 122 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 31/54 (57%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + R E KK+ WP+R E ++++V + + S++ L+ D GW + +LG Sbjct: 69 YLRASRAELKKVVWPTRQEAFQTLLLVAVFTGVLSLYLLLCDLLAGWGVETLLG 122 >gi|258543808|ref|ZP_05704042.1| preprotein translocase IISP family, membrane subunit [Cardiobacterium hominis ATCC 15826] gi|258520937|gb|EEV89796.1| preprotein translocase IISP family, membrane subunit [Cardiobacterium hominis ATCC 15826] Length = 125 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 35/59 (59%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 R +L+ + R E +K+ WP++ + + + +VV+++++I S+ + D + ++ +L Sbjct: 67 RTYILSLMRGARIEMRKMRWPTKDDAVKTTMVVLLLVAIFSIVLSIFDWILTSIVKALL 125 >gi|239980080|ref|ZP_04702604.1| preprotein translocase subunit SecE [Streptomyces albus J1074] gi|291451934|ref|ZP_06591324.1| translocase SecE [Streptomyces albus J1074] gi|291354883|gb|EFE81785.1| translocase SecE [Streptomyces albus J1074] Length = 93 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+RS++ VVII + I V D + +I G Sbjct: 40 FYRQIVAELRKVVWPTRSQLTTYTTVVIIFVVIMIGLVTVFDYGFSNAVKYIFG 93 >gi|33239684|ref|NP_874626.1| preprotein translocase subunit SecE [Prochlorococcus marinus subsp. marinus str. CCMP1375] gi|33237209|gb|AAP99278.1| Preprotein translocase subunit SecE [Prochlorococcus marinus subsp. marinus str. CCMP1375] Length = 80 Score = 39.8 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 26/53 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F DE K + WPSR ++ I VI+M+++S+ + + GW I Sbjct: 27 FLPSTVDELKLVVWPSRQQLFSESIAVILMVTLSAASIAAVSRFYGWGASQIF 79 >gi|260434840|ref|ZP_05788810.1| preprotein translocase, SecE subunit [Synechococcus sp. WH 8109] gi|260412714|gb|EEX06010.1| preprotein translocase, SecE subunit [Synechococcus sp. WH 8109] Length = 80 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 27/62 (43%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + F DE K + WPSR ++ I VI+M+S+S+ + + GW Sbjct: 18 AADSTKSGGFLADTVDELKLVVWPSRQQLFSESIAVILMVSLSAATIAAVSRFFGWASSQ 77 Query: 62 IL 63 + Sbjct: 78 VF 79 >gi|297192721|ref|ZP_06910119.1| secretory protein SecE [Streptomyces pristinaespiralis ATCC 25486] gi|197721623|gb|EDY65531.1| secretory protein SecE [Streptomyces pristinaespiralis ATCC 25486] Length = 95 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+++ VVII + I VID + ++ G Sbjct: 42 FYRQIVAELRKVVWPTRNQLTTYTTVVIIFVVIMIGLVTVIDYGFQEAVKYVFG 95 >gi|111018978|ref|YP_701950.1| preprotein translocase subunit SecE [Rhodococcus jostii RHA1] gi|110818508|gb|ABG93792.1| probable protein translocation complex preprotein translocase subunit [Rhodococcus jostii RHA1] Length = 150 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 29/55 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F ++V E +K+ WP+R +++ VV++ + F V+D + + ++ G Sbjct: 96 RFLREVIAELRKVIWPNRKQMITYTSVVLVFVVFMVTFIGVLDLVVIKGVTWLFG 150 >gi|262197204|ref|YP_003268413.1| preprotein translocase, SecE subunit [Haliangium ochraceum DSM 14365] gi|262080551|gb|ACY16520.1| preprotein translocase, SecE subunit [Haliangium ochraceum DSM 14365] Length = 123 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 19/53 (35%), Positives = 24/53 (45%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +V E KK+ WP EV + IVVI+M IS+ D L I G Sbjct: 71 INEVTVELKKVAWPGAKEVRQATIVVIVMTLISATILGAFDYVWANLTDIIYG 123 >gi|260890607|ref|ZP_05901870.1| e protein translocase, SecE subunit [Leptotrichia hofstadii F0254] gi|260859652|gb|EEX74152.1| e protein translocase, SecE subunit [Leptotrichia hofstadii F0254] Length = 71 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 35/59 (59%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + F +R+E KKI+WP + EV ++VI+M + +++ ++ D + +++ I Sbjct: 2 SKFNLKEVFGNLREEYKKIYWPDKIEVYHVTVIVILMTAFIALYTVLFDTAFNFVLAKI 60 >gi|304437206|ref|ZP_07397167.1| preprotein translocase [Selenomonas sp. oral taxon 149 str. 67H29BP] gi|304369868|gb|EFM23532.1| preprotein translocase [Selenomonas sp. oral taxon 149 str. 67H29BP] Length = 61 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 26/57 (45%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ F ++V E KK+ W +R E++ VV I + + + D + IL Sbjct: 3 KIVKFLREVVAEMKKVSWSTRRELVTYTGVVGIAIVVVCALIWICDTIFARIFQVIL 59 >gi|226226255|ref|YP_002760361.1| preprotein translocase SecE subunit [Gemmatimonas aurantiaca T-27] gi|226089446|dbj|BAH37891.1| preprotein translocase SecE subunit [Gemmatimonas aurantiaca T-27] Length = 77 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 29/54 (53%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 ++ F+ +V E KK+ WP R ++ + I +II + + ++D ++ L+ Sbjct: 14 TRLVTFYHEVIAEMKKVTWPDRPQLQQATIQIIIFVLVLGAVIGLVDVALQALL 67 >gi|188588856|ref|YP_001919659.1| preprotein translocase subunit SecE [Clostridium botulinum E3 str. Alaska E43] gi|251780866|ref|ZP_04823786.1| preprotein translocase, SecE subunit [Clostridium botulinum E1 str. 'BoNT E Beluga'] gi|188499137|gb|ACD52273.1| preprotein translocase, SecE subunit [Clostridium botulinum E3 str. Alaska E43] gi|243085181|gb|EES51071.1| preprotein translocase, SecE subunit [Clostridium botulinum E1 str. 'BoNT E Beluga'] Length = 76 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 27/61 (44%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +L+FF++V+ E K I WPS+ E + + V + I + +D L I Sbjct: 14 KNSGLLSFFREVKAEFKIITWPSKDETKKAFVAVGVFAIIYIILVGGLDFIFKNLFEMIF 73 Query: 64 G 64 Sbjct: 74 N 74 >gi|325299606|ref|YP_004259523.1| preprotein translocase, SecE subunit [Bacteroides salanitronis DSM 18170] gi|324319159|gb|ADY37050.1| preprotein translocase, SecE subunit [Bacteroides salanitronis DSM 18170] Length = 65 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + N+ K+ DE K+ WP+R E+ S +VV+ + ++ ++D + ++M ++ Sbjct: 4 KITNYCKESYDELVHKVSWPTRKELSSSAVVVLYASLLIALVVFLMDSAFQFIMEDVI 61 >gi|327399536|ref|YP_004340405.1| preprotein translocase subunit SecE [Hippea maritima DSM 10411] gi|327182165|gb|AEA34346.1| preprotein translocase, SecE subunit [Hippea maritima DSM 10411] Length = 60 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 VL+F ++V+ E KK+ WP + EV + I VI+ I + ++D + + + Sbjct: 3 KVLSFLEEVKIEFKKVVWPGKKEVSSATISVIVFTVIVAFVLSLLDYFLSVGLQSLFK 60 >gi|303232369|ref|ZP_07319061.1| preprotein translocase, SecE subunit [Atopobium vaginae PB189-T1-4] gi|302481453|gb|EFL44521.1| preprotein translocase, SecE subunit [Atopobium vaginae PB189-T1-4] Length = 117 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 23/52 (44%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 R L + V+ E ++ WP+++E+ I + L + + +ID Sbjct: 54 KRGRFLGYLADVKSEMHRVVWPTKAELKNYSIATVAALIVCGIATWLIDTGF 105 >gi|256821649|ref|YP_003145612.1| preprotein translocase subunit SecE [Kangiella koreensis DSM 16069] gi|256795188|gb|ACV25844.1| preprotein translocase, SecE subunit [Kangiella koreensis DSM 16069] Length = 123 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI-GWLMHF 61 A F ++ R E +K+ WP+ +E + + I+VIIM+ I +F +ID I +L+ Sbjct: 61 AKGQAFWKFAREARTELRKVIWPTSNETVKTTIMVIIMVIILGLFLALIDWLINSFLISP 120 Query: 62 ILG 64 I+G Sbjct: 121 IIG 123 >gi|254302297|ref|ZP_04969655.1| possible preprotein translocase SecE [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] gi|148322489|gb|EDK87739.1| possible preprotein translocase SecE [Fusobacterium nucleatum subsp. polymorphum ATCC 10953] Length = 58 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 33/54 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +N F++V+ E K+ WPSR+EV+ S I V+ M I S++ V D ++F+ Sbjct: 1 MNLFQKVKMEYSKVEWPSRTEVIHSTIWVVTMTVIISIYLGVFDILAVRALNFL 54 >gi|295100379|emb|CBK97924.1| preprotein translocase, SecE subunit, bacterial [Faecalibacterium prausnitzii L2-6] Length = 83 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 36/58 (62%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF+ + E KK+ WPS++++ + +VV++ ++I++V + +D G ++ I+G Sbjct: 25 NAAKFFRDTKSELKKVVWPSKADIRTNTVVVLVTVAIAAVVMIALDAIFGGILGLIIG 82 >gi|310829152|ref|YP_003961509.1| hypothetical protein ELI_3587 [Eubacterium limosum KIST612] gi|308740886|gb|ADO38546.1| hypothetical protein ELI_3587 [Eubacterium limosum KIST612] Length = 124 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 30/57 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 L+F K V E KK+ W ++ E+ S V ++I + +ID +G L ++G+ Sbjct: 67 LDFVKGVFSELKKVNWLTKEELAKSSGFVAGFVAIFTFLIWIIDSGLGALAALLIGL 123 >gi|302536234|ref|ZP_07288576.1| SecE protein [Streptomyces sp. C] gi|302445129|gb|EFL16945.1| SecE protein [Streptomyces sp. C] Length = 114 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+++ VVI+ + I VID + F+ G Sbjct: 61 FYRQIVAELRKVVWPTRNQLSTYTTVVIVFVVIMIGLVTVIDYGFQEAIKFVFG 114 >gi|254428610|ref|ZP_05042317.1| preprotein translocase, SecE subunit, putative [Alcanivorax sp. DG881] gi|196194779|gb|EDX89738.1| preprotein translocase, SecE subunit, putative [Alcanivorax sp. DG881] Length = 124 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 32/52 (61%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K E +KI WP+R E L + ++V++ + I ++ V+D +G LM +++G Sbjct: 73 KDSLVELRKIVWPTRQETLQTTLIVLVFVVIVALLLFVLDWILGGLMSWVIG 124 >gi|254881309|ref|ZP_05254019.1| predicted protein [Bacteroides sp. 4_3_47FAA] gi|319640311|ref|ZP_07995036.1| hypothetical protein HMPREF9011_00633 [Bacteroides sp. 3_1_40A] gi|254834102|gb|EET14411.1| predicted protein [Bacteroides sp. 4_3_47FAA] gi|317388086|gb|EFV68940.1| hypothetical protein HMPREF9011_00633 [Bacteroides sp. 3_1_40A] Length = 64 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V N+ K+ DE K+ WP+R E+ S +VV+ + ++ ++D + ++M I+ Sbjct: 4 KVANYCKESYDELVHKVSWPTRKELSSSAVVVLYASLLIALVVFLMDSAFQFVMEDII 61 >gi|33866875|ref|NP_898434.1| preprotein translocase subunit SecE [Synechococcus sp. WH 8102] gi|33639476|emb|CAE08860.1| putative preprotein translocase, SecE subunit [Synechococcus sp. WH 8102] Length = 80 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 27/57 (47%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A F DE K + WPSR ++ I VI+M+S+S+ + + GW + Sbjct: 23 APRGFLPATVDELKLVVWPSRQQLFSESIAVILMVSLSAAGIAAVSRFFGWASSQVF 79 >gi|19705333|ref|NP_602828.1| protein translocase subunit SecE [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gi|296329160|ref|ZP_06871662.1| preprotein translocase [Fusobacterium nucleatum subsp. nucleatum ATCC 23726] gi|19713310|gb|AAL94127.1| Protein translocase subunit SecE [Fusobacterium nucleatum subsp. nucleatum ATCC 25586] gi|296153734|gb|EFG94550.1| preprotein translocase [Fusobacterium nucleatum subsp. nucleatum ATCC 23726] Length = 58 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 33/54 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +N F++V+ E K+ WPSR+EV+ S + V+ M + S++ + D ++F+ Sbjct: 1 MNLFQKVKMEYSKVEWPSRTEVIHSTLWVVTMTVLVSIYLGIFDILAVRALNFL 54 >gi|297184779|gb|ADI20889.1| hypothetical protein [uncultured gamma proteobacterium EB080_L93H08] Length = 71 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 9/38 (23%), Positives = 21/38 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSV 46 +F + R E +K+ WP++ E + + + V + + I + Sbjct: 16 WDFLQGSRVEIRKVIWPTKQETIQTTLTVFVFVLILGI 53 >gi|241890073|ref|ZP_04777371.1| preprotein translocase, SecE subunit [Gemella haemolysans ATCC 10379] gi|241863695|gb|EER68079.1| preprotein translocase, SecE subunit [Gemella haemolysans ATCC 10379] Length = 57 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 30/52 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + F K V E +K+ WP+ SE++ ++VI+++ I +F V+D I + Sbjct: 2 IRFLKNVATEMRKVSWPTFSELVRKTLIVIVVVGILMLFSYVVDLGITAGIR 53 >gi|227486737|ref|ZP_03917053.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Anaerococcus lactolyticus ATCC 51172] gi|227235325|gb|EEI85340.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Anaerococcus lactolyticus ATCC 51172] Length = 60 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 28/53 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF V E KKI WP + L ++VI + + + V V+D+ +L+ IL Sbjct: 8 FFAGVSKEYKKIQWPVKKTTLEYTLIVIAISATTGVAIWVLDKIFHFLLSTIL 60 >gi|34762877|ref|ZP_00143860.1| PROTEIN TRANSLOCASE SUBUNIT SECE [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gi|237740929|ref|ZP_04571410.1| protein translocase subunit sece [Fusobacterium sp. 4_1_13] gi|256846756|ref|ZP_05552212.1| preprotein translocase, SecE subunit [Fusobacterium sp. 3_1_36A2] gi|294784293|ref|ZP_06749587.1| preprotein translocase, SecE subunit [Fusobacterium sp. 3_1_27] gi|27887441|gb|EAA24528.1| PROTEIN TRANSLOCASE SUBUNIT SECE [Fusobacterium nucleatum subsp. vincentii ATCC 49256] gi|229430973|gb|EEO41185.1| protein translocase subunit sece [Fusobacterium sp. 4_1_13] gi|256717976|gb|EEU31533.1| preprotein translocase, SecE subunit [Fusobacterium sp. 3_1_36A2] gi|294488049|gb|EFG35401.1| preprotein translocase, SecE subunit [Fusobacterium sp. 3_1_27] Length = 58 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 33/54 (61%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +N F++V+ E K+ WPSR+EV+ S + V+ M + S++ V D ++F+ Sbjct: 1 MNLFQKVKMEYSKVEWPSRTEVIHSTLWVVTMTVLVSIYLGVFDILAVRALNFL 54 >gi|296395108|ref|YP_003659992.1| preprotein translocase subunit SecE [Segniliparus rotundus DSM 44985] gi|296182255|gb|ADG99161.1| preprotein translocase, SecE subunit [Segniliparus rotundus DSM 44985] Length = 163 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 33/58 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 AV+ F ++V E K+ WP R +++ ++VI+ +++ F ++D L ++LG Sbjct: 106 AVVQFLREVVGELSKVIWPQRRQMVSYTLIVIVFVAVVVSFVALLDIGFAKLALWLLG 163 >gi|329767077|ref|ZP_08258605.1| preprotein translocase [Gemella haemolysans M341] gi|328837802|gb|EGF87427.1| preprotein translocase [Gemella haemolysans M341] Length = 57 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 29/52 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + F K V E K+ WP+ SE++ ++VII++ I +F V+D I + Sbjct: 2 IRFLKNVVAEMHKVSWPTFSELVRKTLIVIIVVGILMLFSYVVDLGITAGIR 53 >gi|300742101|ref|ZP_07072122.1| preprotein translocase, SecE subunit [Rothia dentocariosa M567] gi|311112019|ref|YP_003983241.1| preprotein translocase [Rothia dentocariosa ATCC 17931] gi|300381286|gb|EFJ77848.1| preprotein translocase, SecE subunit [Rothia dentocariosa M567] gi|310943513|gb|ADP39807.1| preprotein translocase [Rothia dentocariosa ATCC 17931] Length = 93 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 26/58 (44%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 F ++V E KK+ P+R E+ + V+ + +F +D G ++ G G Sbjct: 27 FRFLREVISELKKVTTPTRKELAIYFFGVLFFVVFMILFISGLDWVFGQGSFWVFGNG 84 >gi|315037589|ref|YP_004031157.1| preprotein translocase subunit SecE [Lactobacillus amylovorus GRL 1112] gi|325956071|ref|YP_004286681.1| preprotein translocase subunit SecE [Lactobacillus acidophilus 30SC] gi|312275722|gb|ADQ58362.1| preprotein translocase subunit SecE [Lactobacillus amylovorus GRL 1112] gi|325332636|gb|ADZ06544.1| preprotein translocase subunit SecE [Lactobacillus acidophilus 30SC] gi|327182885|gb|AEA31332.1| preprotein translocase subunit SecE [Lactobacillus amylovorus GRL 1118] Length = 56 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FFK V E K + WPS + +VI + + + +D WL I+ Sbjct: 2 IKFFKSVAQEMKMVTWPSAKQNRHDTAIVITSSILFAAYLGALDWLFSWLTQRIM 56 >gi|257784978|ref|YP_003180195.1| preprotein translocase, SecE subunit [Atopobium parvulum DSM 20469] gi|257473485|gb|ACV51604.1| preprotein translocase, SecE subunit [Atopobium parvulum DSM 20469] Length = 120 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 25/55 (45%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 +F VR E ++ WPS SE+ + VI + + ++D I + G+ Sbjct: 64 YFAGVRTEMHRVVWPSSSELAGFSVAVIATIVFFGLVTWLVDTGIVAGLVAFTGL 118 >gi|296126977|ref|YP_003634229.1| preprotein translocase, SecE subunit [Brachyspira murdochii DSM 12563] gi|296018793|gb|ADG72030.1| preprotein translocase, SecE subunit [Brachyspira murdochii DSM 12563] Length = 106 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Query: 4 NRLAVLNFFKQVRDES-KKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + + LN ++++ E ++ WP+R +V+ +VVI++L +S F D + +++ + Sbjct: 5 KKNSFLNSIQEIKKELFERSVWPTRQDVINQTVVVIVLLIAASAFLGAADYVVTFVVRAL 64 Query: 63 L 63 L Sbjct: 65 L 65 >gi|297625759|ref|YP_003687522.1| SecE/Sec61-gamma subunit of protein translocation complex [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] gi|296921524|emb|CBL56078.1| SecE/Sec61-gamma subunit of protein translocation complex [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] Length = 195 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 10/68 (14%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEV-----LVSVIVVIIMLSISSVFFLVIDQSIG 56 G R + F KQ E KK+ WP+ + +V V V+ IM ++ + D + Sbjct: 133 GHKRAGPITFTKQSVGELKKVVWPTGEQTGQYFVVVLVFVLFIMAVVAGL-----DFGLT 187 Query: 57 WLMHFILG 64 L+ ++ G Sbjct: 188 RLLLWLFG 195 >gi|169837421|ref|ZP_02870609.1| hypothetical protein cdivTM_10033 [candidate division TM7 single-cell isolate TM7a] Length = 71 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 35/59 (59%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ + + +R+E KKI+WP + E+ ++VI+M + +++ L+ D + +++ I Sbjct: 2 SKFNLKDAIGNLREEYKKIYWPDKIEIYHVTVIVILMTAFIAIYTLLFDTAFNFVLAKI 60 >gi|307543812|ref|YP_003896291.1| preprotein translocase subunit SecE [Halomonas elongata DSM 2581] gi|307215836|emb|CBV41106.1| preprotein translocase subunit SecE [Halomonas elongata DSM 2581] Length = 122 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 32/61 (52%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +L + + E +++ WP+R E + + +V++ + + + +ID +GW M ++ Sbjct: 62 KGRELLELARNAKKEIQRVVWPTRPETIQTTAIVLVAVLVVGLVLWLIDTLLGWAMSGVI 121 Query: 64 G 64 G Sbjct: 122 G 122 >gi|304310003|ref|YP_003809601.1| Protein translocase subunit [gamma proteobacterium HdN1] gi|301795736|emb|CBL43935.1| Protein translocase subunit [gamma proteobacterium HdN1] Length = 123 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 31/53 (58%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K R E K++ WP++ E + +V++++ +S++ ID +G + F++G Sbjct: 71 VKDSRVELKRVVWPTKQETWSTSAIVLVVVVVSALILWGIDYLLGSSVSFLMG 123 >gi|121997662|ref|YP_001002449.1| preprotein translocase subunit SecE [Halorhodospira halophila SL1] gi|121589067|gb|ABM61647.1| protein translocase subunit secE/sec61 gamma [Halorhodospira halophila SL1] Length = 136 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 36/60 (60%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 +V +F + + E +K+ WP+R E L + ++V ++ I ++F ++D + WL+ I G G Sbjct: 76 SVWSFAQGAKQEVRKVVWPTRQETLQTTLIVAAVVIIVAIFLWLMDLLLLWLVGMITGHG 135 >gi|212695318|ref|ZP_03303446.1| hypothetical protein BACDOR_04858 [Bacteroides dorei DSM 17855] gi|237711660|ref|ZP_04542141.1| predicted protein [Bacteroides sp. 9_1_42FAA] gi|237725898|ref|ZP_04556379.1| predicted protein [Bacteroides sp. D4] gi|265753080|ref|ZP_06088649.1| preprotein translocase, SecE subunit [Bacteroides sp. 3_1_33FAA] gi|212662228|gb|EEB22802.1| hypothetical protein BACDOR_04858 [Bacteroides dorei DSM 17855] gi|229435706|gb|EEO45783.1| predicted protein [Bacteroides dorei 5_1_36/D4] gi|229454355|gb|EEO60076.1| predicted protein [Bacteroides sp. 9_1_42FAA] gi|263236266|gb|EEZ21761.1| preprotein translocase, SecE subunit [Bacteroides sp. 3_1_33FAA] Length = 64 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V N+ K+ DE K+ WP+R E+ S +VV+ + ++ ++D ++M I+ Sbjct: 4 KVANYCKESYDELVHKVSWPTRKELSSSAVVVLYASLLIALVVFLMDSVFQFVMEDII 61 >gi|297618399|ref|YP_003703558.1| preprotein translocase, SecE subunit [Syntrophothermus lipocalidus DSM 12680] gi|297146236|gb|ADI02993.1| preprotein translocase, SecE subunit [Syntrophothermus lipocalidus DSM 12680] Length = 75 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 27/43 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 ++ + V +E KK+ WP+R++++ VV+I +++ +V D Sbjct: 18 DYLRGVYNELKKVHWPNRNQLVAYTAVVLISVALVAVIIWAFD 60 >gi|160881813|ref|YP_001560781.1| preprotein translocase, SecE subunit [Clostridium phytofermentans ISDg] gi|160430479|gb|ABX44042.1| preprotein translocase, SecE subunit [Clostridium phytofermentans ISDg] Length = 76 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 29/52 (55%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FK ++ E KKI WP + + + V+++ +I ++ ++DQ + + IL Sbjct: 25 FKGLKSEFKKIIWPDKESLAKQTVAVVVISTILAIVIGIVDQIVKLGIKIIL 76 >gi|71275253|ref|ZP_00651540.1| SecE subunit of protein translocation complex [Xylella fastidiosa Dixon] gi|170731252|ref|YP_001776685.1| preprotein translocase subunit SecE [Xylella fastidiosa M12] gi|71164062|gb|EAO13777.1| SecE subunit of protein translocation complex [Xylella fastidiosa Dixon] gi|167966045|gb|ACA13055.1| preprotein translocase SecE subunit [Xylella fastidiosa M12] Length = 135 Score = 39.0 bits (90), Expect = 0.19, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F + R E +K+ WP+R E + VVI+M++I S+ D I L + L Sbjct: 81 FLFESRFELRKVVWPTRQEAIRMTWVVIVMITILSLLLGGFDFVIQKLTQWFLS 134 >gi|331001618|ref|ZP_08325141.1| preprotein translocase [Lachnospiraceae oral taxon 107 str. F0167] gi|330413339|gb|EGG92706.1| preprotein translocase [Lachnospiraceae oral taxon 107 str. F0167] Length = 65 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + +F ++ E KKI WP++ +++ I VI + + ++D L++F++ Sbjct: 8 KISDFLNGIKAEFKKIVWPNKDDIVKQTIAVISSSIVLGIIISILDFIFKILLNFVIK 65 >gi|307718194|ref|YP_003873726.1| hypothetical protein STHERM_c04840 [Spirochaeta thermophila DSM 6192] gi|306531919|gb|ADN01453.1| hypothetical protein STHERM_c04840 [Spirochaeta thermophila DSM 6192] gi|315186343|gb|EFU20104.1| preprotein translocase, SecE subunit [Spirochaeta thermophila DSM 6578] Length = 59 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ FFK V E K++ WPS +V S VVI+ ++I ++ +D + +L+ I Sbjct: 3 KIIQFFKDVWAEMKRVTWPSWEDVQGSTQVVIVSVAIFALVLGAVDLLLLFLLDVIF 59 >gi|154503735|ref|ZP_02040795.1| hypothetical protein RUMGNA_01559 [Ruminococcus gnavus ATCC 29149] gi|153795835|gb|EDN78255.1| hypothetical protein RUMGNA_01559 [Ruminococcus gnavus ATCC 29149] Length = 69 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 30/63 (47%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + ++FK ++ E KKI WP ++ + V+I+ + VID + + + F Sbjct: 7 KAEKAQKSSWFKGMKAEFKKIVWPDKNTLAKQTAAVVIVSVLMGALISVIDVLMKYGIDF 66 Query: 62 ILG 64 ++ Sbjct: 67 LIK 69 >gi|61242546|sp|P0A4G9|SECE_STRLI RecName: Full=Preprotein translocase subunit secE gi|971287|dbj|BAA06984.1| secE [Streptomyces coelicolor A3(2)] gi|3493238|gb|AAC33325.1| protein translocase [Streptomyces lividans TK24] Length = 94 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ + +K+ WPSR+++ VVII + I +ID ++ G Sbjct: 41 FYRQIVADVRKVVWPSRNQLTTYTTVVIIFVVIMIGLVTLIDYGFSHAAKYVFG 94 >gi|221632692|ref|YP_002521913.1| preprotein translocase [Thermomicrobium roseum DSM 5159] gi|221155452|gb|ACM04579.1| preprotein translocase [Thermomicrobium roseum DSM 5159] Length = 89 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 24/54 (44%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 +R E +KI WP R ++VI + ++ + +D L + + G+ Sbjct: 36 IADLRSEWRKITWPDRETTRKLTLLVIGLATVLGLILGAVDAIFVRLWNLLGGL 89 >gi|104774464|ref|YP_619444.1| preprotein translocase subunit SecE [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] gi|116514568|ref|YP_813474.1| preprotein translocase subunit SecE [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] gi|103423545|emb|CAI98457.1| Preprotein translocase secE subunit [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] gi|116093883|gb|ABJ59036.1| protein translocase subunit secE/sec61 gamma [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] gi|325126277|gb|ADY85607.1| Hypothetical conserved protein [Lactobacillus delbrueckii subsp. bulgaricus 2038] Length = 56 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FFK V E K + WPS E V++ ++F +D + L+ +L Sbjct: 2 IKFFKSVGQEMKLVHWPSAKENRRDTANVVVTSLFYAIFLGSLDWAFAKLIQLVL 56 >gi|259047920|ref|ZP_05738321.1| conserved domain protein [Granulicatella adiacens ATCC 49175] gi|259035417|gb|EEW36672.1| conserved domain protein [Granulicatella adiacens ATCC 49175] Length = 56 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 30/56 (53%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F V E KK+ WP+ EV I VII + ++ FF V+D I L+ F+L Sbjct: 1 MRFLSNVFKEMKKVTWPTGKEVNKYTITVIITVVVALGFFAVVDYGIHQLITFLLK 56 >gi|256852095|ref|ZP_05557482.1| preprotein translocase, SecE subunit [Lactobacillus jensenii 27-2-CHN] gi|260661335|ref|ZP_05862248.1| preprotein translocase, SecE subunit [Lactobacillus jensenii 115-3-CHN] gi|282934887|ref|ZP_06340119.1| preprotein translocase, SecE subunit [Lactobacillus jensenii 208-1] gi|297205030|ref|ZP_06922426.1| preprotein translocase [Lactobacillus jensenii JV-V16] gi|256615507|gb|EEU20697.1| preprotein translocase, SecE subunit [Lactobacillus jensenii 27-2-CHN] gi|260547790|gb|EEX23767.1| preprotein translocase, SecE subunit [Lactobacillus jensenii 115-3-CHN] gi|281301068|gb|EFA93380.1| preprotein translocase, SecE subunit [Lactobacillus jensenii 208-1] gi|297149608|gb|EFH29905.1| preprotein translocase [Lactobacillus jensenii JV-V16] Length = 56 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK V E KK+ WP+ + VI+ + ++F +D + L Sbjct: 2 FKFFKSVGQEMKKVTWPTAKQNRRDTTTVIVTSVLFALFLGALDWAFSTLTQMTF 56 >gi|325271152|ref|ZP_08137708.1| preprotein translocase subunit SecE [Pseudomonas sp. TJI-51] gi|324103704|gb|EGC00995.1| preprotein translocase subunit SecE [Pseudomonas sp. TJI-51] Length = 122 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 32/62 (51%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GW + I Sbjct: 61 AKGKSFFTLAKEARAEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWAVSLI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|253581635|ref|ZP_04858859.1| protein translocase subunit sece [Fusobacterium varium ATCC 27725] gi|257470017|ref|ZP_05634109.1| protein translocase subunit SecE [Fusobacterium ulcerans ATCC 49185] gi|317064242|ref|ZP_07928727.1| protein translocase subunit sece [Fusobacterium ulcerans ATCC 49185] gi|251835984|gb|EES64521.1| protein translocase subunit sece [Fusobacterium varium ATCC 27725] gi|313689918|gb|EFS26753.1| protein translocase subunit sece [Fusobacterium ulcerans ATCC 49185] Length = 60 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 32/57 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 +N F+ ++ E K+ WP + E++ S + VI+M + SV+ V D L+ ++ + Sbjct: 1 MNLFQGIKMEYSKVQWPKKEEIVNSTLWVIVMSLVLSVYLGVFDLIASRLLKVLVSL 57 >gi|237797419|ref|ZP_04585880.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. oryzae str. 1_6] gi|330962538|gb|EGH62798.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. maculicola str. ES4326] gi|331020269|gb|EGI00326.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. oryzae str. 1_6] Length = 122 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 32/52 (61%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GWL+ I+G Sbjct: 71 KEARAEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSLIVG 122 >gi|311087526|gb|ADP67605.1| preprotein translocase subunit SecE [Buchnera aphidicola str. JF98 (Acyrthosiphon pisum)] Length = 127 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 28/62 (45%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +L + + E +KI WP E L + ++VI + S ID I L+ FI+ Sbjct: 64 KGKDILLYIVMSKKEMQKIIWPKYKETLYTTLIVISVTIFISFILWSIDSVIFRLIAFII 123 Query: 64 GI 65 + Sbjct: 124 SL 125 >gi|239943559|ref|ZP_04695496.1| preprotein translocase subunit SecE [Streptomyces roseosporus NRRL 15998] gi|239990012|ref|ZP_04710676.1| preprotein translocase subunit SecE [Streptomyces roseosporus NRRL 11379] Length = 95 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+RS++ VVI+ + + V+D ++ ++ G Sbjct: 42 FYRQIVAELRKVVWPTRSQLTTYTSVVIVFVVVMIGLVTVLDMGFARVVKYVFG 95 >gi|28867841|ref|NP_790460.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. tomato str. DC3000] gi|213969201|ref|ZP_03397339.1| preprotein translocase, SecE subunit [Pseudomonas syringae pv. tomato T1] gi|301381708|ref|ZP_07230126.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. tomato Max13] gi|302062646|ref|ZP_07254187.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. tomato K40] gi|302130767|ref|ZP_07256757.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. tomato NCPPB 1108] gi|28851077|gb|AAO54155.1| preprotein translocase, SecE subunit [Pseudomonas syringae pv. tomato str. DC3000] gi|213925879|gb|EEB59436.1| preprotein translocase, SecE subunit [Pseudomonas syringae pv. tomato T1] gi|331018147|gb|EGH98203.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. lachrymans str. M302278PT] Length = 122 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 13 KQVRDESKKIFWPSRSEVLVSV 34 K+ R E +K+ WP+R E + Sbjct: 71 KEARAEIRKVVWPTRQETTQTT 92 >gi|21672334|ref|NP_660401.1| preprotein translocase subunit SecE [Buchnera aphidicola str. Sg (Schizaphis graminum)] gi|25009250|sp|Q8KA64|SECE_BUCAP RecName: Full=Preprotein translocase subunit secE gi|21622936|gb|AAM67612.1| preprotein translocase SecE subunit [Buchnera aphidicola str. Sg (Schizaphis graminum)] Length = 127 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 29/59 (49%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 V + ++E KKI WP E L + ++I + + S+ +D I L+ FI+ + Sbjct: 67 NVFVYINASKNEMKKITWPQYKETLYTTFIIISVTILISLLLWGLDSIIFRLIAFIISV 125 >gi|219681426|ref|YP_002467811.1| preprotein translocase SecE subunit [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)] gi|219681982|ref|YP_002468366.1| preprotein translocase SecE subunit [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)] gi|257471101|ref|ZP_05635100.1| preprotein translocase subunit SecE [Buchnera aphidicola str. LSR1 (Acyrthosiphon pisum)] gi|219621715|gb|ACL29871.1| preprotein translocase SecE subunit [Buchnera aphidicola str. Tuc7 (Acyrthosiphon pisum)] gi|219624269|gb|ACL30424.1| preprotein translocase SecE subunit [Buchnera aphidicola str. 5A (Acyrthosiphon pisum)] gi|311085788|gb|ADP65870.1| preprotein translocase subunit SecE [Buchnera aphidicola str. LL01 (Acyrthosiphon pisum)] gi|311086363|gb|ADP66444.1| preprotein translocase subunit SecE [Buchnera aphidicola str. TLW03 (Acyrthosiphon pisum)] gi|311086941|gb|ADP67021.1| preprotein translocase subunit SecE [Buchnera aphidicola str. JF99 (Acyrthosiphon pisum)] Length = 127 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 28/62 (45%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +L + + E +KI WP E L + ++VI + S ID I L+ FI+ Sbjct: 64 KGKDILLYIVMSKKEMQKIIWPKYKETLYTTLIVISVTIFISFILWSIDSVIFRLIAFII 123 Query: 64 GI 65 + Sbjct: 124 SL 125 >gi|328884385|emb|CCA57624.1| Preprotein translocase subunit SecE [Streptomyces venezuelae ATCC 10712] Length = 95 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+RS++ VVI+ + I VID + ++ G Sbjct: 42 FYRQIVAELRKVVWPTRSQLSTYTTVVIVFVVIMIGLVTVIDYGFQEAVKYVFG 95 >gi|329769658|ref|ZP_08261062.1| preprotein translocase [Gemella sanguinis M325] gi|328838413|gb|EGF88022.1| preprotein translocase [Gemella sanguinis M325] Length = 57 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 28/52 (53%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 F +V E +K+ WP+ +E++ ++VI+++ I +F +D I + Sbjct: 2 FKFLGKVAAEMRKVSWPTFNELVRKTVIVIVVVGILMLFCYAVDLGITAGIR 53 >gi|42518503|ref|NP_964433.1| preprotein translocase subunit SecE [Lactobacillus johnsonii NCC 533] gi|227888785|ref|ZP_04006590.1| preprotein translocase subunit SecE [Lactobacillus johnsonii ATCC 33200] gi|268318922|ref|YP_003292578.1| preprotein translocase SecE subunit [Lactobacillus johnsonii FI9785] gi|41582788|gb|AAS08399.1| preprotein translocase SecE subunit [Lactobacillus johnsonii NCC 533] gi|227850622|gb|EEJ60708.1| preprotein translocase subunit SecE [Lactobacillus johnsonii ATCC 33200] gi|262397297|emb|CAX66311.1| preprotein translocase SecE subunit [Lactobacillus johnsonii FI9785] gi|329666773|gb|AEB92721.1| preprotein translocase SecE subunit [Lactobacillus johnsonii DPC 6026] Length = 56 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 21/55 (38%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K V K+ WP+ + VVII + + ++D +L L Sbjct: 2 FKFIKSVNQTMAKVSWPTWKQNRRDTGVVIISSILFGAYLGLLDLLFSYLTQMFL 56 >gi|225376338|ref|ZP_03753559.1| hypothetical protein ROSEINA2194_01979 [Roseburia inulinivorans DSM 16841] gi|225211714|gb|EEG94068.1| hypothetical protein ROSEINA2194_01979 [Roseburia inulinivorans DSM 16841] Length = 82 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 25/54 (46%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F ++ E KI WP + + V+ + + ++D I + + F++G+ Sbjct: 27 FTGLKAEFNKIIWPDKQSLARQTGAVVATSVVLGLVIALLDFLIQYGVDFLVGL 80 >gi|295837049|ref|ZP_06823982.1| preprotein translocase subunit SecE [Streptomyces sp. SPB74] gi|197698950|gb|EDY45883.1| preprotein translocase subunit SecE [Streptomyces sp. SPB74] Length = 92 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 27/54 (50%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++QV E +K+ WP+R ++ VVI+ + I V+D ++ G Sbjct: 39 FYRQVIAELRKVVWPTRGQLSTYTTVVIVFVVIMIGLVTVVDYGFSQAAKYVFG 92 >gi|66047788|ref|YP_237629.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. syringae B728a] gi|71735170|ref|YP_276719.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. phaseolicola 1448A] gi|257483172|ref|ZP_05637213.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. tabaci ATCC 11528] gi|289623862|ref|ZP_06456816.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. aesculi str. NCPPB3681] gi|289648955|ref|ZP_06480298.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. aesculi str. 2250] gi|289675472|ref|ZP_06496362.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. syringae FF5] gi|298489109|ref|ZP_07007131.1| preprotein translocase subunit [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|302189264|ref|ZP_07265937.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. syringae 642] gi|63258495|gb|AAY39591.1| SecE subunit of protein translocation complex [Pseudomonas syringae pv. syringae B728a] gi|71555723|gb|AAZ34934.1| preprotein translocase, SecE subunit [Pseudomonas syringae pv. phaseolicola 1448A] gi|298156421|gb|EFH97519.1| preprotein translocase subunit [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|320322335|gb|EFW78429.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. glycinea str. B076] gi|320331993|gb|EFW87929.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. glycinea str. race 4] gi|330869444|gb|EGH04153.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. aesculi str. 0893_23] gi|330879350|gb|EGH13499.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. glycinea str. race 4] gi|330891944|gb|EGH24605.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. mori str. 301020] gi|330899749|gb|EGH31168.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. japonica str. M301072PT] gi|330940868|gb|EGH43827.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. pisi str. 1704B] gi|330969835|gb|EGH69901.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. aceris str. M302273PT] gi|330988295|gb|EGH86398.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. lachrymans str. M301315] gi|331012399|gb|EGH92455.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. tabaci ATCC 11528] Length = 122 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 32/52 (61%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GWL+ I+G Sbjct: 71 KEARAEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSLIVG 122 >gi|198277430|ref|ZP_03209961.1| hypothetical protein BACPLE_03649 [Bacteroides plebeius DSM 17135] gi|198269928|gb|EDY94198.1| hypothetical protein BACPLE_03649 [Bacteroides plebeius DSM 17135] Length = 64 Score = 38.6 bits (89), Expect = 0.25, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 6 LAVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + N+ K+ DE K+ WP+RSE+ S +VV+ + ++ ++D + ++M ++ Sbjct: 3 TKITNYCKESYDELVHKVSWPTRSELSSSAVVVLTASLLIALVVFLMDSAFQFIMEDVI 61 >gi|116617396|ref|YP_817767.1| protein translocase subunit secE/sec61 gamma [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] gi|116096243|gb|ABJ61394.1| protein translocase subunit secE/sec61 gamma [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] Length = 58 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 27/56 (48%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +N+FK V E K + W + + I VI + I ++F +D + +F+L Sbjct: 2 INYFKNVAQEMKNVTWLTGEQTSKETITVITVSIIFALFLGGVDWLLQQGFNFLLA 57 >gi|300812639|ref|ZP_07093051.1| preprotein translocase, SecE subunit [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] gi|300496369|gb|EFK31479.1| preprotein translocase, SecE subunit [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] Length = 56 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FFK V E K WPS E V++ + ++F +D + L+ +L Sbjct: 2 IKFFKSVGQEMKLSHWPSAKENRRDTANVVVTSLLYAIFLGALDWAFAKLIQLVL 56 >gi|299541912|ref|ZP_07052235.1| transcription antitermination protein NusG [Lysinibacillus fusiformis ZC1] gi|298725650|gb|EFI66291.1| transcription antitermination protein NusG [Lysinibacillus fusiformis ZC1] Length = 61 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 31/59 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + +FF V E +K WP E+ +VVI + I ++FF+++D I L + L + Sbjct: 3 KIKSFFSDVMSEMRKTSWPKSKELTKYTVVVISTVVIMALFFVLVDLGISSLFRWYLDL 61 >gi|15839228|ref|NP_299916.1| preprotein translocase subunit SecE [Xylella fastidiosa 9a5c] gi|9107870|gb|AAF85436.1|AE004071_4 preprotein translocase subunit [Xylella fastidiosa 9a5c] Length = 135 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F + R E +K+ WP+R E + VVI+M++I S+ D I L + L Sbjct: 81 FLFESRFELRKVVWPTRQEAIRITWVVIVMITILSLLLGGFDFVIQKLTQWFLS 134 >gi|311693258|gb|ADP96131.1| SecE subunit of protein translocation complex [marine bacterium HP15] Length = 122 Score = 38.6 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 31/56 (55%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ R E +K+ WP+R E++ + +V++ + + ++ +D I WL+ +G Sbjct: 67 ATLLKEARVEIRKVVWPTRPELVQTTAIVVVFVLVVALLLWGMDSLISWLVAGFIG 122 >gi|183221360|ref|YP_001839356.1| preprotein translocase subunit SecE [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] gi|189911453|ref|YP_001963008.1| preprotein translocase subunit SecE [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] gi|167776129|gb|ABZ94430.1| Preprotein translocase, SecE subunit [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] gi|167779782|gb|ABZ98080.1| Preprotein translocase SecE subunit [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] Length = 62 Score = 38.6 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 34/61 (55%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + +F ++ + E +K+ WP+R EV+ S +VV++ + I S+F D L+ + + Sbjct: 1 MKATSFIQECKAELEKVHWPTRQEVVSSTVVVLVTVFIFSLFLSASDFVFLKLLKWFWAL 60 Query: 66 G 66 G Sbjct: 61 G 61 >gi|182436669|ref|YP_001824388.1| preprotein translocase subunit SecE [Streptomyces griseus subsp. griseus NBRC 13350] gi|326777291|ref|ZP_08236556.1| preprotein translocase, SecE subunit [Streptomyces cf. griseus XylebKG-1] gi|178465185|dbj|BAG19705.1| putative preprotein translocase SecE [Streptomyces griseus subsp. griseus NBRC 13350] gi|326657624|gb|EGE42470.1| preprotein translocase, SecE subunit [Streptomyces cf. griseus XylebKG-1] Length = 95 Score = 38.6 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+RS++ VVI+ + + V+D ++ ++ G Sbjct: 42 FYRQIVAELRKVVWPTRSQLTTYTSVVIVFVVVMIGLVTVLDMGFARVVKYVFG 95 >gi|257413232|ref|ZP_04742421.2| conserved domain protein [Roseburia intestinalis L1-82] gi|257204194|gb|EEV02479.1| conserved domain protein [Roseburia intestinalis L1-82] Length = 95 Score = 38.6 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 12/48 (25%), Positives = 25/48 (52%) Query: 17 DESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 E KKI WP + ++ VI + + + ++D +I + + F++G Sbjct: 45 AEFKKIIWPEKQSLVRQTTAVIAVSVVLGLIIALLDFAIQYGVDFLVG 92 >gi|327438256|dbj|BAK14621.1| preprotein translocase subunit SecE [Solibacillus silvestris StLB046] Length = 61 Score = 38.6 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 30/59 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 V NF ++V E +K WP E+ +VV+ + + ++FF ID I L + L + Sbjct: 3 KVTNFLQEVGSEMRKTSWPKSKELTKYTVVVVSTVIVMALFFTAIDLGISELFRWFLSL 61 >gi|300932757|ref|ZP_07148013.1| preprotein translocase subunit SecE [Corynebacterium resistens DSM 45100] Length = 112 Score = 38.6 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+++FF+ V E K+ WP+ E+++ IVV++ L + + +D LM I Sbjct: 55 AIVDFFRGVVREMSKVIWPTGREMVMYTIVVLVFLVLLTTLVGGVDYLTSLLMGAIF 111 >gi|329944008|ref|ZP_08292276.1| preprotein translocase, SecE subunit [Actinomyces sp. oral taxon 170 str. F0386] gi|328531209|gb|EGF58055.1| preprotein translocase, SecE subunit [Actinomyces sp. oral taxon 170 str. F0386] Length = 77 Score = 38.6 bits (89), Expect = 0.31, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QV DE +K+ WP+ +E+ VV++ + F V+D + + ++ Sbjct: 21 IALFIRQVIDELRKVVWPTMNELWTYFTVVVVFIVAIMAFTGVLDFAFNRAVMWLFA 77 >gi|295397926|ref|ZP_06807983.1| preprotein translocase [Aerococcus viridans ATCC 11563] gi|294973811|gb|EFG49581.1| preprotein translocase [Aerococcus viridans ATCC 11563] Length = 57 Score = 38.6 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 27/57 (47%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F K V E + WPS E++ +V+ + + ++F +ID W + + + Sbjct: 1 MQFLKDVWHEMRLTTWPSGGELVRYTGIVLSTIIMVAIFLGIIDTLAQWAFAWFINL 57 >gi|256830551|ref|YP_003159279.1| preprotein translocase, SecE subunit [Desulfomicrobium baculatum DSM 4028] gi|256579727|gb|ACU90863.1| preprotein translocase, SecE subunit [Desulfomicrobium baculatum DSM 4028] Length = 77 Score = 38.3 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 31/54 (57%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FF Q + E KK+ WP + E + + V++++ + ++F V+D + ++ +L Sbjct: 24 FFDQAKVELKKVVWPDKQETISTSSAVLLLVVVMALFLGVVDLVLTKIIAAVLS 77 >gi|238855650|ref|ZP_04645950.1| preprotein translocase, SecE subunit [Lactobacillus jensenii 269-3] gi|260664909|ref|ZP_05865760.1| preprotein translocase, SecE subunit [Lactobacillus jensenii SJ-7A-US] gi|282933599|ref|ZP_06338968.1| preprotein translocase, SecE subunit [Lactobacillus jensenii 208-1] gi|313472544|ref|ZP_07813034.1| preprotein translocase, SecE subunit [Lactobacillus jensenii 1153] gi|238831716|gb|EEQ24053.1| preprotein translocase, SecE subunit [Lactobacillus jensenii 269-3] gi|239529981|gb|EEQ68982.1| preprotein translocase, SecE subunit [Lactobacillus jensenii 1153] gi|260561392|gb|EEX27365.1| preprotein translocase, SecE subunit [Lactobacillus jensenii SJ-7A-US] gi|281302254|gb|EFA94487.1| preprotein translocase, SecE subunit [Lactobacillus jensenii 208-1] Length = 56 Score = 38.3 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK V E KK+ WP+ + VI+ + ++F +D + L Sbjct: 2 FKFFKSVGHEMKKVTWPTAKQNRRDTTTVIVTSVLFALFLGALDWAFSTLTQMTF 56 >gi|189460671|ref|ZP_03009456.1| hypothetical protein BACCOP_01318 [Bacteroides coprocola DSM 17136] gi|189432630|gb|EDV01615.1| hypothetical protein BACCOP_01318 [Bacteroides coprocola DSM 17136] Length = 64 Score = 38.3 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + N+ K+ DE K+ WP+RSE+ S +VV+ + ++ ++D + ++M ++ Sbjct: 4 KITNYCKESYDELVHKVSWPTRSELSSSAVVVLYASLLIALVVFLMDSAFQFIMEDVI 61 >gi|219848386|ref|YP_002462819.1| preprotein translocase subunit SecE [Chloroflexus aggregans DSM 9485] gi|219542645|gb|ACL24383.1| preprotein translocase, SecE subunit [Chloroflexus aggregans DSM 9485] Length = 75 Score = 38.3 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 28/54 (51%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F++ R E +++ WPSR E + ++V+ + + + + D +L ++ + Sbjct: 20 FRETRSELRQVVWPSREETIRLTVLVVSVSIVIGLLLFIGDTIFTFLYTSLVSL 73 >gi|291530534|emb|CBK96119.1| preprotein translocase, SecE subunit, bacterial [Eubacterium siraeum 70/3] Length = 97 Score = 38.3 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 33/61 (54%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + +++ +FK ++ E KK+ W S+ V + +VV++ L +S + +D L+ L Sbjct: 33 KKSIVKYFKDLKSEFKKVVWTSKKTVFNNTVVVLVTLVVSGICVWGLDTLFATLLRLALN 92 Query: 65 I 65 + Sbjct: 93 M 93 >gi|203284307|ref|YP_002222047.1| preprotein translocase SecE subunit [Borrelia duttonii Ly] gi|201083750|gb|ACH93341.1| preprotein translocase SecE subunit [Borrelia duttonii Ly] Length = 56 Score = 38.3 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 28/55 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK+ E KKI WP +EV+ S V ++ SVF +D + ++ +I Sbjct: 2 FKFFKESVLELKKITWPRYNEVIGSGKQVFWLVVFISVFLGAVDYIMYLVITYIF 56 >gi|253579424|ref|ZP_04856694.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA] gi|251849522|gb|EES77482.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA] Length = 69 Score = 38.3 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 29/53 (54%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F+ ++ E +KI W R+E++ IVV+ + + V V+D I ++ ++ Sbjct: 17 FQGLQSEFRKIVWTDRNELIKQTIVVVCVSIVLCVLISVMDSFILEGINLLMK 69 >gi|33520006|ref|NP_878838.1| preprotein translocase subunit SecE [Candidatus Blochmannia floridanus] gi|33504352|emb|CAD83245.1| preprotein translocase SecE subunit [Candidatus Blochmannia floridanus] Length = 124 Score = 38.3 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 31/58 (53%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ F K+ E +K+ WP+ E L + +V++ + + S+ +D + ++ F L + Sbjct: 67 IIVFGKESCIELQKVVWPTYQESLNTTLVIVAVTVLMSLLVWGLDAVLVHVIAFGLRL 124 >gi|314965018|gb|EFT09117.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL082PA2] gi|315093849|gb|EFT65825.1| preprotein translocase, SecE subunit [Propionibacterium acnes HL060PA1] gi|327326460|gb|EGE68249.1| putative SecE/Sec61-gamma subunit of protein translocation complex [Propionibacterium acnes HL103PA1] Length = 216 Score = 38.3 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 31/63 (49%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G R+ + F KQ E K+ WPS E+ +VV++ + + + +D GW++ Sbjct: 153 GKQRIGPVTFTKQSVAELCKVKWPSGDELGQYFLVVLVFVLLIIAYVSGLDVVFGWVVIK 212 Query: 62 ILG 64 + G Sbjct: 213 LFG 215 >gi|227513724|ref|ZP_03943773.1| preprotein translocase subunit SecE [Lactobacillus buchneri ATCC 11577] gi|227522459|ref|ZP_03952508.1| preprotein translocase subunit SecE [Lactobacillus hilgardii ATCC 8290] gi|227083043|gb|EEI18355.1| preprotein translocase subunit SecE [Lactobacillus buchneri ATCC 11577] gi|227090411|gb|EEI25723.1| preprotein translocase subunit SecE [Lactobacillus hilgardii ATCC 8290] Length = 58 Score = 38.3 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 27/57 (47%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + + NF K V E K + WP+ + VI I ++F ++D + W + F+ Sbjct: 1 MRLWNFCKNVVKEMKVVTWPNVKQTRTDTTTVIGTSIIMAIFLGLVDLIVQWGLSFL 57 >gi|28199873|ref|NP_780187.1| preprotein translocase subunit SecE [Xylella fastidiosa Temecula1] gi|182682625|ref|YP_001830785.1| preprotein translocase subunit SecE [Xylella fastidiosa M23] gi|28057994|gb|AAO29836.1| preprotein translocase SecE subunit [Xylella fastidiosa Temecula1] gi|182632735|gb|ACB93511.1| preprotein translocase, SecE subunit [Xylella fastidiosa M23] gi|307578906|gb|ADN62875.1| preprotein translocase subunit SecE [Xylella fastidiosa subsp. fastidiosa GB514] Length = 135 Score = 38.3 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 28/54 (51%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F + R E +K+ WP+R E + VVI+M++I S+ D I L + L Sbjct: 81 FLFESRFELRKVVWPTRHEAIRITWVVIVMITILSLLLGGFDFVIQKLTQWFLS 134 >gi|483835|dbj|BAA04280.1| SecE [Streptomyces griseus subsp. griseus NBRC 13350] Length = 86 Score = 38.3 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+RS++ VVI+ + + V+D ++ ++ G Sbjct: 33 FYRQIVAELRKVVWPTRSQLTTYTSVVIVFVVVMIGLVTVLDMGFARVVKYVFG 86 >gi|183601874|ref|ZP_02963243.1| preprotein translocase subunit SecE [Bifidobacterium animalis subsp. lactis HN019] gi|219682788|ref|YP_002469171.1| preprotein translocase subunit SecE [Bifidobacterium animalis subsp. lactis AD011] gi|241190364|ref|YP_002967758.1| preprotein translocase subunit SecE [Bifidobacterium animalis subsp. lactis Bl-04] gi|241195770|ref|YP_002969325.1| preprotein translocase subunit SecE [Bifidobacterium animalis subsp. lactis DSM 10140] gi|183218759|gb|EDT89401.1| preprotein translocase subunit SecE [Bifidobacterium animalis subsp. lactis HN019] gi|219620438|gb|ACL28595.1| preprotein translocase, SecE subunit [Bifidobacterium animalis subsp. lactis AD011] gi|240248756|gb|ACS45696.1| preprotein translocase subunit SecE [Bifidobacterium animalis subsp. lactis Bl-04] gi|240250324|gb|ACS47263.1| preprotein translocase subunit SecE [Bifidobacterium animalis subsp. lactis DSM 10140] gi|289178087|gb|ADC85333.1| SecE [Bifidobacterium animalis subsp. lactis BB-12] gi|295793351|gb|ADG32886.1| preprotein translocase subunit SecE [Bifidobacterium animalis subsp. lactis V9] Length = 76 Score = 38.3 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 31/59 (52%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + F KQ+ DE +K+ P+R ++ + V I +++ VF +D +G L I G Sbjct: 18 MRIGLFIKQIIDELRKVVTPTRKQLFYWSLAVFIFVALLMVFVTAMDFGLGKLSFLIFG 76 >gi|330812088|ref|YP_004356550.1| Putative Sec protein secretion system, subunit SecE [Pseudomonas brassicacearum subsp. brassicacearum NFM421] gi|327380196|gb|AEA71546.1| Putative Sec protein secretion system, subunit SecE [Pseudomonas brassicacearum subsp. brassicacearum NFM421] Length = 122 Score = 38.3 bits (88), Expect = 0.38, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GWL+ I Sbjct: 61 AKGKSFFVLAKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSLI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|330966924|gb|EGH67184.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. actinidiae str. M302091] Length = 122 Score = 38.3 bits (88), Expect = 0.38, Method: Composition-based stats. Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 13 KQVRDESKKIFWPSRSEVLVSV 34 K+ R E +K+ WP+R E + Sbjct: 71 KEARAEIRKVVWPTRQETTQTT 92 >gi|42519936|ref|NP_965851.1| preprotein translocase subunit SecE [Wolbachia endosymbiont of Drosophila melanogaster] gi|225629887|ref|YP_002726678.1| preprotein translocase, SecE subunit [Wolbachia sp. wRi] gi|225631287|ref|ZP_03787966.1| protein translocase subunit SecE [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|42409673|gb|AAS13785.1| protein translocase subunit SecE [Wolbachia endosymbiont of Drosophila melanogaster] gi|225591021|gb|EEH12224.1| protein translocase subunit SecE [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|225591868|gb|ACN94887.1| preprotein translocase, SecE subunit [Wolbachia sp. wRi] Length = 69 Score = 38.3 bits (88), Expect = 0.39, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 33/55 (60%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF ++ E ++I W + EVL S+ VV+I++ S+FF +D +++ + GI Sbjct: 11 FFCDIKQEIRRIAWVKKQEVLSSLFVVMIVILCFSIFFCFVDFMSLYVIKALFGI 65 >gi|1711364|sp|P36690|SECE_STRGR RecName: Full=Preprotein translocase subunit secE gi|603588|emb|CAA51295.1| secretory protein SecE [Streptomyces griseus] Length = 95 Score = 38.3 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+RS++ VVI+ + + V+D ++ ++ G Sbjct: 42 FYRQIVAELRKVVWPTRSQLTTYTSVVIVFVVVMIGLVTVLDIGFARVVKYVFG 95 >gi|227536125|ref|ZP_03966174.1| elongation factor Tu [Sphingobacterium spiritivorum ATCC 33300] gi|300772096|ref|ZP_07081966.1| preprotein translocase [Sphingobacterium spiritivorum ATCC 33861] gi|227244022|gb|EEI94037.1| elongation factor Tu [Sphingobacterium spiritivorum ATCC 33300] gi|300760399|gb|EFK57225.1| preprotein translocase [Sphingobacterium spiritivorum ATCC 33861] Length = 64 Score = 38.3 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 VL+FFK +E ++K+ WP+ +++ S ++V+I I ++ V+D++ ++ + GI Sbjct: 3 KVLDFFKDSYEEITQKVTWPTWAQLQSSAVIVLIASLIIALLVFVMDKASSNVLELLYGI 62 >gi|104779742|ref|YP_606240.1| preprotein translocase subunit SecE [Pseudomonas entomophila L48] gi|95108729|emb|CAK13423.1| preprotein translocase, membrane component, transport across inner membrane (General Secretory Pathway) [Pseudomonas entomophila L48] Length = 122 Score = 38.3 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GWL+ I Sbjct: 61 AKGKSFFALAKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSLI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|188995441|ref|YP_001929693.1| putative preprotein translocase SecE subunit [Porphyromonas gingivalis ATCC 33277] gi|188595121|dbj|BAG34096.1| putative preprotein translocase SecE subunit [Porphyromonas gingivalis ATCC 33277] Length = 67 Score = 37.9 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 27/47 (57%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 K+ WP+RSE+ S +VV+I I ++F V+D + +M + + Sbjct: 19 VHKVSWPTRSELTNSAVVVMIASLIIALFVFVVDTAFERIMELVYKL 65 >gi|77461313|ref|YP_350820.1| preprotein translocase subunit SecE [Pseudomonas fluorescens Pf0-1] gi|77385316|gb|ABA76829.1| preprotein translocase SecE subunit [Pseudomonas fluorescens Pf0-1] Length = 122 Score = 37.9 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GWL+ I Sbjct: 61 AKGKSFFVLVKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSLI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|70728948|ref|YP_262663.1| preprotein translocase subunit SecE [Pseudomonas fluorescens Pf-5] gi|68343247|gb|AAY90853.1| preprotein translocase, SecE subunit [Pseudomonas fluorescens Pf-5] Length = 122 Score = 37.9 bits (87), Expect = 0.42, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GWL+ I Sbjct: 61 AKGKSFFVLVKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSLI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|72383409|ref|YP_292764.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. NATL2A] gi|72003259|gb|AAZ59061.1| protein translocase subunit secE/sec61 gamma [Prochlorococcus marinus str. NATL2A] Length = 80 Score = 37.9 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 27/53 (50%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F DE K + WPSR ++ + VI+M+++S+V + + GW I Sbjct: 27 FLSSTIDEMKLVVWPSRQQLFSESVAVILMVTLSAVSIAAVSRFYGWASTQIF 79 >gi|203287843|ref|YP_002222858.1| preprotein translocase SecE subunit [Borrelia recurrentis A1] gi|201085063|gb|ACH94637.1| preprotein translocase SecE subunit [Borrelia recurrentis A1] Length = 56 Score = 37.9 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 29/55 (52%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK+ E KKI WP +EV+ S V ++ SVF V+D + ++ +I Sbjct: 2 FKFFKESVLELKKITWPRYNEVIGSGKQVFWLVVFISVFLGVVDYIMYLVITYIF 56 >gi|46446231|ref|YP_007596.1| putative preprotein translocase SecE [Candidatus Protochlamydia amoebophila UWE25] gi|46399872|emb|CAF23321.1| putative preprotein translocase SecE [Candidatus Protochlamydia amoebophila UWE25] Length = 95 Score = 37.9 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 24/46 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSI 55 NF V+ E KI W SR E++V +V++ + + ++D I Sbjct: 34 NFVADVKSEIYKINWTSRDELIVYTKIVVLATFLFGMSIYLLDLMI 79 >gi|167756032|ref|ZP_02428159.1| hypothetical protein CLORAM_01552 [Clostridium ramosum DSM 1402] gi|237734018|ref|ZP_04564499.1| predicted protein [Mollicutes bacterium D7] gi|167704024|gb|EDS18603.1| hypothetical protein CLORAM_01552 [Clostridium ramosum DSM 1402] gi|229382844|gb|EEO32935.1| predicted protein [Coprobacillus sp. D7] Length = 62 Score = 37.9 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 11/51 (21%), Positives = 26/51 (50%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 K +R E K + W S+ E+ + +V++ + ++F D I +++ + Sbjct: 9 LKGIRKEIKNVSWLSKKELAQNSAIVLLFCFVMGLYFFAGDAIIAFILKTL 59 >gi|15616669|ref|NP_239881.1| preprotein translocase subunit SecE [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] gi|11134507|sp|P57152|SECE_BUCAI RecName: Full=Preprotein translocase subunit secE gi|25301349|pir||G84934 preprotein translocase secE chain [imported] - Buchnera sp. (strain APS) gi|10038732|dbj|BAB12767.1| preprotein translocase secE subunit [Buchnera aphidicola str. APS (Acyrthosiphon pisum)] Length = 127 Score = 37.9 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 27/62 (43%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 +L + + E +KI WP E L + +VI + S ID I L+ FI+ Sbjct: 64 KGKDILLYIVMSKKEMQKIIWPKYKETLYTTFIVISVTIFISFILWSIDSVIFRLIAFII 123 Query: 64 GI 65 + Sbjct: 124 SL 125 >gi|29831451|ref|NP_826085.1| preprotein translocase subunit SecE [Streptomyces avermitilis MA-4680] gi|29608566|dbj|BAC72620.1| putative preprotein translocase SecE subunit [Streptomyces avermitilis MA-4680] Length = 95 Score = 37.9 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WPSR+++ VVI+ + I VID + ++ G Sbjct: 42 FYRQIVAELRKVVWPSRNQLTTYTTVVIVFVVIMIALVTVIDYGLNHAAKYVFG 95 >gi|326799805|ref|YP_004317624.1| preprotein translocase, SecE subunit [Sphingobacterium sp. 21] gi|326550569|gb|ADZ78954.1| preprotein translocase, SecE subunit [Sphingobacterium sp. 21] Length = 64 Score = 37.9 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 VL+F K E ++K+ WP+ SE+ S +VV++ I ++ L +DQS ++ G Sbjct: 3 NVLDFIKDSYHEMTQKVSWPTWSELQNSAVVVLVASIIIALIVLAMDQSSSAILKLFYG 61 >gi|257869762|ref|ZP_05649415.1| predicted protein [Enterococcus gallinarum EG2] gi|257803926|gb|EEV32748.1| predicted protein [Enterococcus gallinarum EG2] Length = 56 Score = 37.9 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +NF K V E K + WPSR ++ VVI I +V F V+D I + IL Sbjct: 1 MNFMKNVFAEMKNVSWPSRKQLRRDTFVVIQTTIIFAVMFFVMDTLIQTVFDLILK 56 >gi|169830420|ref|YP_001716402.1| preprotein translocase subunit SecE [Candidatus Desulforudis audaxviator MP104C] gi|169637264|gb|ACA58770.1| preprotein translocase, SecE subunit [Candidatus Desulforudis audaxviator MP104C] Length = 113 Score = 37.9 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 29/54 (53%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF+ V E KK+ WP+R EV++ VV++ + + + + D + + ++ Sbjct: 59 RFFEGVWHELKKVHWPTRREVIIYTGVVLVAVLLVGLILWIFDLLLSQIFGRLI 112 >gi|167772355|ref|ZP_02444408.1| hypothetical protein ANACOL_03732 [Anaerotruncus colihominis DSM 17241] gi|167665458|gb|EDS09588.1| hypothetical protein ANACOL_03732 [Anaerotruncus colihominis DSM 17241] Length = 74 Score = 37.9 bits (87), Expect = 0.49, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 34/56 (60%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FFK ++ E+KK+ WP + +++ + +VI+M+ I++VF +D L+ + + Sbjct: 18 KFFKDIKGETKKVVWPDKKQIVNNTGIVIVMVVIAAVFVGCLDLIAKGLLDLFVKL 73 >gi|42527928|ref|NP_973026.1| preprotein translocase subunit SecE [Treponema denticola ATCC 35405] gi|41818973|gb|AAS12945.1| preprotein translocase, SecE subunit [Treponema denticola ATCC 35405] gi|325474847|gb|EGC78033.1| preprotein translocase [Treponema denticola F0402] Length = 59 Score = 37.9 bits (87), Expect = 0.49, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 30/57 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F+K+ E +K+ WP+ SEV SV VV+I I +VF +D + +I Sbjct: 3 KIGTFWKECIGELRKVVWPTASEVGSSVKVVLISTLIVAVFLGGLDAFFIACVGWIF 59 >gi|320009120|gb|ADW03970.1| preprotein translocase, SecE subunit [Streptomyces flavogriseus ATCC 33331] Length = 103 Score = 37.9 bits (87), Expect = 0.49, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+RS++ VVI+ + + VID ++ ++ G Sbjct: 50 FYRQIVAELRKVVWPTRSQLSTYTAVVIVFVVVMIGLVTVIDFGFARVIKYVFG 103 >gi|320531936|ref|ZP_08032841.1| preprotein translocase, SecE subunit [Actinomyces sp. oral taxon 171 str. F0337] gi|320135850|gb|EFW27893.1| preprotein translocase, SecE subunit [Actinomyces sp. oral taxon 171 str. F0337] Length = 78 Score = 37.9 bits (87), Expect = 0.50, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QV DE +K+ WP+ +E+ VV++ + F V+D + + ++ Sbjct: 22 IALFIRQVIDELRKVVWPTMNELWTYFTVVVVFIIAIMAFTGVLDFAFNRAVMWLFA 78 >gi|257066640|ref|YP_003152896.1| preprotein translocase, SecE subunit [Anaerococcus prevotii DSM 20548] gi|256798520|gb|ACV29175.1| preprotein translocase, SecE subunit [Anaerococcus prevotii DSM 20548] Length = 60 Score = 37.9 bits (87), Expect = 0.50, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 29/53 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF V E KKI WP++ +VI + +++++ ++DQ +L+ I+ Sbjct: 8 FFSGVSREFKKIQWPTKKTAFEYSWIVIAISAVTALAIWLLDQVFQFLLQTIM 60 >gi|116495743|ref|YP_807477.1| preprotein translocase subunit SecE [Lactobacillus casei ATCC 334] gi|191639231|ref|YP_001988397.1| preprotein translocase subunit SecE [Lactobacillus casei BL23] gi|239630148|ref|ZP_04673179.1| protein translocase subunit secE/sec61 gamma [Lactobacillus paracasei subsp. paracasei 8700:2] gi|301067298|ref|YP_003789321.1| preprotein translocase subunit SecE [Lactobacillus casei str. Zhang] gi|116105893|gb|ABJ71035.1| protein translocase subunit secE/sec61 gamma [Lactobacillus casei ATCC 334] gi|190713533|emb|CAQ67539.1| Putative uncharacterized protein secE [Lactobacillus casei BL23] gi|239527760|gb|EEQ66761.1| protein translocase subunit secE/sec61 gamma [Lactobacillus paracasei subsp. paracasei 8700:2] gi|300439705|gb|ADK19471.1| Preprotein translocase subunit SecE [Lactobacillus casei str. Zhang] gi|327383309|gb|AEA54785.1| Preprotein translocase, SecE subunit [Lactobacillus casei LC2W] gi|327386492|gb|AEA57966.1| Preprotein translocase, SecE subunit [Lactobacillus casei BD-II] Length = 56 Score = 37.9 bits (87), Expect = 0.51, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F K V E K + WP+ + VI+ I +++F +D I + L Sbjct: 1 MKFIKSVFAEMKAVTWPTARQTRRDTFTVIMTSIIFAIYFAAVDWVINMIFQAFL 55 >gi|148545726|ref|YP_001265828.1| preprotein translocase subunit SecE [Pseudomonas putida F1] gi|148509784|gb|ABQ76644.1| protein translocase subunit secE/sec61 gamma [Pseudomonas putida F1] Length = 122 Score = 37.9 bits (87), Expect = 0.52, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 32/62 (51%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GW + I Sbjct: 61 AKGKSFFALAKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWAVSLI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|167031487|ref|YP_001666718.1| preprotein translocase subunit SecE [Pseudomonas putida GB-1] gi|166857975|gb|ABY96382.1| preprotein translocase, SecE subunit [Pseudomonas putida GB-1] Length = 122 Score = 37.9 bits (87), Expect = 0.52, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 33/62 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + + K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GW + I Sbjct: 61 AKGKSFFSLAKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWAVSLI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|170723919|ref|YP_001751607.1| preprotein translocase subunit SecE [Pseudomonas putida W619] gi|169761922|gb|ACA75238.1| preprotein translocase, SecE subunit [Pseudomonas putida W619] Length = 122 Score = 37.9 bits (87), Expect = 0.52, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 32/62 (51%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GW + I Sbjct: 61 AKGKSFFALAKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWAVSLI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|26987182|ref|NP_742607.1| preprotein translocase subunit SecE [Pseudomonas putida KT2440] gi|24981818|gb|AAN66071.1|AE016236_5 preprotein translocase, SecE subunit [Pseudomonas putida KT2440] Length = 122 Score = 37.9 bits (87), Expect = 0.52, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 32/62 (51%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GW + I Sbjct: 61 AKGKSFFALAKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWAVSLI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|313496806|gb|ADR58172.1| SecE [Pseudomonas putida BIRD-1] Length = 122 Score = 37.9 bits (87), Expect = 0.53, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 32/62 (51%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GW + I Sbjct: 61 AKGKSFFALAKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWAVSLI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|319937664|ref|ZP_08012067.1| hypothetical protein HMPREF9488_02903 [Coprobacillus sp. 29_1] gi|319807099|gb|EFW03713.1| hypothetical protein HMPREF9488_02903 [Coprobacillus sp. 29_1] Length = 64 Score = 37.9 bits (87), Expect = 0.54, Method: Composition-based stats. Identities = 14/51 (27%), Positives = 26/51 (50%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 K VR E K I W ++ E+ + +VV++ + V+F D I ++ + Sbjct: 11 LKGVRSEIKNIHWLTKKELAYNAMVVLVFCFLFGVYFYGSDAIIAVILKAL 61 >gi|254785050|ref|YP_003072478.1| preprotein translocase, SecE subunit [Teredinibacter turnerae T7901] gi|237686393|gb|ACR13657.1| preprotein translocase, SecE subunit [Teredinibacter turnerae T7901] Length = 123 Score = 37.5 bits (86), Expect = 0.56, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 33/62 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A N K + E +K+ WPSR E + ++V +++ ++++ +D +G+L I Sbjct: 62 AKGNAFWNLLKAAQVEVRKVVWPSRQETTQTTLIVAVVVVVTALILWGLDTGLGYLASLI 121 Query: 63 LG 64 +G Sbjct: 122 IG 123 >gi|261338354|ref|ZP_05966238.1| preprotein translocase, SecE subunit [Bifidobacterium gallicum DSM 20093] gi|270277029|gb|EFA22883.1| preprotein translocase, SecE subunit [Bifidobacterium gallicum DSM 20093] Length = 78 Score = 37.5 bits (86), Expect = 0.56, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F KQ+ DE +K+ P+R ++ + V+ V I + + VF +D +G L I G Sbjct: 25 FIKQIIDELRKVVTPTRKQLFMWVLAVFIFVVLLMVFVTAMDFGLGNLAFLIFG 78 >gi|326382995|ref|ZP_08204684.1| preprotein translocase subunit SecE [Gordonia neofelifaecis NRRL B-59395] gi|326198131|gb|EGD55316.1| preprotein translocase subunit SecE [Gordonia neofelifaecis NRRL B-59395] Length = 127 Score = 37.5 bits (86), Expect = 0.56, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 30/59 (50%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + F KQV E +K+ WP+R+E++ VI V + + + F +D L + G Sbjct: 69 VRIWIFLKQVVSEMRKVVWPTRNEMVNYVIAVFAFVVVVTAFIAGLDIGFAKLTLLVFG 127 >gi|116785946|gb|ABK23918.1| unknown [Picea sitchensis] Length = 246 Score = 37.5 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL-GIG 66 F++ V +E+ +I WP +VL + VV+ ++ SSV L ++ + + I GIG Sbjct: 180 FWRGVLEETAQIEWPPFQKVLGTTGVVLAVMVGSSVVLLTVNAILAEISDKIFNGIG 236 >gi|237743081|ref|ZP_04573562.1| protein translocase subunit sece [Fusobacterium sp. 7_1] gi|256028512|ref|ZP_05442346.1| protein translocase subunit SecE [Fusobacterium sp. D11] gi|260495682|ref|ZP_05815805.1| preprotein translocase, SecE subunit [Fusobacterium sp. 3_1_33] gi|289766432|ref|ZP_06525810.1| translocase subunit sece [Fusobacterium sp. D11] gi|229433377|gb|EEO43589.1| protein translocase subunit sece [Fusobacterium sp. 7_1] gi|260196747|gb|EEW94271.1| preprotein translocase, SecE subunit [Fusobacterium sp. 3_1_33] gi|289717987|gb|EFD81999.1| translocase subunit sece [Fusobacterium sp. D11] Length = 58 Score = 37.5 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 32/54 (59%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +N F++V+ E K+ WPS++EV+ S + V+ M S++ V D ++F+ Sbjct: 1 MNLFQKVKMEYSKVEWPSKTEVIHSTLWVVTMTVFVSIYLGVFDILAVRALNFL 54 >gi|237738809|ref|ZP_04569290.1| protein translocase subunit sece [Fusobacterium sp. 2_1_31] gi|229423912|gb|EEO38959.1| protein translocase subunit sece [Fusobacterium sp. 2_1_31] Length = 58 Score = 37.5 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 32/54 (59%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +N F++V+ E K+ WPS++EV+ S I VI M I SV+ V D ++ + Sbjct: 1 MNLFQKVKMEYSKVEWPSKTEVIHSTIWVITMTVIVSVYLGVFDILAVKALNAL 54 >gi|319891499|ref|YP_004148374.1| Preprotein translocase subunit SecE [Staphylococcus pseudintermedius HKU10-03] gi|317161195|gb|ADV04738.1| Preprotein translocase subunit SecE [Staphylococcus pseudintermedius HKU10-03] gi|323465329|gb|ADX77482.1| preprotein translocase, SecE subunit [Staphylococcus pseudintermedius ED99] Length = 59 Score = 37.5 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 16/52 (30%), Positives = 29/52 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF+ V+ E +K WP+ E++ +V++ + +FF +D IG L+ I Sbjct: 7 FFQGVKSEMEKTSWPTGPELVKYTTIVVMTVLFFLLFFWGLDIGIGQLIEMI 58 >gi|292670291|ref|ZP_06603717.1| preprotein translocase subunit SecE [Selenomonas noxia ATCC 43541] gi|292648022|gb|EFF65994.1| preprotein translocase subunit SecE [Selenomonas noxia ATCC 43541] Length = 61 Score = 37.5 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 26/56 (46%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ F ++V E KK+ W ++ E++ VV I + + + D + IL Sbjct: 4 IVKFLREVVAEMKKVSWSTKKELVTYTGVVGIAIVVVCALIWICDTIFARVFQVIL 59 >gi|116074060|ref|ZP_01471322.1| SecE subunit of protein translocation complex [Synechococcus sp. RS9916] gi|116069365|gb|EAU75117.1| SecE subunit of protein translocation complex [Synechococcus sp. RS9916] Length = 118 Score = 37.5 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 25/53 (47%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F +E K + WP+R ++ I VI+M+S+S+ + + W + Sbjct: 65 FLAATLEELKLVVWPTRQQLFSESIAVILMVSLSAAAIASVSRFFSWSASQVF 117 >gi|294462089|gb|ADE76597.1| unknown [Picea sitchensis] Length = 248 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL-GIG 66 F++ V +E+ +I WP +VL + VV+ ++ SS L ++ + + I GIG Sbjct: 182 FWRGVLEETARIEWPPFQKVLGTTGVVLAVMVGSSAVLLTVNAILAEISDEIFNGIG 238 >gi|229592916|ref|YP_002875035.1| preprotein translocase subunit SecE [Pseudomonas fluorescens SBW25] gi|229364782|emb|CAY52789.1| preprotein translocase SecE subunit [Pseudomonas fluorescens SBW25] Length = 122 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GWL+ I Sbjct: 61 AKGKSFAVLVKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSLI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|311896609|dbj|BAJ29017.1| putative preprotein translocase SecE subunit [Kitasatospora setae KM-6054] Length = 122 Score = 37.5 bits (86), Expect = 0.61, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 30/57 (52%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F++Q+ E +K+ WP+RS+++ VV++ + + + +D +I G Sbjct: 66 IAIFYRQIIAELRKVVWPTRSQLIQYTTVVVVFVIVMMLVVAGLDWVFAKGAFWIFG 122 >gi|120553639|ref|YP_957990.1| preprotein translocase subunit SecE [Marinobacter aquaeolei VT8] gi|120323488|gb|ABM17803.1| protein translocase subunit secE/sec61 gamma [Marinobacter aquaeolei VT8] Length = 122 Score = 37.5 bits (86), Expect = 0.61, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 32/56 (57%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ R E +K+ WP+R E++ + I+V++ + + ++ +D I WL+ +G Sbjct: 67 ATLLKEARVEIRKVVWPTRPELVQTTIIVVVFVLVVALILWGMDSLISWLVAGFIG 122 >gi|199598557|ref|ZP_03211974.1| preprotein translocase subunit SecE [Lactobacillus rhamnosus HN001] gi|258509295|ref|YP_003172046.1| preprotein translocase subunit SecE [Lactobacillus rhamnosus GG] gi|258540481|ref|YP_003174980.1| preprotein translocase subunit SecE [Lactobacillus rhamnosus Lc 705] gi|199590599|gb|EDY98688.1| preprotein translocase subunit SecE [Lactobacillus rhamnosus HN001] gi|257149222|emb|CAR88195.1| Preprotein translocase, SecE subunit [Lactobacillus rhamnosus GG] gi|257152157|emb|CAR91129.1| Preprotein translocase, SecE subunit [Lactobacillus rhamnosus Lc 705] gi|259650576|dbj|BAI42738.1| preprotein translocase subunit SecE [Lactobacillus rhamnosus GG] gi|328478516|gb|EGF48216.1| preprotein translocase subunit SecE [Lactobacillus rhamnosus MTCC 5462] Length = 56 Score = 37.5 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F K V E K + WP+ + VI+ I +++F +D I + L Sbjct: 1 MKFIKSVFAEMKAVTWPTAQQTRRDTFTVIMTSIIFAIYFAGVDWVINAVFQAFL 55 >gi|187735542|ref|YP_001877654.1| preprotein translocase, SecE subunit [Akkermansia muciniphila ATCC BAA-835] gi|187425594|gb|ACD04873.1| preprotein translocase, SecE subunit [Akkermansia muciniphila ATCC BAA-835] Length = 75 Score = 37.5 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 14/71 (19%), Positives = 29/71 (40%), Gaps = 11/71 (15%) Query: 7 AVLNFFKQVRDESKKIFWPSR-----------SEVLVSVIVVIIMLSISSVFFLVIDQSI 55 + F +V+ E KK WP E+ S +VV+I + F D + Sbjct: 4 KISQFIAEVKGELKKTTWPWESDPKVKGFKKFRELWGSTLVVLIAMVFLGAFVASFDIFL 63 Query: 56 GWLMHFILGIG 66 ++++++ + Sbjct: 64 HSVVNYLIQLA 74 >gi|288926254|ref|ZP_06420179.1| preprotein translocase, SecE subunit [Prevotella buccae D17] gi|315606520|ref|ZP_07881535.1| preprotein translocase [Prevotella buccae ATCC 33574] gi|288336945|gb|EFC75306.1| preprotein translocase, SecE subunit [Prevotella buccae D17] gi|315251926|gb|EFU31900.1| preprotein translocase [Prevotella buccae ATCC 33574] Length = 62 Score = 37.5 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 22/42 (52%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 + K WP+ E+ S +VV+ I +V ++D GW+M Sbjct: 16 AHKTTWPTLPELTHSAVVVLSASLIIAVVVFLMDSVFGWIMG 57 >gi|227533697|ref|ZP_03963746.1| preprotein translocase subunit SecE [Lactobacillus paracasei subsp. paracasei ATCC 25302] gi|227188681|gb|EEI68748.1| preprotein translocase subunit SecE [Lactobacillus paracasei subsp. paracasei ATCC 25302] Length = 57 Score = 37.5 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F K V E K + WP+ + VI+ I +++F +D I + L Sbjct: 2 MKFIKSVFAEMKAVTWPTARQTRRDTFTVIMTSIIFAIYFAAVDWVINMIFQAFL 56 >gi|262067339|ref|ZP_06026951.1| preprotein translocase, SecE subunit [Fusobacterium periodonticum ATCC 33693] gi|291378902|gb|EFE86420.1| preprotein translocase, SecE subunit [Fusobacterium periodonticum ATCC 33693] Length = 58 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 20/46 (43%), Positives = 29/46 (63%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQS 54 +N F++V+ E K+ WPS++EV+ S I VI M I SV+ V D Sbjct: 1 MNLFQKVKMEYSKVEWPSKTEVIHSTIWVITMTVIVSVYLGVFDIL 46 >gi|269121552|ref|YP_003309729.1| preprotein translocase, SecE subunit [Sebaldella termitidis ATCC 33386] gi|268615430|gb|ACZ09798.1| preprotein translocase, SecE subunit [Sebaldella termitidis ATCC 33386] Length = 59 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 32/52 (61%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 K++ DE KK++WPS+ EVL ++V+++ S++ + D S ++ ++ Sbjct: 2 LKEIIDEYKKVYWPSKQEVLHVTVIVLLITIFISLYVVAFDLSFNRVLSLLI 53 >gi|329962253|ref|ZP_08300259.1| preprotein translocase, SecE subunit [Bacteroides fluxus YIT 12057] gi|328530361|gb|EGF57238.1| preprotein translocase, SecE subunit [Bacteroides fluxus YIT 12057] Length = 62 Score = 37.5 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ +FK+ DE K+ WP+ SE+ S +VV+ + ++ +D LM FI Sbjct: 3 KIVAYFKETYDELVHKVSWPTYSELTNSAVVVLYASLLIALVVFAMDFCFQNLMEFI 59 >gi|313892108|ref|ZP_07825703.1| preprotein translocase, SecE subunit [Dialister microaerophilus UPII 345-E] gi|313119463|gb|EFR42660.1| preprotein translocase, SecE subunit [Dialister microaerophilus UPII 345-E] Length = 77 Score = 37.5 bits (86), Expect = 0.68, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 34/61 (55%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ FF+ + E KK+ WP++ +++ +I VI+ + + S +V+D + L F++ Sbjct: 14 KSAAMTGFFRGTKMEMKKVIWPTKQQMIQYLIAVIVSVVLVSFLIVVVDFAFMALSKFLI 73 Query: 64 G 64 Sbjct: 74 S 74 >gi|146308936|ref|YP_001189401.1| preprotein translocase subunit SecE [Pseudomonas mendocina ymp] gi|145577137|gb|ABP86669.1| protein translocase subunit secE/sec61 gamma [Pseudomonas mendocina ymp] Length = 122 Score = 37.5 bits (86), Expect = 0.68, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 33/53 (62%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ R E +K+ WP+R E + + ++V+ ++ + ++ +D +GWL+ I+G Sbjct: 70 LKEARVEIRKVVWPTRQETMQTTLIVVAVVLVMALLLWGLDSLLGWLVSLIVG 122 >gi|296130514|ref|YP_003637764.1| preprotein translocase, SecE subunit [Cellulomonas flavigena DSM 20109] gi|296022329|gb|ADG75565.1| preprotein translocase, SecE subunit [Cellulomonas flavigena DSM 20109] Length = 93 Score = 37.5 bits (86), Expect = 0.70, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QV E KK+ P+R E++ VV++ +++ +F +ID IG L + G Sbjct: 37 IALFVRQVVAELKKVVRPTRQELVTYTSVVLVFVTVVMLFVTLIDLGIGKLTFLVFG 93 >gi|325510554|gb|ADZ22190.1| preprotein translocase subunit SecE [Clostridium acetobutylicum EA 2018] Length = 74 Score = 37.1 bits (85), Expect = 0.72, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 25/54 (46%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FFK + E+ +I WPS+ ++ + I V+ + + ++D L I Sbjct: 21 FFKDLGAETHRITWPSKLDLKKTTIAVLTFCAAYIIVVAIMDYGFNNLFRVIFK 74 >gi|325068004|ref|ZP_08126677.1| preprotein translocase, SecE subunit [Actinomyces oris K20] gi|326773945|ref|ZP_08233227.1| preprotein translocase, SecE subunit [Actinomyces viscosus C505] gi|326636084|gb|EGE36988.1| preprotein translocase, SecE subunit [Actinomyces viscosus C505] Length = 78 Score = 37.1 bits (85), Expect = 0.72, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 29/57 (50%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QV DE +K+ WP+ +E+ VV++ + F V+D + + ++ Sbjct: 22 IALFIRQVIDELRKVVWPTMNELWTYFTVVVVFIIAIMAFTGVLDFAFNRAVMWLFA 78 >gi|312892231|ref|ZP_07751728.1| preprotein translocase, SecE subunit [Mucilaginibacter paludis DSM 18603] gi|311295361|gb|EFQ72533.1| preprotein translocase, SecE subunit [Mucilaginibacter paludis DSM 18603] Length = 64 Score = 37.1 bits (85), Expect = 0.73, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 V + K+ +E + K+ WP+ E+ S I+V++ I ++ L++D+S G L+ + Sbjct: 3 KVTEYIKESYEELTDKVTWPTWGELQNSAILVLVAAVIIALIVLLMDESFGRLLQY 58 >gi|229552908|ref|ZP_04441633.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Lactobacillus rhamnosus LMS2-1] gi|229313716|gb|EEN79689.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Lactobacillus rhamnosus LMS2-1] Length = 57 Score = 37.1 bits (85), Expect = 0.73, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + F K V E K + WP+ + VI+ I +++F +D I + L Sbjct: 2 MKFIKSVFAEMKAVTWPTAQQTRRDTFTVIMTSIIFAIYFAGVDWVINAVFQAFL 56 >gi|58336695|ref|YP_193280.1| preprotein translocase subunit SecE [Lactobacillus acidophilus NCFM] gi|227903258|ref|ZP_04021063.1| preprotein translocase subunit SecE [Lactobacillus acidophilus ATCC 4796] gi|58254012|gb|AAV42249.1| putative protein translocase [Lactobacillus acidophilus NCFM] gi|227869063|gb|EEJ76484.1| preprotein translocase subunit SecE [Lactobacillus acidophilus ATCC 4796] Length = 55 Score = 37.1 bits (85), Expect = 0.73, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 24/54 (44%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + FFK V E K + WP+ + + VI + +V+ +D WL + Sbjct: 2 IKFFKGVAHEMKLVTWPTAKQNRRDTVTVITSSVLFAVYLGALDWLFSWLTQKM 55 >gi|300776005|ref|ZP_07085864.1| preprotein translocase [Chryseobacterium gleum ATCC 35910] gi|300505138|gb|EFK36277.1| preprotein translocase [Chryseobacterium gleum ATCC 35910] Length = 68 Score = 37.1 bits (85), Expect = 0.75, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 7 AVLNFFKQVRDESK-KIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + ++F K +E + K+ WP +++ S IVV I I ++F +D+ + I+G+ Sbjct: 3 SFVDFLKGSYNEFRHKVEWPKWADLQSSTIVVTIATVILALFTFGVDELFSKAISNIIGM 62 >gi|197303971|ref|ZP_03169003.1| hypothetical protein RUMLAC_02708 [Ruminococcus lactaris ATCC 29176] gi|197296939|gb|EDY31507.1| hypothetical protein RUMLAC_02708 [Ruminococcus lactaris ATCC 29176] Length = 65 Score = 37.1 bits (85), Expect = 0.75, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 30/61 (49%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++FK ++ E KK+ WP ++ + V+ + I VID ++ + + F++ Sbjct: 5 TKTQKKSWFKGLQAEFKKVIWPDKNTLTKQTTAVVAVSVILGALIAVIDAALKYGIDFLV 64 Query: 64 G 64 Sbjct: 65 K 65 >gi|295425598|ref|ZP_06818285.1| preprotein translocase [Lactobacillus amylolyticus DSM 11664] gi|295064614|gb|EFG55535.1| preprotein translocase [Lactobacillus amylolyticus DSM 11664] Length = 56 Score = 37.1 bits (85), Expect = 0.76, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 26/55 (47%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK V E K + WP+ + ++VI+ + +++ +D + L ++ Sbjct: 2 FKFFKSVGHEMKLVTWPTYKQNRHDTMIVIVSSILFAIYLGALDWAFSALTQAVM 56 >gi|153816491|ref|ZP_01969159.1| hypothetical protein RUMTOR_02744 [Ruminococcus torques ATCC 27756] gi|317500771|ref|ZP_07958988.1| preprotein translocase [Lachnospiraceae bacterium 8_1_57FAA] gi|331089752|ref|ZP_08338646.1| preprotein translocase [Lachnospiraceae bacterium 3_1_46FAA] gi|145846187|gb|EDK23105.1| hypothetical protein RUMTOR_02744 [Ruminococcus torques ATCC 27756] gi|316897864|gb|EFV19918.1| preprotein translocase [Lachnospiraceae bacterium 8_1_57FAA] gi|330403635|gb|EGG83190.1| preprotein translocase [Lachnospiraceae bacterium 3_1_46FAA] Length = 65 Score = 37.1 bits (85), Expect = 0.78, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 27/60 (45%) Query: 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + ++FK ++ E KK+ WP + + V+ + I VID + + + ++ Sbjct: 6 KTQKKSWFKGLQAEFKKVIWPDKKTLARQTTAVVAVSVILGALIAVIDVILRYGIDLLIK 65 >gi|294781918|ref|ZP_06747250.1| preprotein translocase, SecE subunit [Fusobacterium sp. 1_1_41FAA] gi|294481729|gb|EFG29498.1| preprotein translocase, SecE subunit [Fusobacterium sp. 1_1_41FAA] Length = 58 Score = 37.1 bits (85), Expect = 0.78, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 32/54 (59%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +N F++V+ E K+ WPS++EV+ S I VI M I SV+ V D ++ + Sbjct: 1 MNLFQKVKMEYSKVEWPSKTEVIHSTIWVITMTVIVSVYLGVFDILAVKALNVL 54 >gi|15896398|ref|NP_349747.1| preprotein translocase subunit SecE [Clostridium acetobutylicum ATCC 824] gi|15026216|gb|AAK81087.1|AE007810_6 Preprotein translocase subunit SecE [Clostridium acetobutylicum ATCC 824] Length = 76 Score = 37.1 bits (85), Expect = 0.78, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 25/54 (46%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FFK + E+ +I WPS+ ++ + I V+ + + ++D L I Sbjct: 23 FFKDLGAETHRITWPSKLDLKKTTIAVLTFCAAYIIVVAIMDYGFNNLFRVIFK 76 >gi|229830145|ref|ZP_04456214.1| hypothetical protein GCWU000342_02252 [Shuttleworthia satelles DSM 14600] gi|229791443|gb|EEP27557.1| hypothetical protein GCWU000342_02252 [Shuttleworthia satelles DSM 14600] Length = 68 Score = 37.1 bits (85), Expect = 0.79, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 30/54 (55%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F+ ++ E KI WPS ++V + V++ I++ + +D + + ++F++ Sbjct: 11 FWTGIKHEFSKITWPSINQVSRESVAVVVTSVITAAIIVAVDFVVHFGLNFLVN 64 >gi|331091903|ref|ZP_08340735.1| preprotein translocase [Lachnospiraceae bacterium 2_1_46FAA] gi|330402802|gb|EGG82369.1| preprotein translocase [Lachnospiraceae bacterium 2_1_46FAA] Length = 68 Score = 37.1 bits (85), Expect = 0.79, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 26/53 (49%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FK ++ E KKI WP + + V+ + + + VID + + + F++ Sbjct: 16 FKGLKAEFKKIIWPDKKTLAKETTAVVAVSVLLAALISVIDVIVKYGVDFLIK 68 >gi|227494531|ref|ZP_03924847.1| conserved hypothetical protein [Actinomyces coleocanis DSM 15436] gi|226832265|gb|EEH64648.1| conserved hypothetical protein [Actinomyces coleocanis DSM 15436] Length = 74 Score = 37.1 bits (85), Expect = 0.79, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 28/57 (49%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ F KQV E KK+ WP+ E +VV++ + F ++D WL + G Sbjct: 18 IVLFVKQVIGELKKVVWPTVDEWKTYFLVVLVFVGAIMAFTGLLDLLFSWLSVLVFG 74 >gi|291534885|emb|CBL07997.1| protein translocase subunit secE/sec61 gamma [Roseburia intestinalis M50/1] gi|291539446|emb|CBL12557.1| protein translocase subunit secE/sec61 gamma [Roseburia intestinalis XB6B4] Length = 71 Score = 37.1 bits (85), Expect = 0.81, Method: Composition-based stats. Identities = 12/48 (25%), Positives = 25/48 (52%) Query: 17 DESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 E KKI WP + ++ VI + + + ++D +I + + F++G Sbjct: 21 AEFKKIIWPEKQSLVRQTTAVIAVSVVLGLIIALLDFAIQYGVDFLVG 68 >gi|161506933|ref|YP_001576887.1| preprotein translocase subunit SecE [Lactobacillus helveticus DPC 4571] gi|260102418|ref|ZP_05752655.1| preprotein translocase subunit SecE [Lactobacillus helveticus DSM 20075] gi|160347922|gb|ABX26596.1| Preprotein translocase, SecE subunit [Lactobacillus helveticus DPC 4571] gi|260083786|gb|EEW67906.1| preprotein translocase subunit SecE [Lactobacillus helveticus DSM 20075] gi|328462979|gb|EGF34787.1| preprotein translocase subunit SecE [Lactobacillus helveticus MTCC 5463] Length = 55 Score = 37.1 bits (85), Expect = 0.82, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 23/54 (42%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + FFK V E K + WP+ + + VI + + + +D WL + Sbjct: 2 IKFFKSVAHEMKLVTWPTAKQNRHDTMTVITSSILFAAYLGALDWLFSWLTQKM 55 >gi|88608140|ref|YP_506562.1| preprotein translocase, SecE subunit [Neorickettsia sennetsu str. Miyayama] gi|88600309|gb|ABD45777.1| preprotein translocase, SecE subunit [Neorickettsia sennetsu str. Miyayama] Length = 60 Score = 37.1 bits (85), Expect = 0.84, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 30/53 (56%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 ++FF+ V E + I WPSR EV+ + + + SI ++ F +D I ++ F Sbjct: 6 ISFFRSVFAEFRGITWPSRREVVSFSLFALSITSIFALLFAFVDYVIFLMIRF 58 >gi|257867883|ref|ZP_05647536.1| preprotein translocase [Enterococcus casseliflavus EC30] gi|257874212|ref|ZP_05653865.1| preprotein translocase [Enterococcus casseliflavus EC10] gi|257876777|ref|ZP_05656430.1| preprotein translocase [Enterococcus casseliflavus EC20] gi|325570756|ref|ZP_08146482.1| preprotein translocase subunit SecE [Enterococcus casseliflavus ATCC 12755] gi|257801966|gb|EEV30869.1| preprotein translocase [Enterococcus casseliflavus EC30] gi|257808376|gb|EEV37198.1| preprotein translocase [Enterococcus casseliflavus EC10] gi|257810943|gb|EEV39763.1| preprotein translocase [Enterococcus casseliflavus EC20] gi|325156602|gb|EGC68782.1| preprotein translocase subunit SecE [Enterococcus casseliflavus ATCC 12755] Length = 56 Score = 37.1 bits (85), Expect = 0.86, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 30/56 (53%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F K V +E K + WPS+ ++ VVI I ++ F V+D I + ++IL Sbjct: 1 MKFLKNVVEEMKNVSWPSKKQLRKDTFVVIQTTIIFALMFFVMDTLIQTVFNWILK 56 >gi|154491727|ref|ZP_02031353.1| hypothetical protein PARMER_01338 [Parabacteroides merdae ATCC 43184] gi|218264361|ref|ZP_03478218.1| hypothetical protein PRABACTJOHN_03909 [Parabacteroides johnsonii DSM 18315] gi|154087968|gb|EDN87013.1| hypothetical protein PARMER_01338 [Parabacteroides merdae ATCC 43184] gi|218222059|gb|EEC94709.1| hypothetical protein PRABACTJOHN_03909 [Parabacteroides johnsonii DSM 18315] Length = 64 Score = 37.1 bits (85), Expect = 0.86, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 ++N+ K+ +E K+ WP+R+E+ S +VV+ I + VID +M F Sbjct: 3 KIINYIKESYNELVYKVSWPTRTELSNSAVVVMFASLIIAALIFVIDLGFEGVMRF 58 >gi|119714941|ref|YP_921906.1| preprotein translocase, SecE subunit [Nocardioides sp. JS614] gi|119535602|gb|ABL80219.1| preprotein translocase, SecE subunit [Nocardioides sp. JS614] Length = 81 Score = 37.1 bits (85), Expect = 0.87, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 33/63 (52%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G R ++ F++QV E +K+ +P++ +++ IVV++ + V+D G L+ Sbjct: 14 GSQRTSIPTFYRQVVAELRKVVYPTQEQLVTYFIVVMVFVVFFMTLVSVLDLGFGKLVFS 73 Query: 62 ILG 64 I Sbjct: 74 IFA 76 >gi|87306551|ref|ZP_01088698.1| hypothetical protein DSM3645_09467 [Blastopirellula marina DSM 3645] gi|87290730|gb|EAQ82617.1| hypothetical protein DSM3645_09467 [Blastopirellula marina DSM 3645] Length = 151 Score = 37.1 bits (85), Expect = 0.88, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 25/52 (48%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 +F V E K+ WPSR+E++ + VVI+ + + D +++ Sbjct: 89 ADFLIAVEAEMNKVSWPSRAELIRASAVVILFVFALAAVLFAYDVFWQFVLK 140 >gi|281425131|ref|ZP_06256044.1| preprotein translocase, SecE subunit [Prevotella oris F0302] gi|299141116|ref|ZP_07034253.1| preprotein translocase, SecE subunit [Prevotella oris C735] gi|281400723|gb|EFB31554.1| preprotein translocase, SecE subunit [Prevotella oris F0302] gi|298577076|gb|EFI48945.1| preprotein translocase, SecE subunit [Prevotella oris C735] Length = 63 Score = 37.1 bits (85), Expect = 0.90, Method: Composition-based stats. Identities = 11/44 (25%), Positives = 23/44 (52%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K WP+R+E+ S +VV+ + ++ +D ++M I Sbjct: 17 AHKTTWPTRAELTHSAMVVLSASLVIALVVFAMDSLFRFVMSTI 60 >gi|123965470|ref|YP_001010551.1| preprotein translocase subunit SecE [Prochlorococcus marinus str. MIT 9515] gi|123199836|gb|ABM71444.1| putative preprotein translocase, SecE subunit [Prochlorococcus marinus str. MIT 9515] Length = 85 Score = 37.1 bits (85), Expect = 0.90, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 26/54 (48%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NF DE K + WP++ ++ + VIIM+S S+ + + GW I Sbjct: 31 NFLTSTVDELKLVVWPNKQQLFSESVAVIIMVSFSAAAIASVSRFYGWAASQIF 84 >gi|325104987|ref|YP_004274641.1| preprotein translocase, SecE subunit [Pedobacter saltans DSM 12145] gi|324973835|gb|ADY52819.1| preprotein translocase, SecE subunit [Pedobacter saltans DSM 12145] Length = 64 Score = 37.1 bits (85), Expect = 0.91, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 7 AVLNFFKQVRDESK-KIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K+ E K K+ WP+ SE+ S ++ ++ I ++ +D+S G L+ I Sbjct: 3 NFAEYIKESFTELKEKVTWPTWSELQNSAVITLVAALIIALIVFAMDESAGNLIKLI 59 >gi|49078050|gb|AAT49746.1| PA4276 [synthetic construct] Length = 123 Score = 37.1 bits (85), Expect = 0.92, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 34/62 (54%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A + K+ R E +K+ WPSR E + ++V+ ++ + ++ +D +GWL+ I Sbjct: 61 AKGQAFFSLAKEARVEIRKVVWPSRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSMI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|254458800|ref|ZP_05072224.1| preprotein translocase, SecE subunit [Campylobacterales bacterium GD 1] gi|207084566|gb|EDZ61854.1| preprotein translocase, SecE subunit [Campylobacterales bacterium GD 1] Length = 59 Score = 37.1 bits (85), Expect = 0.92, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 33/59 (55%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + + R E K+ +P++ +V + I V+I++++ + F ++D + +M ILG Sbjct: 1 MNLGTHIRNARSELTKVIFPTKGQVKQAYISVLIVVTVIAAFLALVDLFMSSVMSAILG 59 >gi|330837667|ref|YP_004412308.1| preprotein translocase, SecE subunit [Spirochaeta coccoides DSM 17374] gi|329749570|gb|AEC02926.1| preprotein translocase, SecE subunit [Spirochaeta coccoides DSM 17374] Length = 59 Score = 36.7 bits (84), Expect = 0.94, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ +FK+ R E KK+ WP R V+ S VV++ +++F VID + ++ I Sbjct: 3 KLIAYFKESRQEMKKVVWPGRDTVVASTKVVLVATVAAALFLGVIDFLLLQGLYLIF 59 >gi|290958182|ref|YP_003489364.1| preprotein translocase SecE subunit [Streptomyces scabiei 87.22] gi|260647708|emb|CBG70813.1| preprotein translocase SecE subunit [Streptomyces scabiei 87.22] Length = 96 Score = 36.7 bits (84), Expect = 0.95, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+++ VVI+ + I VID + ++ G Sbjct: 42 FYRQIIAELRKVVWPTRAQLTTYTSVVIVFVVIMIGLVTVIDFGLDKAAKYVFG 95 >gi|167764385|ref|ZP_02436510.1| hypothetical protein BACSTE_02769 [Bacteroides stercoris ATCC 43183] gi|218131351|ref|ZP_03460155.1| hypothetical protein BACEGG_02962 [Bacteroides eggerthii DSM 20697] gi|317476378|ref|ZP_07935627.1| preprotein translocase [Bacteroides eggerthii 1_2_48FAA] gi|329956684|ref|ZP_08297257.1| preprotein translocase, SecE subunit [Bacteroides clarus YIT 12056] gi|167697790|gb|EDS14369.1| hypothetical protein BACSTE_02769 [Bacteroides stercoris ATCC 43183] gi|217986283|gb|EEC52620.1| hypothetical protein BACEGG_02962 [Bacteroides eggerthii DSM 20697] gi|316907404|gb|EFV29109.1| preprotein translocase [Bacteroides eggerthii 1_2_48FAA] gi|328524056|gb|EGF51132.1| preprotein translocase, SecE subunit [Bacteroides clarus YIT 12056] Length = 62 Score = 36.7 bits (84), Expect = 0.95, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ +FK+ DE K+ WP+ SE+ S +VV+ + ++ +D LM F+ Sbjct: 3 KIVAYFKETYDELVHKVSWPTYSELTNSAVVVLYASLLIALVVFAMDFCFQHLMEFV 59 >gi|282889736|ref|ZP_06298275.1| hypothetical protein pah_c004o098 [Parachlamydia acanthamoebae str. Hall's coccus] gi|281500310|gb|EFB42590.1| hypothetical protein pah_c004o098 [Parachlamydia acanthamoebae str. Hall's coccus] Length = 87 Score = 36.7 bits (84), Expect = 0.96, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 3/65 (4%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V+ L+F ++ E +KI W S+ E+L +V+ + + ++D I F+ Sbjct: 19 VSSKKTLSFLDDIKAEFQKITWTSQEELLAYAKIVVGATFVFGIGIYMMDVLIQ---SFL 75 Query: 63 LGIGR 67 G+G Sbjct: 76 AGLGN 80 >gi|210632465|ref|ZP_03297393.1| hypothetical protein COLSTE_01295 [Collinsella stercoris DSM 13279] gi|210159560|gb|EEA90531.1| hypothetical protein COLSTE_01295 [Collinsella stercoris DSM 13279] Length = 85 Score = 36.7 bits (84), Expect = 0.96, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 27/55 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + VR E K++ WP+++E++ I V + L + V ++D I + + Sbjct: 29 YMASVRSEMKRVVWPTKNELVNYTIAVCVSLVVVGVAIALLDIVISEGLVLFASL 83 >gi|184200229|ref|YP_001854436.1| preprotein translocase SecE subunit [Kocuria rhizophila DC2201] gi|183580459|dbj|BAG28930.1| preprotein translocase SecE subunit [Kocuria rhizophila DC2201] Length = 88 Score = 36.7 bits (84), Expect = 0.96, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 33/60 (55%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 + F +QV E KK+ PSR E++ V+VV++ ++ V ++D G L ++ G G Sbjct: 26 IWLFIRQVVGELKKVVTPSRRELVNYVLVVLVFVAFMMVLISLLDLGFGQLAIWLFGNGN 85 >gi|85858132|ref|YP_460334.1| protein translocase subunit [Syntrophus aciditrophicus SB] gi|85721223|gb|ABC76166.1| protein translocase subunit [Syntrophus aciditrophicus SB] Length = 71 Score = 36.7 bits (84), Expect = 0.97, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 30/55 (54%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F K + E KK+ WP+ + L S VVI+++ I S F ++D + + +LG Sbjct: 17 QFLKGAKTELKKVTWPTPKQTLASTSVVIVVVIIVSTFLGIVDFGLAKTIKLVLG 71 >gi|88606977|ref|YP_505589.1| preprotein translocase subunit SecE [Anaplasma phagocytophilum HZ] gi|88598040|gb|ABD43510.1| preprotein translocase, SecE subunit [Anaplasma phagocytophilum HZ] Length = 66 Score = 36.7 bits (84), Expect = 0.98, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 35/59 (59%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F V+ E ++ W SR EVLV ++VVI+ +++SSV F +D L+ +LG+ Sbjct: 4 SFAKFLLDVKQEVYQVSWASRKEVLVFLLVVILTVALSSVLFSCVDFVFLRLVKVMLGV 62 >gi|7481911|pir||T11787 probable protein translocase secE - Streptomyces virginiae gi|849061|dbj|BAA09300.1| SecE like protein [Streptomyces virginiae] Length = 121 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+++ VVI+ + I VID + F+ G Sbjct: 68 FYRQIVAELRKVVWPTRNQLTTYTTVVIVFVVIMIGLVTVIDFGFEKAIKFVFG 121 >gi|150008880|ref|YP_001303623.1| putative preprotein translocase SecE subunit [Parabacteroides distasonis ATCC 8503] gi|255014708|ref|ZP_05286834.1| putative preprotein translocase SecE subunit [Bacteroides sp. 2_1_7] gi|256841126|ref|ZP_05546633.1| preprotein translocase, SecE subunit [Parabacteroides sp. D13] gi|262383753|ref|ZP_06076889.1| preprotein translocase, SecE subunit [Bacteroides sp. 2_1_33B] gi|298375891|ref|ZP_06985847.1| preprotein translocase, SecE subunit [Bacteroides sp. 3_1_19] gi|301311925|ref|ZP_07217847.1| preprotein translocase, SecE subunit [Bacteroides sp. 20_3] gi|149937304|gb|ABR44001.1| putative preprotein translocase SecE subunit [Parabacteroides distasonis ATCC 8503] gi|256736969|gb|EEU50296.1| preprotein translocase, SecE subunit [Parabacteroides sp. D13] gi|262294651|gb|EEY82583.1| preprotein translocase, SecE subunit [Bacteroides sp. 2_1_33B] gi|298266928|gb|EFI08585.1| preprotein translocase, SecE subunit [Bacteroides sp. 3_1_19] gi|300830027|gb|EFK60675.1| preprotein translocase, SecE subunit [Bacteroides sp. 20_3] Length = 64 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ + K+ +E K+ WP+R+E+ S +VV+ I + V+D + +M F Sbjct: 3 KIITYIKESYNELVYKVSWPTRAELSNSAVVVMFASLIIAALIFVVDGAFEAVMRFFYN 61 >gi|227894580|ref|ZP_04012385.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Lactobacillus ultunensis DSM 16047] gi|227863571|gb|EEJ70992.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Lactobacillus ultunensis DSM 16047] Length = 56 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 24/55 (43%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FFK V E K + WPS + + VI + + + +D WL I+ Sbjct: 2 IKFFKSVVKEMKMVTWPSAKQNRHDTMTVITSSVLFAAYLGALDWLFSWLTQKIM 56 >gi|254383189|ref|ZP_04998543.1| SecE protein [Streptomyces sp. Mg1] gi|194342088|gb|EDX23054.1| SecE protein [Streptomyces sp. Mg1] Length = 114 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+++ VVI+ + I VID + F+ G Sbjct: 61 FYRQIVAELRKVVWPTRNQLTTYTTVVIVFVVIMIGLVTVIDYGFQQAIKFVFG 114 >gi|15599472|ref|NP_252966.1| preprotein translocase subunit SecE [Pseudomonas aeruginosa PAO1] gi|116054414|ref|YP_788843.1| preprotein translocase subunit SecE [Pseudomonas aeruginosa UCBPP-PA14] gi|152984987|ref|YP_001346210.1| preprotein translocase subunit SecE [Pseudomonas aeruginosa PA7] gi|218889396|ref|YP_002438260.1| preprotein translocase subunit SecE [Pseudomonas aeruginosa LESB58] gi|254237136|ref|ZP_04930459.1| secretion protein SecE [Pseudomonas aeruginosa C3719] gi|296387167|ref|ZP_06876666.1| preprotein translocase subunit SecE [Pseudomonas aeruginosa PAb1] gi|81622113|sp|Q9HWC3|SECE_PSEAE RecName: Full=Preprotein translocase subunit secE gi|9950495|gb|AAG07664.1|AE004843_6 secretion protein SecE [Pseudomonas aeruginosa PAO1] gi|115589635|gb|ABJ15650.1| secretion protein SecE [Pseudomonas aeruginosa UCBPP-PA14] gi|126169067|gb|EAZ54578.1| secretion protein SecE [Pseudomonas aeruginosa C3719] gi|150960145|gb|ABR82170.1| preprotein translocase, SecE subunit [Pseudomonas aeruginosa PA7] gi|218769619|emb|CAW25379.1| secretion protein SecE [Pseudomonas aeruginosa LESB58] Length = 122 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 34/62 (54%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A + K+ R E +K+ WPSR E + ++V+ ++ + ++ +D +GWL+ I Sbjct: 61 AKGQAFFSLAKEARVEIRKVVWPSRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSMI 120 Query: 63 LG 64 +G Sbjct: 121 VG 122 >gi|255011629|ref|ZP_05283755.1| putative preprotein translocase SecE subunit [Bacteroides fragilis 3_1_12] Length = 87 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V+ + K+ DE K+ WP+ SE+ S +VV+ + ++ +D M I+ Sbjct: 27 KVVAYIKESYDELVHKVSWPTYSELTNSAVVVLYASLLIALVVFAMDFCFQNFMEKII 84 >gi|222823473|ref|YP_002575047.1| preprotein translocase, SecE subunit [Campylobacter lari RM2100] gi|222538695|gb|ACM63796.1| preprotein translocase, SecE subunit [Campylobacter lari RM2100] Length = 60 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ +FK + E K+ WP + +V + I V +++++ S+F ++D + + + I+G Sbjct: 3 KLITYFKLSKAELGKVIWPLKEQVRNAYITVFVVVTVVSLFLALVDLIMSFSLSKIIG 60 >gi|325269553|ref|ZP_08136169.1| preprotein translocase SecE subunit [Prevotella multiformis DSM 16608] gi|324988172|gb|EGC20139.1| preprotein translocase SecE subunit [Prevotella multiformis DSM 16608] Length = 63 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 7 AVLNFFKQVRDESK-KIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++N+ K DE K WPSR+++ S +VV+ + ++ +D +M F+ Sbjct: 4 KIVNYCKDCYDELAHKTTWPSRAQLTHSAMVVLTASLVIALVVFAMDSVFQHVMGFV 60 >gi|269959045|ref|YP_003328834.1| preprotein translocase subunit SecE [Anaplasma centrale str. Israel] gi|269848876|gb|ACZ49520.1| preprotein translocase subunit SecE [Anaplasma centrale str. Israel] Length = 70 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 33/56 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F VR E ++ W S+ EVLV +++V++ + +SS+ F +D L+ +LG+ Sbjct: 11 RFLCDVRQEVLQVSWASKREVLVFLLIVLMTVVVSSILFSCVDFVFLRLVKIVLGV 66 >gi|325280614|ref|YP_004253156.1| preprotein translocase, SecE subunit [Odoribacter splanchnicus DSM 20712] gi|324312423|gb|ADY32976.1| preprotein translocase, SecE subunit [Odoribacter splanchnicus DSM 20712] Length = 63 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 6 LAVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + +F V +E K+ WPS SE+ S +V+I I ++ V+D S +M FI Sbjct: 1 MKIKAYFADVYNELVNKVSWPSWSELQSSATIVMIASVIIAIGIFVMDFSFRHIMDFIYS 60 Query: 65 I 65 + Sbjct: 61 M 61 >gi|217035349|pdb|3BO0|B Chain B, Ribosome-Secy Complex gi|217035356|pdb|3BO1|B Chain B, Ribosome-Secy Complex gi|290560331|pdb|3KCR|B Chain B, Ribosome-Secy Complex. This Entry 3kcr Contains 50s Ribosomal Subnit. The 30s Ribosomal Subunit Can Be Found In Pdb Entry 3kc4 Length = 65 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 26/62 (41%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A + F ++ R E +K+ WP+R + V + ++ +I I +I Sbjct: 2 KGKATVAFAREARTEVRKVIWPTRKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIK 61 Query: 64 GI 65 GI Sbjct: 62 GI 63 >gi|329121896|ref|ZP_08250510.1| preprotein translocase [Dialister micraerophilus DSM 19965] gi|327467693|gb|EGF13189.1| preprotein translocase [Dialister micraerophilus DSM 19965] Length = 77 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 34/61 (55%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 A+ FF+ + E KK+ WP++ +++ +I VI+ + + S +V+D + L F++ Sbjct: 14 KSAAMTGFFRGTKMEMKKVIWPTKQQMIQYLIAVIVSVVLVSFLIVVVDFAFMALSKFLV 73 Query: 64 G 64 Sbjct: 74 S 74 >gi|160888412|ref|ZP_02069415.1| hypothetical protein BACUNI_00825 [Bacteroides uniformis ATCC 8492] gi|270294765|ref|ZP_06200966.1| preprotein translocase, SecE subunit [Bacteroides sp. D20] gi|317477764|ref|ZP_07936957.1| preprotein translocase [Bacteroides sp. 4_1_36] gi|319900911|ref|YP_004160639.1| preprotein translocase, SecE subunit [Bacteroides helcogenes P 36-108] gi|156862089|gb|EDO55520.1| hypothetical protein BACUNI_00825 [Bacteroides uniformis ATCC 8492] gi|270274012|gb|EFA19873.1| preprotein translocase, SecE subunit [Bacteroides sp. D20] gi|316906109|gb|EFV27870.1| preprotein translocase [Bacteroides sp. 4_1_36] gi|319415942|gb|ADV43053.1| preprotein translocase, SecE subunit [Bacteroides helcogenes P 36-108] Length = 62 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ +FK+ DE K+ WP+ SE+ S +VV+ + +V +D LM F+ Sbjct: 3 KIVAYFKETYDELVHKVSWPTYSELTNSAVVVLYASLLIAVVVFAMDFCFQHLMEFV 59 >gi|33860766|ref|NP_892327.1| preprotein translocase subunit SecE [Prochlorococcus marinus subsp. pastoris str. CCMP1986] gi|33633708|emb|CAE18665.1| putative preprotein translocase, SecE subunit [Prochlorococcus marinus subsp. pastoris str. CCMP1986] Length = 79 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 26/54 (48%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 NF DE K + WP++ ++ I VIIM+S S+ + + GW I Sbjct: 25 NFLTSTFDELKLVVWPNKQQLFSESIAVIIMVSFSAAAIASVSRFYGWAASQIF 78 >gi|330997391|ref|ZP_08321242.1| preprotein translocase, SecE subunit [Paraprevotella xylaniphila YIT 11841] gi|329570765|gb|EGG52481.1| preprotein translocase, SecE subunit [Paraprevotella xylaniphila YIT 11841] Length = 63 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + + K+ DE K WP+RSE+ S +VV+ + ++ +D M I Sbjct: 4 KIFKYCKESYDELVHKTTWPTRSELTNSAVVVLSASLLIALVVFAMDFVFQSAMEVI 60 >gi|262038184|ref|ZP_06011578.1| preprotein translocase, SecE subunit [Leptotrichia goodfellowii F0264] gi|261747765|gb|EEY35210.1| preprotein translocase, SecE subunit [Leptotrichia goodfellowii F0264] Length = 59 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 17/48 (35%), Positives = 29/48 (60%) Query: 18 ESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 E KKI+WP+RSEV I+V+++ +++ LV D L++ + I Sbjct: 4 EYKKIYWPNRSEVFHVTIIVLLITLFIALYILVFDNVFDLLLNRLTQI 51 >gi|68171886|ref|ZP_00545212.1| SecE subunit of protein translocation complex [Ehrlichia chaffeensis str. Sapulpa] gi|88657595|ref|YP_507746.1| preprotein translocase subunit SecE [Ehrlichia chaffeensis str. Arkansas] gi|67998697|gb|EAM85423.1| SecE subunit of protein translocation complex [Ehrlichia chaffeensis str. Sapulpa] gi|88599052|gb|ABD44521.1| putative preprotein translocase, SecE subunit [Ehrlichia chaffeensis str. Arkansas] Length = 65 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F V+ E+ ++ W S++EV+ + +VI++++ SV F +D L+ +LG+ Sbjct: 3 NIAKFLLGVKQEALQVSWASKNEVIGFLFIVILIITFMSVLFCCVDFLFLKLIKIVLGV 61 >gi|302754036|ref|XP_002960442.1| hypothetical protein SELMODRAFT_402701 [Selaginella moellendorffii] gi|300171381|gb|EFJ37981.1| hypothetical protein SELMODRAFT_402701 [Selaginella moellendorffii] Length = 153 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 25/53 (47%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK+ E KI WPS + + + VI + + + +D +++ +L Sbjct: 101 FFKEQFSEFGKIEWPSFDNTVKTSLFVIALSFVLIIALTAMDSGYTFVLSKML 153 >gi|330505220|ref|YP_004382089.1| preprotein translocase subunit SecE [Pseudomonas mendocina NK-01] gi|328919506|gb|AEB60337.1| preprotein translocase subunit SecE [Pseudomonas mendocina NK-01] Length = 122 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 32/53 (60%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GWL+ I+G Sbjct: 70 LKEARVEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLISLIVG 122 >gi|323486267|ref|ZP_08091594.1| preprotein translocase [Clostridium symbiosum WAL-14163] gi|323693942|ref|ZP_08108128.1| preprotein translocase [Clostridium symbiosum WAL-14673] gi|323400412|gb|EGA92783.1| preprotein translocase [Clostridium symbiosum WAL-14163] gi|323501988|gb|EGB17864.1| preprotein translocase [Clostridium symbiosum WAL-14673] Length = 67 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 25/53 (47%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++K ++ E KKI WP + V V+ + + +D I +HF++ Sbjct: 15 YWKGLQAEYKKIIWPDKETVAKQTGAVVAVAIALGLIIAALDTIIVTGLHFVI 67 >gi|88856009|ref|ZP_01130671.1| preprotein translocase SecE subunit [marine actinobacterium PHSC20C1] gi|88814876|gb|EAR24736.1| preprotein translocase SecE subunit [marine actinobacterium PHSC20C1] Length = 93 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F +QV E KK+ P+R E++ +VV++ + I +D L++F+ G Sbjct: 34 FIRQVIGELKKVVTPTRRELVSFTVVVLVFVVIMMGIVSGLDFGFSALVNFLFG 87 >gi|288801075|ref|ZP_06406531.1| preprotein translocase, SecE subunit [Prevotella sp. oral taxon 299 str. F0039] gi|288332009|gb|EFC70491.1| preprotein translocase, SecE subunit [Prevotella sp. oral taxon 299 str. F0039] Length = 63 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 7 AVLNFFKQVRDESK-KIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++N+ K DE K WP+R+E+ S +VV+ I ++ +D ++M I Sbjct: 4 KIVNYCKTSYDELAHKTTWPTRAELTHSAMVVLSASLIIALLVFCMDSVFKFVMGTI 60 >gi|330879468|gb|EGH13617.1| preprotein translocase subunit SecE [Pseudomonas syringae pv. morsprunorum str. M302280PT] Length = 122 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 8/22 (36%), Positives = 13/22 (59%) Query: 13 KQVRDESKKIFWPSRSEVLVSV 34 K+ R E +K+ WP+R E + Sbjct: 71 KEARAEIRKVVWPARQETTQTT 92 >gi|224023594|ref|ZP_03641960.1| hypothetical protein BACCOPRO_00301 [Bacteroides coprophilus DSM 18228] gi|224016816|gb|EEF74828.1| hypothetical protein BACCOPRO_00301 [Bacteroides coprophilus DSM 18228] Length = 64 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + N+ K+ DE K+ WP+RSE+ S + V+ + ++ ++D + ++M ++ Sbjct: 4 TITNYCKESYDELVHKVSWPTRSELSGSAVAVLTASLLIALVVFLMDSAFQFIMEDVI 61 >gi|27904553|ref|NP_777679.1| preprotein translocase SecE subunit [Buchnera aphidicola str. Bp (Baizongia pistaciae)] gi|31340421|sp|Q89B14|SECE_BUCBP RecName: Full=Preprotein translocase subunit secE gi|27903950|gb|AAO26784.1| preprotein translocase SecE subunit [Buchnera aphidicola str. Bp (Baizongia pistaciae)] Length = 127 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 25/55 (45%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 F K E+K I WP+ + L VII+ + ++ +D + W + I + Sbjct: 71 FTKSAIHETKLITWPNFKDTLHVTFTVIIVTILLALILWGLDNILIWFISLITSL 125 >gi|296111501|ref|YP_003621883.1| putative protein translocase [Leuconostoc kimchii IMSNU 11154] gi|295833033|gb|ADG40914.1| putative protein translocase [Leuconostoc kimchii IMSNU 11154] Length = 57 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 26/56 (46%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 L +F+ V E K + W S+ + + VI + I ++F +D + FI+ Sbjct: 2 LKYFRNVATEMKNVTWLSQDQASKETVTVITVSVIFALFLGGVDWLLQSGFSFIMN 57 >gi|169350900|ref|ZP_02867838.1| hypothetical protein CLOSPI_01674 [Clostridium spiroforme DSM 1552] gi|169292486|gb|EDS74619.1| hypothetical protein CLOSPI_01674 [Clostridium spiroforme DSM 1552] Length = 78 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 11/51 (21%), Positives = 25/51 (49%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 K +R E K+I W S+ ++ + +V++ + ++F D I + + Sbjct: 25 LKGIRSEIKRISWLSKKQLAQNSAIVLLFCFVLGLYFFAGDAVIALIFKAL 75 >gi|149198909|ref|ZP_01875950.1| hypothetical protein LNTAR_19632 [Lentisphaera araneosa HTCC2155] gi|149137904|gb|EDM26316.1| hypothetical protein LNTAR_19632 [Lentisphaera araneosa HTCC2155] Length = 62 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 29/56 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 V + V +E K+ WP +SE++ S I+V+I + ++F D + L+ I Sbjct: 7 KVSKYTIDVVEELKRCSWPGKSELVQSSILVLITCILLAIFVQFADGILQKLIEAI 62 >gi|325261294|ref|ZP_08128032.1| preprotein translocase, SecE subunit [Clostridium sp. D5] gi|324032748|gb|EGB94025.1| preprotein translocase, SecE subunit [Clostridium sp. D5] Length = 66 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 12/63 (19%), Positives = 28/63 (44%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + ++FK ++ E KK+ WP + + V+ + + V VID + + + Sbjct: 4 KTAKTQKKSWFKGLQAEFKKVIWPDKKTLAKQTTAVVSVSLLLGVLISVIDAILKYGIDL 63 Query: 62 ILG 64 ++ Sbjct: 64 LVK 66 >gi|297620823|ref|YP_003708960.1| putative preprotein translocase SecE [Waddlia chondrophila WSU 86-1044] gi|297376124|gb|ADI37954.1| putative preprotein translocase SecE [Waddlia chondrophila WSU 86-1044] Length = 92 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 26/56 (46%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NF +V+ E KKI W + E+ V VV+ I + L +D I + + G Sbjct: 30 FNFLGEVKQEFKKISWTDKDELKVYTKVVVAFTFIFGMSVLFVDVIIQQALAGLNG 85 >gi|227499795|ref|ZP_03929890.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Anaerococcus tetradius ATCC 35098] gi|227218099|gb|EEI83367.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Anaerococcus tetradius ATCC 35098] Length = 60 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 27/53 (50%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF V E KKI WP++ ++I M + ++V ++D+ L+ I+ Sbjct: 8 FFSGVSKEFKKIQWPTKKISFEYSWMIIAMSATTAVAIWLLDKVFQALLQIIM 60 >gi|268608957|ref|ZP_06142684.1| hypothetical protein RflaF_05604 [Ruminococcus flavefaciens FD-1] Length = 125 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 34/56 (60%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + +FK +R E KK+ WPS+ V+ + VV+ ++++S++ ++D+ L+ I Sbjct: 68 KLAKWFKDLRIEFKKVVWPSKETVVTNTSVVVGVIALSAILVGLLDEGFLALIRLI 123 >gi|206896032|ref|YP_002247283.1| preprotein translocase, SecE subunit [Coprothermobacter proteolyticus DSM 5265] gi|206738649|gb|ACI17727.1| preprotein translocase, SecE subunit [Coprothermobacter proteolyticus DSM 5265] Length = 67 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 31/57 (54%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + NFF+ + E ++ WPSR + + +V+ +++ I +V ++D L+ ++ Sbjct: 11 IKNFFRSAKVELGRVSWPSREQTVNAVLAILVFSGIWAVLVTLLDLGFARLLPLLVK 67 >gi|224537803|ref|ZP_03678342.1| hypothetical protein BACCELL_02690 [Bacteroides cellulosilyticus DSM 14838] gi|224520623|gb|EEF89728.1| hypothetical protein BACCELL_02690 [Bacteroides cellulosilyticus DSM 14838] Length = 63 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ +FK+ DE K+ WP+ SE+ S +VV+ + ++ +D +M I+ Sbjct: 3 KIVAYFKETYDELVHKVSWPTYSELTNSAVVVLYASLLIALVVFAMDFCFQNVMEKII 60 >gi|318040712|ref|ZP_07972668.1| preprotein translocase subunit SecE [Synechococcus sp. CB0101] Length = 53 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 26/47 (55%) Query: 17 DESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 E +K+ WPSR ++ + VI+M+++S+ ID+ W+ + Sbjct: 6 AELRKVVWPSRQQLFAESVAVILMVTLSAFAIAAIDRFYSWVNAQVF 52 >gi|32491265|ref|NP_871519.1| hypothetical protein WGLp516 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] gi|25166472|dbj|BAC24662.1| secE [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] Length = 127 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 31/58 (53%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 VLNF ++ E KK+ WPS E L + ++V ++ I S+ +D + + FI + Sbjct: 68 VLNFIQESLKEIKKVAWPSLQETLQTTLIVSLVTVIMSLLLWGLDSLLIRAISFITSL 125 >gi|261880901|ref|ZP_06007328.1| conserved hypothetical protein [Prevotella bergensis DSM 17361] gi|270332409|gb|EFA43195.1| conserved hypothetical protein [Prevotella bergensis DSM 17361] Length = 63 Score = 35.9 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 11/44 (25%), Positives = 22/44 (50%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K WP+R+E+ S ++V+ + ++ +D LM I Sbjct: 17 AHKTTWPTRAELTHSAVIVLSASLVIALVVFAMDFVFKNLMGVI 60 >gi|187776562|ref|ZP_02993035.1| hypothetical protein CLOSPO_00076 [Clostridium sporogenes ATCC 15579] gi|187775221|gb|EDU39023.1| hypothetical protein CLOSPO_00076 [Clostridium sporogenes ATCC 15579] Length = 75 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 26/63 (41%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + + FFK ++ E K+I W + +V + V++ + + V D L I Sbjct: 13 AKKKGLSGFFKDLKFEFKRITWAPKKDVKKATETVLVFCFVYMIIVGVFDYGFNNLFKLI 72 Query: 63 LGI 65 + Sbjct: 73 FKL 75 >gi|323465882|gb|ADX69569.1| Preprotein translocase, SecE subunit [Lactobacillus helveticus H10] Length = 55 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 23/54 (42%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + FFK + E K + WP+ + + VI + + + +D WL + Sbjct: 2 IKFFKSIAHEMKLVTWPTAKQNRHDTMTVITSSILFAAYLGALDWLFSWLTQKM 55 >gi|170759991|ref|YP_001788835.1| preprotein translocase subunit SecE [Clostridium botulinum A3 str. Loch Maree] gi|169406980|gb|ACA55391.1| preprotein translocase, SecE subunit [Clostridium botulinum A3 str. Loch Maree] Length = 75 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 26/63 (41%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 N+ + FF+ ++ E K+I W + +V + V+I + V D L I Sbjct: 13 ANKKGLSGFFRDLKFEFKRITWAPKKDVKKATETVLIFCFVYMAIVGVFDYGFNNLFKLI 72 Query: 63 LGI 65 + Sbjct: 73 FKL 75 >gi|237796956|ref|YP_002864508.1| preprotein translocase, SecE subunit [Clostridium botulinum Ba4 str. 657] gi|229261710|gb|ACQ52743.1| preprotein translocase, SecE subunit [Clostridium botulinum Ba4 str. 657] gi|322807820|emb|CBZ05395.1| preprotein translocase subunit SecE (TC 3.A.5.1.1) [Clostridium botulinum H04402 065] Length = 75 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF+ ++ E K+I W + +V + V+I + V V D L I + Sbjct: 21 FFRDLKFEFKRITWAPKKDVKKATETVLIFCFVYMVIVGVFDYGFNNLFKLIFKL 75 >gi|313884767|ref|ZP_07818522.1| preprotein translocase, SecE subunit [Eremococcus coleocola ACS-139-V-Col8] gi|312620028|gb|EFR31462.1| preprotein translocase, SecE subunit [Eremococcus coleocola ACS-139-V-Col8] Length = 57 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 29/55 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + K V E K++ WP+ EV + I+++ +F++ D + L+ +I+ + Sbjct: 3 YIKNVFREMKQVTWPTLKEVNNFTWIAILLIVFFGTYFVLTDFAFSNLLDWIVKL 57 >gi|119953186|ref|YP_945395.1| preprotein translocase subunit SecE [Borrelia turicatae 91E135] gi|119861957|gb|AAX17725.1| protein translocase subunit SecE [Borrelia turicatae 91E135] Length = 56 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 26/55 (47%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K+ E KKI WP EV+ S V ++ S+F ++D + + ++ Sbjct: 2 FKFVKESVLELKKITWPKYGEVIGSGKQVFWLVVFISIFLGIVDYIMYLAITYVF 56 >gi|283798906|ref|ZP_06348059.1| preprotein translocase, SecE subunit [Clostridium sp. M62/1] gi|291073369|gb|EFE10733.1| preprotein translocase, SecE subunit [Clostridium sp. M62/1] gi|295092663|emb|CBK78770.1| protein translocase subunit secE/sec61 gamma [Clostridium cf. saccharolyticum K10] gi|295115913|emb|CBL36760.1| protein translocase subunit secE/sec61 gamma [butyrate-producing bacterium SM4/1] Length = 67 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 25/53 (47%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F+K + E KKI WP + + VI + +D I +L+H+I+ Sbjct: 15 FWKGLEAEYKKIIWPDKETLQKETAAVIAGAVALGLIIAALDTGIVFLLHYII 67 >gi|168333283|ref|ZP_02691567.1| hypothetical protein Epulo_00365 [Epulopiscium sp. 'N.t. morphotype B'] Length = 59 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 25/52 (48%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FFK ESK+I WP+R E+ VI + + ++ + D G + + Sbjct: 4 FFKDFVAESKRIVWPNRKELFSKTSTVITLSILVAIILSIFDFLFGQCLVLL 55 >gi|325478527|gb|EGC81639.1| preprotein translocase, SecE subunit [Anaerococcus prevotii ACS-065-V-Col13] Length = 60 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 30/53 (56%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FF V E KKI WP++S + +VI + ++++V ++D+ L+ I+ Sbjct: 8 FFSGVSREFKKIQWPTKSTAVEYSSLVIAISAVTAVAIWLLDKIFQALLQVIM 60 >gi|296112478|ref|YP_003626416.1| protein translocase subunit SecE [Moraxella catarrhalis RH4] gi|295920172|gb|ADG60523.1| protein translocase subunit SecE [Moraxella catarrhalis RH4] gi|326561518|gb|EGE11861.1| preprotein translocase subunit SecE [Moraxella catarrhalis 7169] gi|326564355|gb|EGE14584.1| preprotein translocase subunit SecE [Moraxella catarrhalis 46P47B1] gi|326566154|gb|EGE16310.1| preprotein translocase subunit SecE [Moraxella catarrhalis 103P14B1] gi|326566164|gb|EGE16319.1| preprotein translocase subunit SecE [Moraxella catarrhalis 12P80B1] gi|326567988|gb|EGE18080.1| preprotein translocase subunit SecE [Moraxella catarrhalis BC7] gi|326570710|gb|EGE20744.1| preprotein translocase subunit SecE [Moraxella catarrhalis BC1] gi|326571265|gb|EGE21288.1| preprotein translocase subunit SecE [Moraxella catarrhalis BC8] gi|326573053|gb|EGE23026.1| preprotein translocase subunit SecE [Moraxella catarrhalis CO72] gi|326577249|gb|EGE27142.1| preprotein translocase subunit SecE [Moraxella catarrhalis 101P30B1] gi|326577812|gb|EGE27680.1| preprotein translocase subunit SecE [Moraxella catarrhalis O35E] Length = 157 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 25/52 (48%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 K E +++ WP++ E VI+++ I + ++D +++ I+ Sbjct: 106 LKDAGIELRRVTWPTKDETARYTWQVILIMIIFGIIIWLLDMFFSYIVGLII 157 >gi|148381435|ref|YP_001255976.1| preprotein translocase, SecE subunit [Clostridium botulinum A str. ATCC 3502] gi|153932781|ref|YP_001385810.1| preprotein translocase subunit SecE [Clostridium botulinum A str. ATCC 19397] gi|153937292|ref|YP_001389217.1| preprotein translocase subunit SecE [Clostridium botulinum A str. Hall] gi|168178818|ref|ZP_02613482.1| preprotein translocase, SecE subunit [Clostridium botulinum NCTC 2916] gi|170756293|ref|YP_001783135.1| preprotein translocase subunit SecE [Clostridium botulinum B1 str. Okra] gi|226950947|ref|YP_002806038.1| preprotein translocase, SecE subunit [Clostridium botulinum A2 str. Kyoto] gi|148290919|emb|CAL85055.1| preprotein translocase SecE subunit [Clostridium botulinum A str. ATCC 3502] gi|152928825|gb|ABS34325.1| preprotein translocase, SecE subunit [Clostridium botulinum A str. ATCC 19397] gi|152933206|gb|ABS38705.1| preprotein translocase, SecE subunit [Clostridium botulinum A str. Hall] gi|169121505|gb|ACA45341.1| preprotein translocase, SecE subunit [Clostridium botulinum B1 str. Okra] gi|182670166|gb|EDT82142.1| preprotein translocase, SecE subunit [Clostridium botulinum NCTC 2916] gi|226844319|gb|ACO86985.1| preprotein translocase, SecE subunit [Clostridium botulinum A2 str. Kyoto] Length = 75 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF+ ++ E K+I W + +V + V+I + V V D L I + Sbjct: 21 FFRDLKFEFKRITWAPKKDVKKATETVLIFCFVYMVIVGVFDYGFNNLFKLIFKL 75 >gi|163815636|ref|ZP_02207009.1| hypothetical protein COPEUT_01811 [Coprococcus eutactus ATCC 27759] gi|158449273|gb|EDP26268.1| hypothetical protein COPEUT_01811 [Coprococcus eutactus ATCC 27759] Length = 70 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 26/53 (49%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++++ E KI W + + + V++ + ++D I ++FI+G Sbjct: 18 FQELKGEFNKITWLDKKSLARQSVAVVLSTVVLGCIIAIVDWLIQIGLNFIVG 70 >gi|301168472|emb|CBW28062.1| putative preprotein translocase subunit [Bacteriovorax marinus SJ] Length = 128 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 27/59 (45%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++V E K+ WP + VL + ++I +SI S F++ID ++ + Sbjct: 69 KNKNASTHMQEVYSELVKVVWPDKDSVLKMTVGLVITVSIISGIFVLIDFLFRKVLELL 127 >gi|260588882|ref|ZP_05854795.1| preprotein translocase, SecE subunit [Blautia hansenii DSM 20583] gi|331083428|ref|ZP_08332540.1| preprotein translocase [Lachnospiraceae bacterium 6_1_63FAA] gi|260540661|gb|EEX21230.1| preprotein translocase, SecE subunit [Blautia hansenii DSM 20583] gi|330404121|gb|EGG83669.1| preprotein translocase [Lachnospiraceae bacterium 6_1_63FAA] Length = 67 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 12/50 (24%), Positives = 27/50 (54%) Query: 15 VRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++ E KK+ WP + ++ + V+ + ++ V VID I L++ ++ Sbjct: 18 LQAEFKKVIWPDKQTLVKQTVAVVSITAVVGVLIAVIDSGILQLLNLLIK 67 >gi|218283697|ref|ZP_03489658.1| hypothetical protein EUBIFOR_02252 [Eubacterium biforme DSM 3989] gi|218215686|gb|EEC89224.1| hypothetical protein EUBIFOR_02252 [Eubacterium biforme DSM 3989] Length = 65 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 27/52 (51%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +V E K + WP+ E++ S +VI+ + ++F V + L+ I+G Sbjct: 13 SKVFKELKTVKWPTFKELMSSSALVIVFTVLFGLYFFVCEVLSSGLVKMIVG 64 >gi|323342432|ref|ZP_08082664.1| preprotein translocase subunit SecE [Erysipelothrix rhusiopathiae ATCC 19414] gi|322463544|gb|EFY08738.1| preprotein translocase subunit SecE [Erysipelothrix rhusiopathiae ATCC 19414] Length = 60 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 12/51 (23%), Positives = 26/51 (50%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F +++E KI WP+R E+ + +V+ + +FL+ + + + I Sbjct: 6 FAGIKEEIHKIKWPTRKEMTRNTTIVLCFVLFFVAYFLLTEVVLVAALKLI 56 >gi|325853511|ref|ZP_08171343.1| preprotein translocase, SecE subunit [Prevotella denticola CRIS 18C-A] gi|327313169|ref|YP_004328606.1| preprotein translocase subunit SecE [Prevotella denticola F0289] gi|325484315|gb|EGC87243.1| preprotein translocase, SecE subunit [Prevotella denticola CRIS 18C-A] gi|326944075|gb|AEA19960.1| preprotein translocase, SecE subunit [Prevotella denticola F0289] Length = 63 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 7 AVLNFFKQVRDESK-KIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++N+ K DE K WPSR+++ S +VV+ + ++ +D +M+F+ Sbjct: 4 KIVNYCKDCYDELAHKTTWPSRAQLTHSAMVVLTASLVIALVVFAMDFVFQHVMNFV 60 >gi|187918261|ref|YP_001883824.1| preprotein translocase subunit SecE [Borrelia hermsii DAH] gi|119861109|gb|AAX16904.1| protein translocase subunit SecE [Borrelia hermsii DAH] Length = 56 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 26/55 (47%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K+ E KKI WP EV+ S V ++ S+F ++D + + ++ Sbjct: 2 FKFVKESVLELKKITWPKYGEVIGSGKQVFWLVVFISIFLGIVDYIMYLAIAYVF 56 >gi|28493683|ref|NP_787844.1| hypothetical protein TWT716 [Tropheryma whipplei str. Twist] gi|28476725|gb|AAO44813.1| unknown [Tropheryma whipplei str. Twist] Length = 80 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 26/57 (45%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++NF ++V E K+ P+R V+ +V I + + +D L+ LG Sbjct: 21 IVNFLREVFQELSKVTVPTRRAVVSFSFMVSIFVIVVIGLVAFVDWIFALLLTLALG 77 >gi|111115224|ref|YP_709842.1| preprotein translocase subunit SecE [Borrelia afzelii PKo] gi|110890498|gb|ABH01666.1| preprotein translocase subunit [Borrelia afzelii PKo] Length = 56 Score = 35.6 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 27/55 (49%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K E KK+ WP +EV+ + V ++ S+F ++D + ++ ++ Sbjct: 2 FRFIKDSILELKKVTWPKYNEVVENGKQVFWLVLFVSIFLGIVDYLMFLVVTYVF 56 >gi|86739280|ref|YP_479680.1| SecE subunit of protein translocation complex [Frankia sp. CcI3] gi|86566142|gb|ABD09951.1| SecE subunit of protein translocation complex [Frankia sp. CcI3] Length = 82 Score = 35.6 bits (81), Expect = 2.1, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 33/57 (57%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 L F ++V E +K+ +P RSE++ V+VV++ +S+ + F +D + + I G Sbjct: 26 PLVFIREVMAELRKVVYPGRSELITYVLVVLVFVSVMTAFVATLDFGLTKAVLAIFG 82 >gi|297587476|ref|ZP_06946120.1| preprotein translocase [Finegoldia magna ATCC 53516] gi|297574165|gb|EFH92885.1| preprotein translocase [Finegoldia magna ATCC 53516] Length = 72 Score = 35.6 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 26/53 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K V+ E KI WP+ E L IVV+I+ I ++ +D L+ + Sbjct: 20 FLKGVKTEWNKIVWPTPKETLEYSIVVVIISFIVALIVYGLDTVFQRLIGLFI 72 >gi|169824234|ref|YP_001691845.1| preprotein translocase SecE subunit [Finegoldia magna ATCC 29328] gi|302380906|ref|ZP_07269368.1| preprotein translocase, SecE subunit [Finegoldia magna ACS-171-V-Col3] gi|167831039|dbj|BAG07955.1| preprotein translocase SecE subunit [Finegoldia magna ATCC 29328] gi|302311284|gb|EFK93303.1| preprotein translocase, SecE subunit [Finegoldia magna ACS-171-V-Col3] Length = 72 Score = 35.6 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 26/53 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K V+ E KI WP+ E L +VV+I+ I ++ +D L+ + Sbjct: 20 FLKGVKTEWNKIVWPTPKETLEYSVVVVIISFIVALIVYGLDTVFQRLIGLFI 72 >gi|51598652|ref|YP_072840.1| preprotein translocase subunit SecE [Borrelia garinii PBi] gi|51573223|gb|AAU07248.1| preprotein translocase subunit [Borrelia garinii PBi] Length = 56 Score = 35.6 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 27/55 (49%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K E KK+ WP +EV+ + V ++ S+F V+D + ++ ++ Sbjct: 2 FRFIKDSILELKKVTWPKYNEVVENGKQVFWLVLFVSIFLGVVDYLMFLVVTYVF 56 >gi|153005088|ref|YP_001379413.1| preprotein translocase, SecE subunit [Anaeromyxobacter sp. Fw109-5] gi|152028661|gb|ABS26429.1| preprotein translocase, SecE subunit [Anaeromyxobacter sp. Fw109-5] Length = 130 Score = 35.6 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 25/49 (51%) Query: 14 QVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +V E +++ WPS E + + VI+ +I++V V D WL + Sbjct: 81 EVALELRRVTWPSLRETRAATVAVIVASTIAAVILGVFDFVWSWLSSKV 129 >gi|153941396|ref|YP_001392848.1| preprotein translocase subunit SecE [Clostridium botulinum F str. Langeland] gi|152937292|gb|ABS42790.1| preprotein translocase, SecE subunit [Clostridium botulinum F str. Langeland] gi|295320827|gb|ADG01205.1| preprotein translocase, SecE subunit [Clostridium botulinum F str. 230613] Length = 75 Score = 35.6 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FF+ ++ E K+I W + +V + V+I + V V D L I + Sbjct: 21 FFRDLKFEFKRITWAPKKDVKKATETVLIFCFVYMVIVGVFDYGFNNLFKLIFKL 75 >gi|254446553|ref|ZP_05060029.1| preprotein translocase, SecE subunit [Verrucomicrobiae bacterium DG1235] gi|198260861|gb|EDY85169.1| preprotein translocase, SecE subunit [Verrucomicrobiae bacterium DG1235] Length = 67 Score = 35.6 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 31/61 (50%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M ++ F + E KK WPS SE+ S VV+I ++I +F V D SI +++ Sbjct: 1 MKNPFRSIRIFTSETITELKKASWPSVSELRESTFVVLIAIAIMGLFVAVADFSIANVVN 60 Query: 61 F 61 Sbjct: 61 L 61 >gi|260585127|ref|ZP_05852868.1| preprotein translocase, SecE subunit [Granulicatella elegans ATCC 700633] gi|260157215|gb|EEW92290.1| preprotein translocase, SecE subunit [Granulicatella elegans ATCC 700633] Length = 56 Score = 35.6 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F V E K++ WP+ EV + V++ + ++ FF V+D +I I+ Sbjct: 1 MRFLVNVVKEMKRVTWPTGKEVNKYTLTVVMAVLLALGFFTVVDFAIASAFKLIIK 56 >gi|15594740|ref|NP_212529.1| preprotein translocase subunit SecE [Borrelia burgdorferi B31] gi|195941255|ref|ZP_03086637.1| preprotein translocase subunit SecE [Borrelia burgdorferi 80a] gi|216264835|ref|ZP_03436827.1| preprotein translocase, SecE subunit [Borrelia burgdorferi 156a] gi|224533685|ref|ZP_03674273.1| preprotein translocase, SecE subunit [Borrelia burgdorferi CA-11.2a] gi|3914964|sp|O51356|SECE_BORBU RecName: Full=Preprotein translocase subunit secE gi|2688302|gb|AAC66770.1| preprotein translocase subunit (secE) [Borrelia burgdorferi B31] gi|215981308|gb|EEC22115.1| preprotein translocase, SecE subunit [Borrelia burgdorferi 156a] gi|224512978|gb|EEF83341.1| preprotein translocase, SecE subunit [Borrelia burgdorferi CA-11.2a] gi|312148500|gb|ADQ31159.1| preprotein translocase, SecE subunit [Borrelia burgdorferi JD1] gi|312149448|gb|ADQ29519.1| preprotein translocase, SecE subunit [Borrelia burgdorferi N40] Length = 56 Score = 35.6 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 27/55 (49%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K E KK+ WP +EV+ + V ++ S+F ++D + ++ ++ Sbjct: 2 FRFIKDSILELKKVTWPKYNEVVGNGKQVFWLVLFVSIFLGIVDYLMFLVVTYVF 56 >gi|294674796|ref|YP_003575412.1| preprotein translocase subunit SecE [Prevotella ruminicola 23] gi|294472484|gb|ADE81873.1| preprotein translocase, SecE subunit [Prevotella ruminicola 23] Length = 63 Score = 35.6 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 21/44 (47%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K WPSR E+ S +VV+ I ++ +D +M + Sbjct: 17 AHKTTWPSRKELTHSAVVVLSASLIIALVVWAMDFVFKSVMSMV 60 >gi|189465405|ref|ZP_03014190.1| hypothetical protein BACINT_01758 [Bacteroides intestinalis DSM 17393] gi|189437679|gb|EDV06664.1| hypothetical protein BACINT_01758 [Bacteroides intestinalis DSM 17393] Length = 63 Score = 35.6 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ + K+ DE K+ WP+ SE+ S +VV+ + ++ +D +M I+ Sbjct: 3 KIVAYIKETYDELVHKVSWPTYSELTNSAVVVLYASLLIALVVFAMDFCFQNVMEKII 60 >gi|303234904|ref|ZP_07321529.1| preprotein translocase, SecE subunit [Finegoldia magna BVS033A4] gi|302494022|gb|EFL53803.1| preprotein translocase, SecE subunit [Finegoldia magna BVS033A4] Length = 72 Score = 35.6 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 26/53 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F K V+ E KI WP+ E L +VV+I+ I ++ +D L+ + Sbjct: 20 FLKGVKTEWNKIVWPTPKETLEYSVVVVIISFIVALIVYGLDTVFQRLIGLFI 72 >gi|113954615|ref|YP_731917.1| preprotein translocase subunit SecE [Synechococcus sp. CC9311] gi|113881966|gb|ABI46924.1| preprotein translocase, SecE subunit [Synechococcus sp. CC9311] Length = 79 Score = 35.6 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 26/53 (49%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F +E K + WPSR ++ + VI+M+S+S+ + + GW + Sbjct: 26 FLAATFEELKLVVWPSRQQLFSESVAVILMVSLSAAAISALSRFYGWAASQVF 78 >gi|320527650|ref|ZP_08028824.1| preprotein translocase, SecE subunit [Solobacterium moorei F0204] gi|320131971|gb|EFW24527.1| preprotein translocase, SecE subunit [Solobacterium moorei F0204] Length = 98 Score = 35.6 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 7/55 (12%) Query: 18 ESKKIFWP------SRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 E+K++ WP S L + V++ ++FF++ D + +LM + GIG Sbjct: 44 EAKRVRWPHWTNQGSEEGTLQNTGEVLVFTIFFALFFVLCDLGVAYLMK-VFGIG 97 >gi|154148329|ref|YP_001407186.1| preprotein translocase subunit SecE [Campylobacter hominis ATCC BAA-381] gi|153804338|gb|ABS51345.1| preprotein translocase, SecE subunit [Campylobacter hominis ATCC BAA-381] Length = 59 Score = 35.6 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 31/54 (57%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ Q + E K+ +P++ + + I V I++++ S+F ++D + + + ++ Sbjct: 6 EYYIQSKTELDKVVFPTKGQTKNAYITVFIVVAVISLFLALVDLMMSFFVSSVV 59 >gi|255527828|ref|ZP_05394677.1| preprotein translocase, SecE subunit [Clostridium carboxidivorans P7] gi|296187252|ref|ZP_06855648.1| preprotein translocase, SecE subunit [Clostridium carboxidivorans P7] gi|255508469|gb|EET84860.1| preprotein translocase, SecE subunit [Clostridium carboxidivorans P7] gi|296048123|gb|EFG87561.1| preprotein translocase, SecE subunit [Clostridium carboxidivorans P7] Length = 76 Score = 35.6 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 29/63 (46%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + + +NFF ++ E+K+I W S+ +V + V+I I V ++D L Sbjct: 14 AASGNSFINFFIDLKAETKRITWASKEKVKKATATVLIFCLIYIVIVGLLDVGFKNLFSV 73 Query: 62 ILG 64 I Sbjct: 74 IFK 76 >gi|312200034|ref|YP_004020095.1| preprotein translocase, SecE subunit [Frankia sp. EuI1c] gi|311231370|gb|ADP84225.1| preprotein translocase, SecE subunit [Frankia sp. EuI1c] Length = 82 Score = 35.2 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 37/63 (58%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 G R+ L F+++V E +K+ +P R+E++ V+VV++ +S+ + +D + L+ Sbjct: 20 GRRRMTPLRFYREVVAELRKVIYPGRTELVTYVVVVLVFVSVMTAIVASLDFGLTKLVLQ 79 Query: 62 ILG 64 I G Sbjct: 80 IFG 82 >gi|121592081|ref|ZP_01679063.1| preprotein translocase, SecE subunit [Vibrio cholerae 2740-80] gi|121546219|gb|EAX56539.1| preprotein translocase, SecE subunit [Vibrio cholerae 2740-80] Length = 47 Score = 35.2 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 10/46 (21%), Positives = 25/46 (54%) Query: 20 KKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ WP+R E + + ++V+ + + ++ ID + L+ F G+ Sbjct: 2 SQVVWPTRQETMQTTLIVLAVSIVMALALWGIDGIMVRLVAFATGV 47 >gi|255326800|ref|ZP_05367876.1| preprotein translocase SecE subunit [Rothia mucilaginosa ATCC 25296] gi|255296017|gb|EET75358.1| preprotein translocase SecE subunit [Rothia mucilaginosa ATCC 25296] Length = 92 Score = 35.2 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 26/59 (44%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + F ++V E KK+ P+ E++ V+ + + + +D G +I G G Sbjct: 29 IFAFLREVFAELKKVTTPTGRELVGYFFGVLFFVVVMLLLISGLDYLFGQGAFWIFGNG 87 >gi|116491405|ref|YP_810949.1| protein translocase subunit secE/sec61 gamma [Oenococcus oeni PSU-1] gi|118586218|ref|ZP_01543683.1| preprotein translocase subunit [Oenococcus oeni ATCC BAA-1163] gi|290890973|ref|ZP_06554037.1| hypothetical protein AWRIB429_1427 [Oenococcus oeni AWRIB429] gi|116092130|gb|ABJ57284.1| protein translocase subunit secE/sec61 gamma [Oenococcus oeni PSU-1] gi|118433347|gb|EAV40048.1| preprotein translocase subunit [Oenococcus oeni ATCC BAA-1163] gi|290479372|gb|EFD88032.1| hypothetical protein AWRIB429_1427 [Oenococcus oeni AWRIB429] Length = 58 Score = 35.2 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 24/56 (42%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + K +E K + W + E VII S F ++D +G + F++ Sbjct: 2 IRYIKGTIEEMKNVTWLNGDETSRDTNYVIITSLFFSGFLALVDLLVGIGIKFLMN 57 >gi|326520952|dbj|BAJ92839.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 151 Score = 35.2 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 10/63 (15%), Positives = 31/63 (49%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 V+ ++ F + + K + WP+ L + + +I++ + V +D ++ +++ Sbjct: 85 FAVSVRNLVVFLAEQPRQLKHLEWPAFRNTLRTAALTLILVVVFIVALSSVDAALSYILS 144 Query: 61 FIL 63 ++L Sbjct: 145 WLL 147 >gi|1711365|sp|P36691|SECE_STRVG RecName: Full=Preprotein translocase subunit secE Length = 93 Score = 35.2 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 F++Q+ E +K+ WP+R+++ VVI+ + I VID + F+ G Sbjct: 40 FYRQIVAELRKVVWPTRNQLTTYTTVVIVFVVIMIGLVTVIDFGFEKAIKFVFG 93 >gi|303237521|ref|ZP_07324086.1| preprotein translocase, SecE subunit [Prevotella disiens FB035-09AN] gi|302482341|gb|EFL45371.1| preprotein translocase, SecE subunit [Prevotella disiens FB035-09AN] Length = 63 Score = 35.2 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 24/44 (54%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K WP+R+E+ S ++V+ I +V V D +M+FI Sbjct: 17 AHKTTWPTRAELTHSAMIVLSASLIIAVVVFVFDFISQHVMNFI 60 >gi|213019490|ref|ZP_03335296.1| protein translocase subunit secE [Wolbachia endosymbiont of Culex quinquefasciatus JHB] gi|212994912|gb|EEB55554.1| protein translocase subunit secE [Wolbachia endosymbiont of Culex quinquefasciatus JHB] Length = 66 Score = 35.2 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 33/59 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + FF ++ E ++I W + +VL S+ +VI ++ S+FF +D +++ + GI Sbjct: 4 NLYVFFCDIKQEIRRIAWIKKQQVLSSLFIVITVILCFSIFFCFVDFMSLYVIKTLFGI 62 >gi|283457497|ref|YP_003362078.1| preprotein translocase subunit SecE [Rothia mucilaginosa DY-18] gi|283133493|dbj|BAI64258.1| preprotein translocase subunit SecE [Rothia mucilaginosa DY-18] Length = 92 Score = 35.2 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 26/59 (44%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + F ++V E KK+ P+ E++ V+ + + + +D G +I G G Sbjct: 29 IFAFLREVIAELKKVTTPTGRELVGYFFGVLFFVVVMLLLISGLDYLFGQGAFWIFGNG 87 >gi|281422264|ref|ZP_06253263.1| preprotein translocase, SecE subunit [Prevotella copri DSM 18205] gi|281403769|gb|EFB34449.1| preprotein translocase, SecE subunit [Prevotella copri DSM 18205] Length = 62 Score = 35.2 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 11/44 (25%), Positives = 21/44 (47%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K WPSR+E+ S +VV+ + ++ +D M + Sbjct: 16 AHKTTWPSRAELTHSAMVVLSASLVIALVVFAMDSIFKAFMGVV 59 >gi|118475765|ref|YP_892474.1| preprotein translocase subunit SecE [Campylobacter fetus subsp. fetus 82-40] gi|261885757|ref|ZP_06009796.1| preprotein translocase subunit SecE [Campylobacter fetus subsp. venerealis str. Azul-94] gi|118414991|gb|ABK83411.1| preprotein translocase, SecE subunit [Campylobacter fetus subsp. fetus 82-40] Length = 59 Score = 35.2 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 32/54 (59%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 +++FK R E K+ +P++ ++ + I V +++I S+F ++D + + + + Sbjct: 5 ISYFKLSRAEIGKVIFPTKEQIRNAFITVFAVVAIVSLFLALVDLIMSFTVSKL 58 >gi|242309998|ref|ZP_04809153.1| preprotein translocase subunit SecE [Helicobacter pullorum MIT 98-5489] gi|239523295|gb|EEQ63161.1| preprotein translocase subunit SecE [Helicobacter pullorum MIT 98-5489] Length = 60 Score = 35.2 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 37/57 (64%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++N+++ R+E K+ +P++ +V + I VI++++I ++F ++D +G + IL Sbjct: 4 KLINYYRLSREELSKVIFPTKEQVRNAFISVIMVVTIIALFLALVDFILGSFVSSIL 60 >gi|255534433|ref|YP_003094804.1| hypothetical protein FIC_00274 [Flavobacteriaceae bacterium 3519-10] gi|255340629|gb|ACU06742.1| hypothetical protein FIC_00274 [Flavobacteriaceae bacterium 3519-10] Length = 67 Score = 35.2 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Query: 6 LAVLNFFKQVRDESK-KIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +++++F K E K K+ WP ++ S IVV I I ++F +D + ++ Sbjct: 1 MSLVDFIKGSYIEFKDKVEWPKWPDLQSSTIVVTIATVILALFVFGVDSLFSKAIANMIS 60 Query: 65 I 65 + Sbjct: 61 L 61 >gi|317504005|ref|ZP_07962012.1| preprotein translocase SecE subunit [Prevotella salivae DSM 15606] gi|315664865|gb|EFV04525.1| preprotein translocase SecE subunit [Prevotella salivae DSM 15606] Length = 63 Score = 35.2 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 22/44 (50%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 K WP+R+E+ S ++V+ + ++ +D ++M I Sbjct: 17 VHKTTWPTRAELTHSAMIVLSASLVIALVVFGMDSLFKFVMSTI 60 >gi|21592611|gb|AAM64560.1| unknown [Arabidopsis thaliana] Length = 177 Score = 35.2 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 F V +E K+I WP+ +VL + VV+ +++ SSV L ++ + L + IGR Sbjct: 114 EFLSGVAEEVKEIEWPAFQKVLGTTGVVLGVVAGSSVVLLTVNFLLAELSDRVF-IGR 170 >gi|311114210|ref|YP_003985431.1| preprotein translocase [Gardnerella vaginalis ATCC 14019] gi|310945704|gb|ADP38408.1| preprotein translocase [Gardnerella vaginalis ATCC 14019] Length = 71 Score = 35.2 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 28/59 (47%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + F KQ DE++K+ P E+ V I + VF V+D +G + ++ G Sbjct: 13 MRIGMFIKQTIDETRKVVAPHGKELFAWSASVFIFVIFLMVFVTVMDFGLGKSVMWLFG 71 >gi|147822738|emb|CAN68296.1| hypothetical protein VITISV_033562 [Vitis vinifera] Length = 519 Score = 35.2 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 27/57 (47%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ F + K I WPS L + I+ +++++ V ID ++ +L+ L Sbjct: 459 SLFEFLVDQPSQLKYIEWPSFQSTLKTAILTLVLVAALIVALSSIDSALCFLLTMFL 515 >gi|81429287|ref|YP_396288.1| preprotein translocase subunit SecE [Lactobacillus sakei subsp. sakei 23K] gi|78610930|emb|CAI55982.1| Preprotein translocase, SecE subunit [Lactobacillus sakei subsp. sakei 23K] Length = 59 Score = 34.8 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 30/58 (51%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + ++ F K V +E K + WP+ + V++ + ++FF V+D +I L+ + Sbjct: 1 MKMIKFLKSVVEEMKIVTWPNAKQTRKDTSTVVMTSVLYAIFFGVVDLAILKLLELFI 58 >gi|226942764|ref|YP_002797837.1| preprotein translocase subunit SecE [Azotobacter vinelandii DJ] gi|226717691|gb|ACO76862.1| preprotein translocase, SecE subunit [Azotobacter vinelandii DJ] Length = 83 Score = 34.8 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 32/52 (61%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ R E +K+ WP+R E + ++V+ ++ + ++ +D +GWL+ I+G Sbjct: 32 KEARAEIRKVVWPTRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSVIVG 83 >gi|295396487|ref|ZP_06806648.1| preprotein translocase [Brevibacterium mcbrellneri ATCC 49030] gi|294970679|gb|EFG46593.1| preprotein translocase [Brevibacterium mcbrellneri ATCC 49030] Length = 86 Score = 34.8 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 28/58 (48%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FF +V E KK+ P+R E++ VV+ + + V L +D G L+ F Sbjct: 21 TIARFFAEVMSELKKVVTPTRKELINMFGVVLGFVVVMIVIVLTVDFVFGKLVGFAFA 78 >gi|78776548|ref|YP_392863.1| preprotein translocase subunit SecE [Sulfurimonas denitrificans DSM 1251] gi|78497088|gb|ABB43628.1| SecE subunit of protein translocation complex [Sulfurimonas denitrificans DSM 1251] Length = 59 Score = 34.8 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 31/53 (58%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K R E K+ +P++ +V + I V+I++++ + F ++D + +M ILG Sbjct: 7 IKNARIELSKVIFPTKGQVKQAYISVLIVVTVITAFLALVDLLMSSIMSAILG 59 >gi|291561990|emb|CBL40801.1| protein translocase subunit secE/sec61 gamma [butyrate-producing bacterium SS3/4] Length = 68 Score = 34.8 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 28/55 (50%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 +F K ++ E KI WP + + +VV++ I + +D I + ++ +LG Sbjct: 14 DFIKGLKAEFNKIIWPDKDTLTKETVVVVVSTVILGIVIAALDLIIKFGLNIVLG 68 >gi|190570974|ref|YP_001975332.1| protein translocase subunit secE [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|190357246|emb|CAQ54668.1| protein translocase subunit secE [Wolbachia endosymbiont of Culex quinquefasciatus Pel] Length = 69 Score = 34.8 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 33/59 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + FF ++ E ++I W + +VL S+ +VI ++ S+FF +D +++ + GI Sbjct: 7 NLYVFFCDIKQEIRRIAWIKKQQVLSSLFIVITVILCFSIFFCFVDFMSLYVIKTLFGI 65 >gi|262340951|ref|YP_003283806.1| hypothetical protein BLBBGE_173 [Blattabacterium sp. (Blattella germanica) str. Bge] gi|262272288|gb|ACY40196.1| hypothetical protein BLBBGE_173 [Blattabacterium sp. (Blattella germanica) str. Bge] Length = 61 Score = 34.8 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Query: 10 NFFKQVRDESKK-IFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 NFF +V DE I WP ++ + I+V S+F +D +L+ + + Sbjct: 5 NFFLEVYDEFFHCITWPKWEDLQGTTIMVSFFSIFLSIFLYGVDVFFIFLIKRLFSL 61 >gi|227879327|ref|ZP_03997192.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Lactobacillus crispatus JV-V01] gi|256844504|ref|ZP_05549990.1| preprotein translocase, SecE subunit [Lactobacillus crispatus 125-2-CHN] gi|256849108|ref|ZP_05554541.1| preprotein translocase subunit SecE [Lactobacillus crispatus MV-1A-US] gi|262047588|ref|ZP_06020543.1| preprotein translocase, SecE subunit [Lactobacillus crispatus MV-3A-US] gi|293381064|ref|ZP_06627085.1| preprotein translocase, SecE subunit [Lactobacillus crispatus 214-1] gi|295692219|ref|YP_003600829.1| preprotein translocase, sece subunit [Lactobacillus crispatus ST1] gi|312977942|ref|ZP_07789688.1| preprotein translocase, SecE subunit [Lactobacillus crispatus CTV-05] gi|227861071|gb|EEJ68725.1| Sec family type I general secretory pathway preprotein translocase subunit SecE [Lactobacillus crispatus JV-V01] gi|256613582|gb|EEU18785.1| preprotein translocase, SecE subunit [Lactobacillus crispatus 125-2-CHN] gi|256713884|gb|EEU28872.1| preprotein translocase subunit SecE [Lactobacillus crispatus MV-1A-US] gi|260572164|gb|EEX28729.1| preprotein translocase, SecE subunit [Lactobacillus crispatus MV-3A-US] gi|290922364|gb|EFD99345.1| preprotein translocase, SecE subunit [Lactobacillus crispatus 214-1] gi|295030325|emb|CBL49804.1| Preprotein translocase, SecE subunit [Lactobacillus crispatus ST1] gi|310895249|gb|EFQ44317.1| preprotein translocase, SecE subunit [Lactobacillus crispatus CTV-05] Length = 56 Score = 34.8 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 23/55 (41%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FFK V E K + WPS + VI + + + +D WL ++ Sbjct: 2 IKFFKSVGHEMKLVKWPSAKQNRRDTATVITSSILFAAYLGALDWLFTWLTQRLM 56 >gi|58578829|ref|YP_197041.1| preprotein translocase subunit SecE [Ehrlichia ruminantium str. Welgevonden] gi|58616886|ref|YP_196085.1| preprotein translocase subunit SecE [Ehrlichia ruminantium str. Gardel] gi|58416498|emb|CAI27611.1| Hypothetical protein ERGA_CDS_01590 [Ehrlichia ruminantium str. Gardel] gi|58417455|emb|CAI26659.1| Hypothetical protein ERWE_CDS_01650 [Ehrlichia ruminantium str. Welgevonden] Length = 69 Score = 34.8 bits (79), Expect = 4.1, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 33/59 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++ F V+ E+ + W S++EV+ + +V++++ S+ F +D L+ +LG+ Sbjct: 7 SIAKFLLSVKQEALHVSWASKNEVIGFLFIVVLIIIFMSILFCCVDFLFLRLIKIVLGV 65 >gi|313111430|ref|ZP_07797234.1| LOW QUALITY PROTEIN: secretion protein SecE [Pseudomonas aeruginosa 39016] gi|310883736|gb|EFQ42330.1| LOW QUALITY PROTEIN: secretion protein SecE [Pseudomonas aeruginosa 39016] Length = 72 Score = 34.8 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 34/62 (54%) Query: 3 VNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 A + K+ R E +K+ WPSR E + ++V+ ++ + ++ +D +GWL+ I Sbjct: 11 AKGQAFFSLAKEARVEIRKVVWPSRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSMI 70 Query: 63 LG 64 +G Sbjct: 71 VG 72 >gi|223038969|ref|ZP_03609261.1| preprotein translocase, SecE subunit [Campylobacter rectus RM3267] gi|222879942|gb|EEF15031.1| preprotein translocase, SecE subunit [Campylobacter rectus RM3267] Length = 59 Score = 34.8 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 32/57 (56%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++N+ K R E K+ +P + ++ + I V +++I S+F ++D + + + ++ Sbjct: 3 KMINYIKLSRAEIGKVIFPLKEQIRNAFITVFAVVAIVSLFLALVDAIMSFSLSKLI 59 >gi|259500946|ref|ZP_05743848.1| preprotein translocase subunit SecE [Lactobacillus iners DSM 13335] gi|302190602|ref|ZP_07266856.1| preprotein translocase subunit SecE [Lactobacillus iners AB-1] gi|309803772|ref|ZP_07697858.1| preprotein translocase, SecE subunit [Lactobacillus iners LactinV 11V1-d] gi|309804721|ref|ZP_07698786.1| preprotein translocase, SecE subunit [Lactobacillus iners LactinV 09V1-c] gi|309806503|ref|ZP_07700507.1| preprotein translocase, SecE subunit [Lactobacillus iners LactinV 03V1-b] gi|309808501|ref|ZP_07702400.1| preprotein translocase, SecE subunit [Lactobacillus iners LactinV 01V1-a] gi|309809220|ref|ZP_07703090.1| preprotein translocase, SecE subunit [Lactobacillus iners SPIN 2503V10-D] gi|312871548|ref|ZP_07731641.1| preprotein translocase, SecE subunit [Lactobacillus iners LEAF 3008A-a] gi|312872503|ref|ZP_07732571.1| preprotein translocase, SecE subunit [Lactobacillus iners LEAF 2062A-h1] gi|312873893|ref|ZP_07733931.1| preprotein translocase, SecE subunit [Lactobacillus iners LEAF 2052A-d] gi|312874908|ref|ZP_07734927.1| preprotein translocase, SecE subunit [Lactobacillus iners LEAF 2053A-b] gi|315653973|ref|ZP_07906889.1| preprotein translocase subunit SecE [Lactobacillus iners ATCC 55195] gi|325912436|ref|ZP_08174831.1| preprotein translocase, SecE subunit [Lactobacillus iners UPII 143-D] gi|325913129|ref|ZP_08175499.1| preprotein translocase, SecE subunit [Lactobacillus iners UPII 60-B] gi|329920525|ref|ZP_08277257.1| preprotein translocase, SecE subunit [Lactobacillus iners SPIN 1401G] gi|259167640|gb|EEW52135.1| preprotein translocase subunit SecE [Lactobacillus iners DSM 13335] gi|308164181|gb|EFO66442.1| preprotein translocase, SecE subunit [Lactobacillus iners LactinV 11V1-d] gi|308166113|gb|EFO68331.1| preprotein translocase, SecE subunit [Lactobacillus iners LactinV 09V1-c] gi|308167102|gb|EFO69277.1| preprotein translocase, SecE subunit [Lactobacillus iners LactinV 03V1-b] gi|308168329|gb|EFO70448.1| preprotein translocase, SecE subunit [Lactobacillus iners LactinV 01V1-a] gi|308170454|gb|EFO72477.1| preprotein translocase, SecE subunit [Lactobacillus iners SPIN 2503V10-D] gi|311089653|gb|EFQ48078.1| preprotein translocase, SecE subunit [Lactobacillus iners LEAF 2053A-b] gi|311090569|gb|EFQ48975.1| preprotein translocase, SecE subunit [Lactobacillus iners LEAF 2052A-d] gi|311091865|gb|EFQ50241.1| preprotein translocase, SecE subunit [Lactobacillus iners LEAF 2062A-h1] gi|311092943|gb|EFQ51294.1| preprotein translocase, SecE subunit [Lactobacillus iners LEAF 3008A-a] gi|315488669|gb|EFU78315.1| preprotein translocase subunit SecE [Lactobacillus iners ATCC 55195] gi|325475778|gb|EGC78949.1| preprotein translocase, SecE subunit [Lactobacillus iners UPII 143-D] gi|325477550|gb|EGC80692.1| preprotein translocase, SecE subunit [Lactobacillus iners UPII 60-B] gi|328936201|gb|EGG32654.1| preprotein translocase, SecE subunit [Lactobacillus iners SPIN 1401G] Length = 55 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 11/54 (20%), Positives = 22/54 (40%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 F K+V KK+ WP+ + V+ + + + V+D L+ + Sbjct: 2 FKFIKEVIASMKKVTWPTLEQNRRDTSTVVWCSILFAAYLGVLDFIFQQLVKLL 55 >gi|119025263|ref|YP_909108.1| preprotein translocase subunit SecE [Bifidobacterium adolescentis ATCC 15703] gi|154486658|ref|ZP_02028065.1| hypothetical protein BIFADO_00478 [Bifidobacterium adolescentis L2-32] gi|118764847|dbj|BAF39026.1| preprotein translocase SecE subunit [Bifidobacterium adolescentis ATCC 15703] gi|154084521|gb|EDN83566.1| hypothetical protein BIFADO_00478 [Bifidobacterium adolescentis L2-32] Length = 75 Score = 34.4 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 28/59 (47%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + F KQ+ DE +K+ P+ E+ + V I + + +D +G L +I G Sbjct: 17 MRIGLFIKQIIDELRKVVTPTSKELFFWSLAVFIFVLLLMALVTGMDYGLGKLTLWIFG 75 >gi|315651270|ref|ZP_07904299.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986] gi|315486474|gb|EFU76827.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986] Length = 65 Score = 34.4 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 30/58 (51%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + +F K ++ E KKI WP++ +++ + VI + ++D L++F++ Sbjct: 8 KISDFLKGIKTEFKKIVWPTKDDIVKETVAVISSSIAIGIIISILDFIFKVLLNFVIK 65 >gi|300857260|ref|YP_003782244.1| putative preprotein translocase SecE [Clostridium ljungdahlii DSM 13528] gi|300437375|gb|ADK17142.1| predicted preprotein translocase SecE [Clostridium ljungdahlii DSM 13528] Length = 76 Score = 34.4 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 26/56 (46%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFFK + E K+I W S+ + I VI+ +I V VID L I+ Sbjct: 21 FNFFKGLVSEFKRITWASKEHTKKATIAVIVFCAIYVVIVGVIDFGFNSLAKIIMK 76 >gi|297744565|emb|CBI37827.3| unnamed protein product [Vitis vinifera] Length = 156 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 27/57 (47%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ F + K I WPS L + I+ +++++ V ID ++ +L+ L Sbjct: 96 SLFEFLVDQPSQLKYIEWPSFQSTLKTAILTLVLVAALIVALSSIDSALCFLLTMFL 152 >gi|297804782|ref|XP_002870275.1| protein translocase [Arabidopsis lyrata subsp. lyrata] gi|297316111|gb|EFH46534.1| protein translocase [Arabidopsis lyrata subsp. lyrata] Length = 177 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F V +E K+I WP+ +VL + VV+ +++ SSV L ++ + L + Sbjct: 114 EFLSGVAEEVKEIEWPAFQKVLGTTGVVLGVIAGSSVVLLTVNFLLAELSDRVF 167 >gi|288929391|ref|ZP_06423236.1| preprotein translocase, SecE subunit [Prevotella sp. oral taxon 317 str. F0108] gi|288329493|gb|EFC68079.1| preprotein translocase, SecE subunit [Prevotella sp. oral taxon 317 str. F0108] Length = 63 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 22/41 (53%) Query: 22 IFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 WP+R+E+ S +VV+ + ++ +D + ++M I Sbjct: 20 TTWPTRAELTHSAMVVLSASLVIALVVFAMDSAFKFIMSGI 60 >gi|241895136|ref|ZP_04782432.1| hypothetical protein HMPREF0877_0406 [Weissella paramesenteroides ATCC 33313] gi|241871632|gb|EER75383.1| hypothetical protein HMPREF0877_0406 [Weissella paramesenteroides ATCC 33313] Length = 56 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 10/54 (18%), Positives = 22/54 (40%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + F V E + WP+ SE + + +V+ ++ F D + ++ Sbjct: 1 MKFISSVIKEMHTVTWPTFSENVHNTTIVVFTGLAFALIFGGADWVFEQGITWL 54 >gi|317125905|ref|YP_004100017.1| protein translocase subunit secE/sec61 gamma [Intrasporangium calvum DSM 43043] gi|315589993|gb|ADU49290.1| protein translocase subunit secE/sec61 gamma [Intrasporangium calvum DSM 43043] Length = 89 Score = 34.4 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 29/58 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A+ F +Q+ DE +K+ P+ E++ VVI+ + + +D L+ ++L Sbjct: 28 AISLFVRQILDELRKVVRPTGPELVRYTSVVIVFVLVIMALVSGLDLGWSKLVSWVLA 85 >gi|323344614|ref|ZP_08084838.1| preprotein translocase SecE subunit [Prevotella oralis ATCC 33269] gi|323093884|gb|EFZ36461.1| preprotein translocase SecE subunit [Prevotella oralis ATCC 33269] Length = 61 Score = 34.4 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 23/44 (52%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K WP+ +E+ S +VV+ + ++ +D +++H I Sbjct: 17 AHKTTWPTSAELTHSAMVVLSASLVIALVVFCMDSLFRFMLHLI 60 >gi|255657873|ref|ZP_05403282.1| preprotein translocase, SecE subunit [Mitsuokella multacida DSM 20544] gi|260850063|gb|EEX70070.1| preprotein translocase, SecE subunit [Mitsuokella multacida DSM 20544] Length = 59 Score = 34.4 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 26/54 (48%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 F +V E KK+ W ++ E++ +VV I ++I + D L H IL Sbjct: 5 KFLDEVVAEMKKVSWSTKKELVNYTVVVGIAVAIVCALIWICDTFFARLFHIIL 58 >gi|254994760|ref|ZP_05276950.1| preprotein translocase subunit SecE [Anaplasma marginale str. Mississippi] gi|255002881|ref|ZP_05277845.1| preprotein translocase subunit SecE [Anaplasma marginale str. Puerto Rico] gi|255004012|ref|ZP_05278813.1| preprotein translocase subunit SecE [Anaplasma marginale str. Virginia] Length = 66 Score = 34.4 bits (78), Expect = 5.3, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 33/59 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F V+ E+ ++ W SR EV V +++V++ + +SS+ F +D L+ LG+ Sbjct: 4 SFARFLCDVKQEALQVSWASRKEVSVFLLIVLLTVVVSSILFSCVDFVFLRLVKIALGV 62 >gi|149278896|ref|ZP_01885031.1| elongation factor Tu [Pedobacter sp. BAL39] gi|149230515|gb|EDM35899.1| elongation factor Tu [Pedobacter sp. BAL39] Length = 65 Score = 34.4 bits (78), Expect = 5.3, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 V+ F K+ +E ++K+ WP+ E+ S ++V++ I ++ +D+ +++ Sbjct: 3 KVVQFIKESYEEMTQKVTWPTWGELQNSAVLVLVASLIIALVVFAMDKGSTFVL 56 >gi|256371202|ref|YP_003109026.1| preprotein translocase, SecE subunit [Acidimicrobium ferrooxidans DSM 10331] gi|256007786|gb|ACU53353.1| preprotein translocase, SecE subunit [Acidimicrobium ferrooxidans DSM 10331] Length = 86 Score = 34.4 bits (78), Expect = 5.4, Method: Composition-based stats. Identities = 10/61 (16%), Positives = 26/61 (42%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + + + + VR E + + WP+R ++ VV + L + +++ + + Sbjct: 26 RKGRIRRYLQGVRTELRAVEWPTRRQLRSYATVVFVTLVLVVALIFLLNVVFAKGVSLLY 85 Query: 64 G 64 G Sbjct: 86 G 86 >gi|327463499|gb|EGF09818.1| preprotein translocase subunit SecE [Streptococcus sanguinis SK1057] Length = 59 Score = 34.4 bits (78), Expect = 5.4, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 24/57 (42%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + FFK V K WP+R E I V+ + V + D+ + + IL I Sbjct: 1 MKFFKDVFKLLKDTTWPTRKERWTDFISVMEYTAFFVVIIYIFDKIVASGLFQILNI 57 >gi|255560485|ref|XP_002521257.1| conserved hypothetical protein [Ricinus communis] gi|223539525|gb|EEF41113.1| conserved hypothetical protein [Ricinus communis] Length = 159 Score = 34.4 bits (78), Expect = 5.4, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 30/57 (52%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ F + + K I WPS L + I+ ++++++ V +D + +L+ ++L Sbjct: 99 SLFIFLVEQPSQLKYIEWPSFHSTLKTAILTLVIVALLIVALSSVDSILCYLLAWLL 155 >gi|124005806|ref|ZP_01690644.1| preprotein translocase, SecE subunit [Microscilla marina ATCC 23134] gi|123988489|gb|EAY28130.1| preprotein translocase, SecE subunit [Microscilla marina ATCC 23134] Length = 56 Score = 34.4 bits (78), Expect = 5.4, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 FK++RD K+ WP E+ S +V+I I ++ +ID+ M+ Sbjct: 5 FKELRD---KVTWPKYKELQNSSTLVLIASVIFALVIFMIDKVFENAMNL 51 >gi|225428098|ref|XP_002280561.1| PREDICTED: hypothetical protein [Vitis vinifera] Length = 157 Score = 34.4 bits (78), Expect = 5.5, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 27/57 (47%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ F + K I WPS L + I+ +++++ V ID ++ +L+ L Sbjct: 97 SLFEFLVDQPSQLKYIEWPSFQSTLKTAILTLVLVAALIVALSSIDSALCFLLTMFL 153 >gi|126666826|ref|ZP_01737803.1| translocase [Marinobacter sp. ELB17] gi|126628871|gb|EAZ99491.1| translocase [Marinobacter sp. ELB17] Length = 122 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 32/53 (60%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 K+ R E +K+ WP+R E++ + ++VI+ + + ++ V+D I L+ +G Sbjct: 70 LKEARVEIRKVVWPTRPELIQTTVIVIVFVLVVALLLWVMDSLISLLVAGFIG 122 >gi|289449735|ref|YP_003475549.1| preprotein translocase subunit SecE [Clostridiales genomosp. BVAB3 str. UPII9-5] gi|289184282|gb|ADC90707.1| preprotein translocase, SecE subunit [Clostridiales genomosp. BVAB3 str. UPII9-5] Length = 118 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 32/59 (54%) Query: 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 N+ A NFF ++ E K++ WP + + + +V V+++ ++ ++D + ++ I Sbjct: 14 NKSAKKNFFGDLKAELKRVAWPDKEKTVRTVAAVVVLTVAFALLIWIVDTLVYGGLNLI 72 >gi|189502710|ref|YP_001958427.1| hypothetical protein Aasi_1402 [Candidatus Amoebophilus asiaticus 5a2] gi|189498151|gb|ACE06698.1| hypothetical protein Aasi_1402 [Candidatus Amoebophilus asiaticus 5a2] Length = 64 Score = 34.4 bits (78), Expect = 5.8, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 32/65 (49%), Gaps = 3/65 (4%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M + +++ F++VR K+ WP+ + S ++V++ I ++ ++D + M Sbjct: 2 MKKIKTFIVDSFREVR---YKVTWPTYKSLQDSALLVLLASVIFAIVIGLVDLAFRNAMS 58 Query: 61 FILGI 65 + I Sbjct: 59 WFYNI 63 >gi|285017307|ref|YP_003375018.1| preprotein translocase subunit sece [Xanthomonas albilineans GPE PC73] gi|283472525|emb|CBA15030.1| putative preprotein translocase subunit sece [Xanthomonas albilineans] Length = 137 Score = 34.4 bits (78), Expect = 5.8, Method: Composition-based stats. Identities = 8/25 (32%), Positives = 14/25 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSV 34 F + R E +K+ WP+R E + + Sbjct: 82 EFLSESRFELRKVVWPTRQEAIRTT 106 >gi|166031508|ref|ZP_02234337.1| hypothetical protein DORFOR_01206 [Dorea formicigenerans ATCC 27755] gi|166028913|gb|EDR47670.1| hypothetical protein DORFOR_01206 [Dorea formicigenerans ATCC 27755] Length = 68 Score = 34.4 bits (78), Expect = 6.0, Method: Composition-based stats. Identities = 12/65 (18%), Positives = 27/65 (41%) Query: 2 GVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 + N+FK + E KKI WP + ++ V+ + + ++D + Sbjct: 4 KSQKTQKKNWFKGLNAEFKKIIWPDKQTLVKETAAVVSVSVVLGAIIALVDFLAQHGIDI 63 Query: 62 ILGIG 66 ++ +G Sbjct: 64 LVNLG 68 >gi|57237526|ref|YP_178540.1| preprotein translocase subunit SecE [Campylobacter jejuni RM1221] gi|86148966|ref|ZP_01067198.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. jejuni CF93-6] gi|86151679|ref|ZP_01069893.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. jejuni 260.94] gi|86153944|ref|ZP_01072147.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. jejuni HB93-13] gi|88597034|ref|ZP_01100270.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. jejuni 84-25] gi|121613109|ref|YP_001000179.1| preprotein translocase subunit SecE [Campylobacter jejuni subsp. jejuni 81-176] gi|153951577|ref|YP_001398491.1| preprotein translocase subunit SecE [Campylobacter jejuni subsp. doylei 269.97] gi|157414765|ref|YP_001482021.1| preprotein translocase subunit SecE [Campylobacter jejuni subsp. jejuni 81116] gi|167005137|ref|ZP_02270895.1| preprotein translocase SecE subunit [Campylobacter jejuni subsp. jejuni 81-176] gi|218562127|ref|YP_002343906.1| preprotein translocase subunit SecE [Campylobacter jejuni subsp. jejuni NCTC 11168] gi|283955894|ref|ZP_06373384.1| preprotein translocase SecE subunit [Campylobacter jejuni subsp. jejuni 1336] gi|57166330|gb|AAW35109.1| preprotein translocase, SecE subunit [Campylobacter jejuni RM1221] gi|85840324|gb|EAQ57581.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. jejuni CF93-6] gi|85841308|gb|EAQ58556.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. jejuni 260.94] gi|85842905|gb|EAQ60117.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. jejuni HB93-13] gi|87250472|gb|EAQ73430.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. jejuni 81-176] gi|88190723|gb|EAQ94696.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. jejuni 84-25] gi|112359833|emb|CAL34620.1| preprotein translocase SecE subunit [Campylobacter jejuni subsp. jejuni NCTC 11168] gi|152939023|gb|ABS43764.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. doylei 269.97] gi|157385729|gb|ABV52044.1| preprotein translocase SecE subunit [Campylobacter jejuni subsp. jejuni 81116] gi|283792554|gb|EFC31333.1| preprotein translocase SecE subunit [Campylobacter jejuni subsp. jejuni 1336] gi|284925739|gb|ADC28091.1| preprotein translocase subunit SecE [Campylobacter jejuni subsp. jejuni IA3902] gi|307747404|gb|ADN90674.1| Preprotein translocase SecE subunit [Campylobacter jejuni subsp. jejuni M1] gi|315057892|gb|ADT72221.1| Preprotein translocase subunit SecE [Campylobacter jejuni subsp. jejuni S3] gi|315928199|gb|EFV07516.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. jejuni DFVF1099] gi|315929764|gb|EFV08934.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. jejuni 305] gi|315931087|gb|EFV10061.1| preprotein translocase, SecE subunit [Campylobacter jejuni subsp. jejuni 327] Length = 59 Score = 34.4 bits (78), Expect = 6.0, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 34/57 (59%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ +FK + E +K+ +P + +V + I V +++++ S+F ++D + ++ I+ Sbjct: 3 KLITYFKLSKAELRKVIFPLKEQVRNAYITVFVVVAVISLFLALVDWLMSSIVSAIV 59 >gi|125718990|ref|YP_001036123.1| preprotein translocase subunit SecE [Streptococcus sanguinis SK36] gi|323350658|ref|ZP_08086319.1| preprotein translocase subunit SecE [Streptococcus sanguinis VMC66] gi|125498907|gb|ABN45573.1| Preprotein translocase secE component, putative [Streptococcus sanguinis SK36] gi|322123078|gb|EFX94769.1| preprotein translocase subunit SecE [Streptococcus sanguinis VMC66] gi|324989622|gb|EGC21566.1| preprotein translocase subunit SecE [Streptococcus sanguinis SK353] gi|324995864|gb|EGC27775.1| preprotein translocase subunit SecE [Streptococcus sanguinis SK678] gi|325686706|gb|EGD28732.1| preprotein translocase subunit SecE [Streptococcus sanguinis SK72] gi|325695369|gb|EGD37269.1| preprotein translocase subunit SecE [Streptococcus sanguinis SK150] gi|325697310|gb|EGD39196.1| preprotein translocase subunit SecE [Streptococcus sanguinis SK160] gi|327467894|gb|EGF13384.1| preprotein translocase subunit SecE [Streptococcus sanguinis SK330] gi|327472155|gb|EGF17592.1| preprotein translocase subunit SecE [Streptococcus sanguinis SK408] gi|328944701|gb|EGG38862.1| preprotein translocase subunit SecE [Streptococcus sanguinis SK1087] Length = 59 Score = 34.0 bits (77), Expect = 6.1, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 24/57 (42%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + FFK V K WP+R E I V+ + V + D+ + + IL I Sbjct: 1 MKFFKDVFKLLKDTTWPTRKERWTDFISVMEYTAFFVVIIYIFDKVVASGLFQILNI 57 >gi|326792627|ref|YP_004310448.1| preprotein translocase, SecE subunit [Clostridium lentocellum DSM 5427] gi|326543391|gb|ADZ85250.1| preprotein translocase, SecE subunit [Clostridium lentocellum DSM 5427] Length = 63 Score = 34.0 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 29/55 (52%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 FFK ESK++ WP++ E+ + V+ + I ++ ++D +I + + + Sbjct: 4 FFKDFIAESKRVVWPNKEELTKLTLNVLGLSIIVAIIIYIMDFAINGGIGVLENL 58 >gi|290968176|ref|ZP_06559721.1| preprotein translocase, SecE subunit [Megasphaera genomosp. type_1 str. 28L] gi|290781851|gb|EFD94434.1| preprotein translocase, SecE subunit [Megasphaera genomosp. type_1 str. 28L] Length = 76 Score = 34.0 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 13/52 (25%), Positives = 28/52 (53%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FF+ V+ E K++ WP++ E++ +I+VI+ I + D + + + Sbjct: 20 FFQGVKAEMKRVIWPTKRELISYIIMVIVTTIIVMAVMGISDGVFSRIFNLL 71 >gi|257791877|ref|YP_003182483.1| preprotein translocase, SecE subunit [Eggerthella lenta DSM 2243] gi|317489880|ref|ZP_07948373.1| preprotein translocase [Eggerthella sp. 1_3_56FAA] gi|325829850|ref|ZP_08163308.1| preprotein translocase, SecE subunit [Eggerthella sp. HGA1] gi|257475774|gb|ACV56094.1| preprotein translocase, SecE subunit [Eggerthella lenta DSM 2243] gi|316911035|gb|EFV32651.1| preprotein translocase [Eggerthella sp. 1_3_56FAA] gi|325488017|gb|EGC90454.1| preprotein translocase, SecE subunit [Eggerthella sp. HGA1] Length = 151 Score = 34.0 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 10/21 (47%), Positives = 15/21 (71%) Query: 11 FFKQVRDESKKIFWPSRSEVL 31 F K VR E K++ WP++ +VL Sbjct: 94 FLKDVRSELKRVTWPTKQDVL 114 >gi|300172657|ref|YP_003771822.1| preprotein translocase subunit SecE [Leuconostoc gasicomitatum LMG 18811] gi|299887035|emb|CBL91003.1| preprotein translocase, SecE subunit [Leuconostoc gasicomitatum LMG 18811] Length = 57 Score = 34.0 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 L +F+ V E K++ W S+ + + VI + + ++F +D + +FIL Sbjct: 2 LKYFRNVAAEMKRVTWLSQEQASKETVTVITVSVVFALFLGGVDWLLQSGFNFILN 57 >gi|53715483|ref|YP_101475.1| preprotein translocase SecE subunit [Bacteroides fragilis YCH46] gi|60683456|ref|YP_213600.1| putative preprotein translocase SecE subunit [Bacteroides fragilis NCTC 9343] gi|253566652|ref|ZP_04844105.1| preprotein translocase SecE subunit [Bacteroides sp. 3_2_5] gi|265767530|ref|ZP_06095196.1| preprotein translocase, SecE subunit [Bacteroides sp. 2_1_16] gi|313149464|ref|ZP_07811657.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12] gi|52218348|dbj|BAD50941.1| preprotein translocase SecE subunit [Bacteroides fragilis YCH46] gi|60494890|emb|CAH09697.1| putative preprotein translocase SecE subunit [Bacteroides fragilis NCTC 9343] gi|251944824|gb|EES85299.1| preprotein translocase SecE subunit [Bacteroides sp. 3_2_5] gi|263252835|gb|EEZ24347.1| preprotein translocase, SecE subunit [Bacteroides sp. 2_1_16] gi|301164940|emb|CBW24501.1| Putative preprotein translocase SecE subunit [Bacteroides fragilis 638R] gi|313138231|gb|EFR55591.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12] Length = 63 Score = 34.0 bits (77), Expect = 6.3, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 V+ + K+ DE K+ WP+ SE+ S +VV+ + ++ +D M I+ Sbjct: 3 KVVAYIKESYDELVHKVSWPTYSELTNSAVVVLYASLLIALVVFAMDFCFQNFMEKII 60 >gi|255530755|ref|YP_003091127.1| preprotein translocase subunit SecE [Pedobacter heparinus DSM 2366] gi|255343739|gb|ACU03065.1| preprotein translocase, SecE subunit [Pedobacter heparinus DSM 2366] Length = 65 Score = 34.0 bits (77), Expect = 6.6, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Query: 7 AVLNFFKQVRDE-SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM 59 V+ F K+ +E ++K+ WP+ E+ S ++V++ I + +D+ +++ Sbjct: 3 KVVQFIKESYEEMTQKVTWPTWGELQNSAVLVLVASLIIACVVFAMDKGSTFVL 56 >gi|73666796|ref|YP_302812.1| preprotein translocase subunit SecE [Ehrlichia canis str. Jake] gi|72393937|gb|AAZ68214.1| protein translocase subunit secE/sec61 gamma [Ehrlichia canis str. Jake] Length = 65 Score = 34.0 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 33/59 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 V F V+ E+ ++ W S++EV+ + VVI++++ S+ F +D + ILG+ Sbjct: 3 NVTKFLLGVKQEALQVSWASKNEVVGFLFVVILIITFMSILFCSVDFLFLKFIKIILGV 61 >gi|28377492|ref|NP_784384.1| preprotein translocase subunit SecE [Lactobacillus plantarum WCFS1] gi|300769744|ref|ZP_07079626.1| preprotein translocase [Lactobacillus plantarum subsp. plantarum ATCC 14917] gi|308179703|ref|YP_003923831.1| preprotein translocase subunit SecE [Lactobacillus plantarum subsp. plantarum ST-III] gi|28270324|emb|CAD63225.1| preprotein translocase, SecE subunit [Lactobacillus plantarum WCFS1] gi|300492652|gb|EFK27838.1| preprotein translocase [Lactobacillus plantarum subsp. plantarum ATCC 14917] gi|308045194|gb|ADN97737.1| preprotein translocase subunit SecE [Lactobacillus plantarum subsp. plantarum ST-III] Length = 61 Score = 34.0 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 24/59 (40%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + + FF QV E KK+ WP+ E V+ FF + D I L+ + Sbjct: 1 MRLFKFFGQVGHEMKKVTWPTWRENRRDSWTVVSTSLFFVAFFALFDWIIQLLLQMLTS 59 >gi|227874726|ref|ZP_03992881.1| preprotein translocase, SecE subunit [Mobiluncus mulieris ATCC 35243] gi|269977528|ref|ZP_06184497.1| preprotein translocase subunit SecE [Mobiluncus mulieris 28-1] gi|306818025|ref|ZP_07451758.1| preprotein translocase [Mobiluncus mulieris ATCC 35239] gi|307701854|ref|ZP_07638867.1| preprotein translocase, SecE subunit [Mobiluncus mulieris FB024-16] gi|227844692|gb|EEJ54846.1| preprotein translocase, SecE subunit [Mobiluncus mulieris ATCC 35243] gi|269934283|gb|EEZ90848.1| preprotein translocase subunit SecE [Mobiluncus mulieris 28-1] gi|304649206|gb|EFM46498.1| preprotein translocase [Mobiluncus mulieris ATCC 35239] gi|307612969|gb|EFN92225.1| preprotein translocase, SecE subunit [Mobiluncus mulieris FB024-16] Length = 84 Score = 34.0 bits (77), Expect = 6.8, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 28/58 (48%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + F +QV DE KK+ +P+ E+ IVVI+ + I ++D G L I Sbjct: 25 KIWRFIRQVIDEMKKVVYPTGEELKRYFIVVIVFVGIIMALVGLVDLGFGALTDLIFS 82 >gi|326693427|ref|ZP_08230432.1| putative protein translocase [Leuconostoc argentinum KCTC 3773] Length = 57 Score = 34.0 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 29/56 (51%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + +FK V +E K + W S ++ + VI + I ++F +D + ++F++ Sbjct: 2 VRYFKNVANEMKNVTWLSEAQASKETVTVITVSIIFAIFLGGVDWLLQQGINFVMK 57 >gi|260909716|ref|ZP_05916410.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str. F0295] gi|260636141|gb|EEX54137.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str. F0295] Length = 63 Score = 34.0 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 10/41 (24%), Positives = 22/41 (53%) Query: 22 IFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 WP+R+E+ S +VV+ + ++ +D + ++M I Sbjct: 20 TTWPTRAELTHSAMVVLSASLVIALVVFAMDSAFKFVMSGI 60 >gi|220930951|ref|YP_002507859.1| preprotein translocase, SecE subunit [Halothermothrix orenii H 168] gi|219992261|gb|ACL68864.1| preprotein translocase, SecE subunit [Halothermothrix orenii H 168] Length = 66 Score = 34.0 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 29/57 (50%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 + FF+ + E KK+ WP + E+ VV++ + +F V+D + ++ ++ Sbjct: 9 KIKKFFRNFKAELKKVNWPRKKELSSYTAVVLVTVVALIIFIGVMDYILTSIITPLI 65 >gi|260592784|ref|ZP_05858242.1| preprotein translocase, SecE subunit [Prevotella veroralis F0319] gi|260535315|gb|EEX17932.1| preprotein translocase, SecE subunit [Prevotella veroralis F0319] Length = 63 Score = 34.0 bits (77), Expect = 7.2, Method: Composition-based stats. Identities = 11/44 (25%), Positives = 24/44 (54%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K WPSR+++ S +VV+ + ++ +D +M+F+ Sbjct: 17 AHKTTWPSRAQLTHSAMVVLSASLVIALVVFAMDFVFQHVMNFV 60 >gi|225164273|ref|ZP_03726544.1| preprotein translocase, SecE subunit [Opitutaceae bacterium TAV2] gi|224801115|gb|EEG19440.1| preprotein translocase, SecE subunit [Opitutaceae bacterium TAV2] Length = 67 Score = 34.0 bits (77), Expect = 7.3, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 29/61 (47%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 M ++ FF ++ E +K WP+ E+ S IVVI I +F + D S+ ++ Sbjct: 1 MKNPFRSIRIFFGEMVTELRKAAWPTLRELRDSTIVVIAAAIILGLFTSICDFSLFEVVS 60 Query: 61 F 61 Sbjct: 61 L 61 >gi|219853512|ref|YP_002470634.1| hypothetical protein CKR_0169 [Clostridium kluyveri NBRC 12016] gi|219567236|dbj|BAH05220.1| hypothetical protein [Clostridium kluyveri NBRC 12016] Length = 79 Score = 34.0 bits (77), Expect = 7.3, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFFK + E K+I W S+ +V + I VI I V VID + L+ IL Sbjct: 24 FNFFKGLVVEFKRITWASKEDVKKATIAVIAFCCIYVVIVAVIDFGLNSLVKTILK 79 >gi|18414331|ref|NP_567446.1| P-P-bond-hydrolysis-driven protein transmembrane transporter [Arabidopsis thaliana] gi|2244844|emb|CAB10266.1| hypothetical protein [Arabidopsis thaliana] gi|7268233|emb|CAB78529.1| hypothetical protein [Arabidopsis thaliana] gi|15027941|gb|AAK76501.1| unknown protein [Arabidopsis thaliana] gi|20465399|gb|AAM20124.1| unknown protein [Arabidopsis thaliana] Length = 177 Score = 34.0 bits (77), Expect = 7.3, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 F V +E K+I WP+ +VL + VV+ +++ SSV L ++ + L + IGR Sbjct: 114 EFLSGVAEEVKEIEWPAFQKVLGTTGVVLGVIAGSSVVLLTVNFLLAELSDRVF-IGR 170 >gi|210613432|ref|ZP_03289715.1| hypothetical protein CLONEX_01922 [Clostridium nexile DSM 1787] gi|210151175|gb|EEA82183.1| hypothetical protein CLONEX_01922 [Clostridium nexile DSM 1787] Length = 66 Score = 34.0 bits (77), Expect = 7.4, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 24/53 (45%) Query: 12 FKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 FK ++ E KKI WP + + + V + V+D + + + F++ Sbjct: 14 FKGLKAEFKKIIWPDKKTLAKQTVAVTACSIVLGAIIAVVDVIVKYGVDFLVK 66 >gi|56416540|ref|YP_153614.1| preprotein translocase subunit SecE [Anaplasma marginale str. St. Maries] gi|222474908|ref|YP_002563323.1| Conserved family - SecE subunit [Anaplasma marginale str. Florida] gi|56387772|gb|AAV86359.1| hypothetical protein AM255 [Anaplasma marginale str. St. Maries] gi|222419044|gb|ACM49067.1| Conserved family - SecE subunit [Anaplasma marginale str. Florida] Length = 70 Score = 34.0 bits (77), Expect = 7.5, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 33/59 (55%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 + F V+ E+ ++ W SR EV V +++V++ + +SS+ F +D L+ LG+ Sbjct: 8 SFARFLCDVKQEALQVSWASRKEVSVFLLIVLLTVVVSSILFSCVDFVFLRLVKIALGV 66 >gi|296274147|ref|YP_003656778.1| preprotein translocase subunit SecE [Arcobacter nitrofigilis DSM 7299] gi|296098321|gb|ADG94271.1| preprotein translocase, SecE subunit [Arcobacter nitrofigilis DSM 7299] Length = 60 Score = 34.0 bits (77), Expect = 7.6, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 32/55 (58%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 ++K R+E K+ +P + ++ + I V +++++ S+F +ID + + + ++ Sbjct: 6 TYYKNAREEIGKVIFPIKEQIRSAYISVFVVVTVISLFLALIDAVMSFSLSSVIN 60 >gi|313206994|ref|YP_004046171.1| preprotein translocase, sece subunit [Riemerella anatipestifer DSM 15868] gi|312446310|gb|ADQ82665.1| preprotein translocase, SecE subunit [Riemerella anatipestifer DSM 15868] gi|315024070|gb|EFT37072.1| hypothetical protein RAYM_01610 [Riemerella anatipestifer RA-YM] gi|325335572|gb|ADZ11846.1| Protein secE/sec61-gamma protein [Riemerella anatipestifer RA-GD] Length = 68 Score = 34.0 bits (77), Expect = 7.8, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Query: 7 AVLNFFKQVRDESK-KIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 ++++F K E K K+ WP ++ S VV + I ++F +D ++ + + Sbjct: 3 SLVSFLKDSYIEFKDKVEWPKWVDLQSSTTVVAVSTLILALFTFGVDTLFSRSINNLFSL 62 >gi|212550369|ref|YP_002308686.1| putative preprotein translocase SecE subunit [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2] gi|212548607|dbj|BAG83275.1| putative preprotein translocase SecE subunit [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2] Length = 73 Score = 33.6 bits (76), Expect = 7.9, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 24/43 (55%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHF 61 K+ WP++ E+ S IVV++ + ++ +ID S +M F Sbjct: 25 MYKVSWPTKQELSNSTIVVMMASLVMALVVFLIDFSFENVMMF 67 >gi|254524341|ref|ZP_05136396.1| translocase SecE [Stenotrophomonas sp. SKA14] gi|219721932|gb|EED40457.1| translocase SecE [Stenotrophomonas sp. SKA14] Length = 137 Score = 33.6 bits (76), Expect = 8.1, Method: Composition-based stats. Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSV 34 F + R E +K+ WP+R E + Sbjct: 82 EFLSESRFELRKVVWPTRQEAIRMT 106 >gi|226322714|ref|ZP_03798232.1| hypothetical protein COPCOM_00486 [Coprococcus comes ATCC 27758] gi|225208875|gb|EEG91229.1| hypothetical protein COPCOM_00486 [Coprococcus comes ATCC 27758] Length = 70 Score = 33.6 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 25/53 (47%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 FFK ++ E KI WP ++ + V+++ I + D + + + ++ Sbjct: 17 FFKGLKAEFNKIIWPDKTTLTKQTAAVVVVSVILGAIITICDILVKFGVDLLV 69 >gi|7109681|gb|AAF36752.1| preprotein translocase subunit SecE [Mycoplasma gallisepticum] Length = 124 Score = 33.6 bits (76), Expect = 8.2, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 22/41 (53%) Query: 18 ESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 ES++I W + ++ + ++VI +++ + IDQ + Sbjct: 80 ESRRITWCTPKLLITNFLIVIAIVAFLTGLLFGIDQIFSAI 120 >gi|294660582|ref|NP_853430.2| preprotein translocase subunit SecE [Mycoplasma gallisepticum str. R(low)] gi|284812245|gb|AAP56998.2| preprotein translocase subunit SecE [Mycoplasma gallisepticum str. R(low)] gi|284930927|gb|ADC30866.1| preprotein translocase subunit SecE [Mycoplasma gallisepticum str. R(high)] gi|284931683|gb|ADC31621.1| preprotein translocase subunit SecE [Mycoplasma gallisepticum str. F] Length = 128 Score = 33.6 bits (76), Expect = 8.9, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 22/41 (53%) Query: 18 ESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 ES++I W + ++ + ++VI +++ + IDQ + Sbjct: 84 ESRRITWCTPKLLITNFLIVIAIVAFLTGLLFGIDQIFSAI 124 >gi|254555722|ref|YP_003062139.1| preprotein translocase subunit SecE [Lactobacillus plantarum JDM1] gi|254044649|gb|ACT61442.1| preprotein translocase subunit SecE [Lactobacillus plantarum JDM1] Length = 61 Score = 33.6 bits (76), Expect = 8.9, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 23/59 (38%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 + FF QV E KK+ WP+ E V+ FF + D I L+ + Sbjct: 1 MRSFKFFGQVGHEMKKVTWPTWRENRRDSWTVVSTSLFFVAFFALFDWIIQLLLQMLTS 59 >gi|21241724|ref|NP_641306.1| preprotein translocase subunit SecE [Xanthomonas axonopodis pv. citri str. 306] gi|78046541|ref|YP_362716.1| preprotein translocase subunit SecE [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|294627828|ref|ZP_06706407.1| translocase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122] gi|294668062|ref|ZP_06733181.1| translocase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] gi|325926954|ref|ZP_08188232.1| protein translocase subunit SecE/sec61 gamma [Xanthomonas perforans 91-118] gi|21107093|gb|AAM35842.1| preprotein translocase subunit [Xanthomonas axonopodis pv. citri str. 306] gi|78034971|emb|CAJ22616.1| preprotein translocase subunit SecE [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|292597742|gb|EFF41900.1| translocase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122] gi|292601869|gb|EFF45697.1| translocase [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] gi|325542666|gb|EGD14130.1| protein translocase subunit SecE/sec61 gamma [Xanthomonas perforans 91-118] Length = 135 Score = 33.6 bits (76), Expect = 8.9, Method: Composition-based stats. Identities = 8/25 (32%), Positives = 14/25 (56%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSV 34 F + R E +K+ WP+R E + + Sbjct: 80 EFLSESRFELRKVVWPTRQEAIRTT 104 >gi|157738109|ref|YP_001490793.1| preprotein translocase subunit SecE [Arcobacter butzleri RM4018] gi|315636461|ref|ZP_07891703.1| preprotein translocase subunit SecE [Arcobacter butzleri JV22] gi|157699963|gb|ABV68123.1| preprotein translocase, SecE subunit [Arcobacter butzleri RM4018] gi|315479242|gb|EFU69933.1| preprotein translocase subunit SecE [Arcobacter butzleri JV22] Length = 60 Score = 33.6 bits (76), Expect = 8.9, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 27/43 (62%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 N++ V+ E K+ +P + ++ + I V I++++ S+F +ID Sbjct: 6 NYYSSVKSELSKVIFPIKEQIRTAYISVFIVVTVISLFLALID 48 >gi|148925851|ref|ZP_01809538.1| preprotein translocase SecE subunit [Campylobacter jejuni subsp. jejuni CG8486] gi|145844837|gb|EDK21941.1| preprotein translocase SecE subunit [Campylobacter jejuni subsp. jejuni CG8486] Length = 59 Score = 33.6 bits (76), Expect = 9.1, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 34/57 (59%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFIL 63 ++ +FK + E +K+ +P + +V + I V +++++ S+F ++D + ++ I+ Sbjct: 3 KLITYFKLSKAELRKVIFPLKEQVRNAYITVFVVVAVISLFLALVDWFMSSIVSAIV 59 >gi|294668286|ref|ZP_06733390.1| hypothetical protein NEIELOOT_00199 [Neisseria elongata subsp. glycolytica ATCC 29315] gi|291309740|gb|EFE50983.1| hypothetical protein NEIELOOT_00199 [Neisseria elongata subsp. glycolytica ATCC 29315] Length = 133 Score = 33.6 bits (76), Expect = 9.2, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 23/42 (54%) Query: 11 FFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 +FK E KK+ WP ++ I V+I ++I ++F + D Sbjct: 91 YFKNSVVELKKVVWPDKAYATKMTIFVLIFVTILTIFIYLAD 132 >gi|282858394|ref|ZP_06267574.1| preprotein translocase, SecE subunit [Prevotella bivia JCVIHMP010] gi|282588842|gb|EFB93967.1| preprotein translocase, SecE subunit [Prevotella bivia JCVIHMP010] Length = 63 Score = 33.6 bits (76), Expect = 9.2, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 24/44 (54%) Query: 19 SKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + K WPSR+E+ +VV+ + +V ++D +M+F+ Sbjct: 17 AHKTTWPSRAELTHRAMVVLTASLVIAVVVFIMDFVFQHVMNFV 60 >gi|153952847|ref|YP_001393612.1| hypothetical protein CKL_0210 [Clostridium kluyveri DSM 555] gi|146345728|gb|EDK32264.1| SecE [Clostridium kluyveri DSM 555] Length = 76 Score = 33.6 bits (76), Expect = 9.4, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 28/56 (50%) Query: 9 LNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 NFFK + E K+I W S+ +V + I VI I V VID + L+ IL Sbjct: 21 FNFFKGLVVEFKRITWASKEDVKKATIAVIAFCCIYVVIVAVIDFGLNSLVKTILK 76 >gi|194364521|ref|YP_002027131.1| preprotein translocase subunit SecE [Stenotrophomonas maltophilia R551-3] gi|194347325|gb|ACF50448.1| preprotein translocase, SecE subunit [Stenotrophomonas maltophilia R551-3] Length = 137 Score = 33.6 bits (76), Expect = 9.6, Method: Composition-based stats. Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSV 34 F + R E +K+ WP+R E + Sbjct: 82 EFLSESRFELRKVVWPTRQEAVRMT 106 >gi|260663229|ref|ZP_05864121.1| preprotein translocase, SecE subunit [Lactobacillus fermentum 28-3-CHN] gi|260552421|gb|EEX25472.1| preprotein translocase, SecE subunit [Lactobacillus fermentum 28-3-CHN] Length = 58 Score = 33.6 bits (76), Expect = 9.7, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 16/33 (48%) Query: 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVI 38 + L F VRDE ++ WP+ E +V+ Sbjct: 1 MHPLKFIGSVRDEMHRVVWPTAKENRRDTTIVL 33 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.322 0.159 0.503 Lambda K H 0.267 0.0496 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,307,252,381 Number of Sequences: 13984884 Number of extensions: 45843653 Number of successful extensions: 409314 Number of sequences better than 10.0: 1716 Number of HSP's better than 10.0 without gapping: 2702 Number of HSP's successfully gapped in prelim test: 119 Number of HSP's that attempted gapping in prelim test: 406308 Number of HSP's gapped (non-prelim): 2902 length of query: 67 length of database: 4,792,584,752 effective HSP length: 39 effective length of query: 28 effective length of database: 4,247,174,276 effective search space: 118920879728 effective search space used: 118920879728 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.8 bits) S2: 76 (33.6 bits)