BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780149|ref|YP_003064562.1| hypothetical protein CLIBASIA_00140 [Candidatus Liberibacter asiaticus str. psy62] (67 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780149|ref|YP_003064562.1| hypothetical protein CLIBASIA_00140 [Candidatus Liberibacter asiaticus str. psy62] Length = 67 Score = 130 bits (326), Expect = 6e-33, Method: Compositional matrix adjust. Identities = 67/67 (100%), Positives = 67/67 (100%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH Sbjct: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 Query: 61 FILGIGR 67 FILGIGR Sbjct: 61 FILGIGR 67 >gi|254780695|ref|YP_003065108.1| flagellar MS-ring protein [Candidatus Liberibacter asiaticus str. psy62] Length = 563 Score = 20.4 bits (41), Expect = 6.1, Method: Compositional matrix adjust. Identities = 10/20 (50%), Positives = 16/20 (80%) Query: 30 VLVSVIVVIIMLSISSVFFL 49 +L SVI+V IML +++ FF+ Sbjct: 24 ILASVILVPIMLFMAARFFV 43 >gi|255764486|ref|YP_003065119.2| ABC transporter, membrane spanning protein [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Score = 20.0 bits (40), Expect = 7.2, Method: Compositional matrix adjust. Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 13 KQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILGIG 66 + +RD S + +RSE + VI I+ + ++IG M +L G Sbjct: 373 RSLRDGSLGL-GATRSETMKYVIFPAAFPGIAGAILMTASRTIGETMIVVLAAG 425 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.334 0.146 0.434 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,442 Number of Sequences: 1233 Number of extensions: 1103 Number of successful extensions: 7 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 6 length of query: 67 length of database: 328,796 effective HSP length: 38 effective length of query: 29 effective length of database: 281,942 effective search space: 8176318 effective search space used: 8176318 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 31 (16.5 bits)