HHsearch alignment for GI: 254780150 and conserved domain: KOG0459

>KOG0459 consensus.
Probab=100.00  E-value=0  Score=524.86  Aligned_cols=373  Identities=29%  Similarity=0.448  Sum_probs=327.3

Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHH-----------HHHHHHHHCCCC--------CCCCHHHHHCCCEEEEEEEEEECC
Q ss_conf             3882799999046898878999999-----------876444200131--------268686986292063789998219
Q gi|254780150|r    9 NKESLGLSTIGHVDHGKTTLTAAIT-----------KYYSEEKKEYGD--------IDSAPEEKLRGITIATAHVSYETD   69 (392)
Q Consensus         9 ~k~~~ni~~iGhvd~GKSTL~~~L~-----------~~~~~~~~~~~~--------~D~~~~E~~rGiTi~~~~~~~~~~   69 (392)
T Consensus        76 pk~hvn~vfighVdagkstigg~il~ltg~Vd~Rt~ekyereake~~rEswylsW~ldtn~EeR~kgKtvEvGrA~FEte  155 (501)
T KOG0459          76 PKEHVNAVFIGHVDAGKSTIGGNILFLTGMVDKRTLEKYEREAKEKNRESWYLSWALDTNGEERDKGKTVEVGRAYFETE  155 (501)
T ss_pred             CCCCCEEEEEEEEECCCCCCCCEEEEEEEEECHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHCCCEEEEEEEEEEEC
T ss_conf             77874489999996440126873678986543778999999987613332248999737601210265054125788713


Q ss_pred             CEEEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-------CCHHHHHHHHHHCCCCCEEEEECCCC--CCCCH
Q ss_conf             9089998478730246779877400233145201234433-------21067788886318760233100233--35612
Q gi|254780150|r   70 KRFYSHIDCPGHADYVKNMITGATQADGAILVCAAEDGPK-------PQTREHILLARQIGISSIVVYMNKVD--AVDDD  140 (392)
Q Consensus        70 ~~~i~iiD~PGH~~f~~~mi~g~~~~D~ailvVda~~G~~-------~QT~eh~~l~~~lgi~~iIv~iNKmD--~v~~~  140 (392)
T Consensus       156 ~~~ftiLDApGHk~fv~nmI~GasqAD~~vLvisar~gefetgFerGgQTREha~Lakt~gv~~lVv~vNKMddPtvnWs  235 (501)
T KOG0459         156 NKRFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWS  235 (501)
T ss_pred             CEEEEEECCCCCCCCCHHHCCCCCHHHHHHHHHHHHHCHHHCCCCCCCCHHHHHHHHHHHCCCEEEEEEEECCCCCCCCC
T ss_conf             43677631676555560003661111233201132001121031036630578999886233257999995058866730


Q ss_pred             -HHHHHCCCCCCEEEEEEEEEE--EEECCCCEEEEEEECCCCC---CCCCCCCCHHHHHHCCCCCCCCCCCCCCCEECCC
Q ss_conf             -221101232100111014532--2102331146764114445---6521233203443102522221000011000000
Q gi|254780150|r  141 -ELLDISEYEIRDLLKEHKYSD--DTPIIRGSALCALQGTNKE---LGEDSIHALMKAVDTHIPTPQRSLDAPFLMHIEG  214 (392)
Q Consensus       141 -~~~~~i~~~i~~~l~~~~~~~--~~pii~~sa~~g~~~~n~~---~~~~~~~~Ll~~i~~~~~~p~~~~~~p~r~~I~~  214 (392)
T Consensus       236 ~eRy~E~~~k~~~fLr~~g~n~~~d~~f~p~sg~tG~~~k~~~~s~cpwy~gp~fl~~ld~-l~~~~R~~~GP~~~pI~~  314 (501)
T KOG0459         236 NERYEECKEKLQPFLRKLGFNPKPDKHFVPVSGLTGANVKDRTDSVCPWYKGPIFLEYLDE-LPHLERILNGPIRCPVAN  314 (501)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCHHHCCCCCCCCCCCCCCCEEHHC-CCCCCCCCCCCEEEEHHH
T ss_conf             5668999999999999844468998414202464555553446665884217755500202-676554689877855256


Q ss_pred             CCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEECC
Q ss_conf             01355445430148742453489679995068743212541210012114432100136664112454322021177326
Q gi|254780150|r  215 SCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCAP  294 (392)
Q Consensus       215 vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~~  294 (392)
T Consensus       315 Kyk--dmGTvv~GKvEsGsi~kg~~lvvMPn---k~~veV~~I~~dd~E~~~~~pGenvk~rlkgieeedi~~GfiL~~~  389 (501)
T KOG0459         315 KYK--DMGTVVGGKVESGSIKKGQQLVVMPN---KTNVEVLGIYSDDVETDRVAPGENVKLRLKGIEEEDISPGFILCSP  389 (501)
T ss_pred             HCC--CCCEEEEEEECCCCEECCCEEEECCC---CCCEEEEEEECCCCEEEECCCCCCEEEEECCCCHHHCCCCEEEECC
T ss_conf             205--56527887860260305984797258---8625789875165201001588515899645335424673487068


Q ss_pred             CCCCC-CEEEEEEEEEEECCCCCCCCCCCCCCEEEEEECCEEEE------EEEEE------CCCHHHHCCCCEEEEEEEE
Q ss_conf             77763-00016899971056787555511597899995414777------99996------1895570789769999997
Q gi|254780150|r  295 GSIQE-YSRFRASVYILTASEGGRTTGFMDNYRPQFFMDTADVT------GRIIL------SPGSQAVMPGDRVDLEVEL  361 (392)
Q Consensus       295 ~~~~~-~~~f~A~i~il~~~~~~~~~~~~~~~~~~~~~~~~~v~------~~i~~------~~~~~~i~~g~~~~v~l~l  361 (392)
T Consensus       390 ~n~~~s~~~F~aqi~IlE~-----~sIi~~GY~~VlHIht~ieEv~i~li~~idkktg~ksKkrprFvkq~~~~iarl~t  464 (501)
T KOG0459         390 NNPCKSGRTFDAQIVILEH-----KSIICAGYSCVLHIHTAVEEVEIKLIHLIDKKTGEKSKKRPRFVKQGQKCIARLET  464 (501)
T ss_pred             CCCCCCCCEEEEEEEEEEC-----CCEECCCCCEEEEEEEEHHHEEEEEEEEECCCCCCCCCCCCEEECCCCEEEEEEEC
T ss_conf             9855555488777899714-----73341584137653111100411224420011465445787200078689999703


Q ss_pred             CCCEEECCC------CEEEEEECCEEEEEEEEEEEEC
Q ss_conf             781775469------8499998996999899955319
Q gi|254780150|r  362 IYPIAMEPN------QTFSMREGGKTVGAGLILEIIE  392 (392)
Q Consensus       362 ~~pi~~e~~------~rfilRd~~~tig~G~I~~v~e  392 (392)
T Consensus       465 ~~~iCle~fkd~pqmgRFtLRdegkTIAiGkV~k~~~  501 (501)
T KOG0459         465 EGPICLETFKDYPQMGRFTLRDEGKTIAIGKVLKVVE  501 (501)
T ss_pred             CCCEEHHHCCCCHHHCCEEEECCCCEEEEEEEEEECC
T ss_conf             7847301004654436167712893788878986049