RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780149|ref|YP_003064562.1| hypothetical protein CLIBASIA_00140 [Candidatus Liberibacter asiaticus str. psy62] (67 letters) >3bo0_B Preprotein translocase SECE subunit; ribosome-SECY complex, protein translocation; 9.60A {Escherichia coli} PDB: 3bo1_B (B:) Length = 65 Score = 57.3 bits (139), Expect = 7e-10 Identities = 14/61 (22%), Positives = 27/61 (44%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 A + F ++ R E +K+ WP+R + V + ++ +I I +I GI Sbjct: 5 ATVAFAREARTEVRKVIWPTRKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGIL 64 Query: 67 R 67 + Sbjct: 65 K 65 >3din_D Preprotein translocase subunit SECE; protein translocation, membrane protein, ATPase, ATP- binding, cytoplasm, inner membrane, nucleotide-binding; HET: ADP; 4.50A {Thermotoga maritima MSB8} (D:) Length = 65 Score = 55.0 bits (133), Expect = 4e-09 Identities = 23/59 (38%), Positives = 38/59 (64%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + FF++V E+KKI WPSR E+L S VV+++L+++SV+F V+D ++ I Sbjct: 4 LRKFFREVIAEAKKISWPSRKELLTSFGVVLVILAVTSVYFFVLDFIFSGVVSAIFKAL 62 >3dl8_C SECE; RECA-type ATPase membrane protein translocation protein- protein complex, ATP-binding, cell membrane; 7.50A {Aquifex aeolicus} (C:) Length = 65 Score = 53.9 bits (130), Expect = 7e-09 Identities = 21/59 (35%), Positives = 33/59 (55%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + F K VRDE K++ WPSR V+ + I VII V+ ++D + ++ FIL + Sbjct: 4 LKEFLKGVRDELKRVVWPSRELVVKATISVIIFSLAIGVYLWILDLTFTKIISFILSLR 62 >2akh_Z Preprotein translocase SECE subunit; protein transport, translocation, transmembrane, transport; 14.90A {Escherichia coli} PDB: 2aki_Z (Z:) Length = 111 Score = 50.8 bits (122), Expect = 6e-08 Identities = 17/59 (28%), Positives = 34/59 (57%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGI 65 A + F ++ R E +K+ WP+R E L + ++V + ++ S+ +D + L+ FI G+ Sbjct: 51 ATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVSFITGL 109 >2zjs_E Preprotein translocase SECE subunit; translocon, SEC, protein-conducting-channel, membrane, protein transport, translocation, transmembrane, transport; 3.20A {Thermus thermophilus} PDB: 2zqp_E (E:) Length = 60 Score = 49.3 bits (118), Expect = 2e-07 Identities = 10/55 (18%), Positives = 27/55 (49%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 ++ +F++ R E ++ WP+R +V+ +++ V + D +L+ + Sbjct: 5 LIRYFQEARAELARVTWPTREQVVEGTQAILLFTLAFMVILGLYDTVFRFLIGLL 59 >2d0t_A Indoleamine 2,3-dioxygenase; helix bundle, riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: HEM PIM NHE; 2.30A {Homo sapiens} (A:129-241,A:317-406) Length = 203 Score = 24.7 bits (54), Expect = 4.4 Identities = 6/15 (40%), Positives = 10/15 (66%) Query: 7 AVLNFFKQVRDESKK 21 ++NF K VR ++K Sbjct: 183 DLMNFLKTVRSTTEK 197 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.334 0.146 0.434 Gapped Lambda K H 0.267 0.0723 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 470,780 Number of extensions: 13649 Number of successful extensions: 80 Number of sequences better than 10.0: 1 Number of HSP's gapped: 79 Number of HSP's successfully gapped: 8 Length of query: 67 Length of database: 4,956,049 Length adjustment: 34 Effective length of query: 33 Effective length of database: 3,806,679 Effective search space: 125620407 Effective search space used: 125620407 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 50 (23.1 bits)