HHsearch alignment for GI: 254780150 and conserved domain: PRK05291

>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed.
Probab=99.30  E-value=2e-11  Score=89.86  Aligned_cols=145  Identities=23%  Similarity=0.269  Sum_probs=97.0

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHH---HH-
Q ss_conf             88279999904689887899999987644420013126868698629206378999821990899984787302---46-
Q gi|254780150|r   10 KESLGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHAD---YV-   85 (392)
Q Consensus        10 k~~~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~---f~-   85 (392)
T Consensus       214 ~~G~~v~i~G~PN~GKSSL~N~L~~~drAIV-----S~------ipGTTRD~ie~~l~l~G~~v~l~DTAGiR~t~d~IE  282 (445)
T PRK05291        214 REGLKVVIAGRPNVGKSSLLNALLGEERAIV-----TD------IAGTTRDVIEEHINLDGIPLRLIDTAGIRETEDEVE  282 (445)
T ss_pred             HCCCEEEEECCCCCCHHHHHHHHHCCCCEEE-----CC------CCCCCCCEEEEEEEECCEEEEEEECCCCCCCCCHHH
T ss_conf             3598699889998768999999857874673-----18------999740402236899998999998997665574588


Q ss_pred             ----HHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEE
Q ss_conf             ----7798774002331452012344332106778888631876023310023335612221101232100111014532
Q gi|254780150|r   86 ----KNMITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSD  161 (392)
Q Consensus        86 ----~~mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~  161 (392)
T Consensus       283 ~~GI~ra~~~~~~ADlil~v~D~s~~~~~~~~---~~~~~~~~~~~i~V~NK~DL~~~~~-------------------~  340 (445)
T PRK05291        283 KIGIERSRKAIEEADLVLLVLDASEPLTEEDK---EILEEFKNKPVIVVLNKADLTGEKI-------------------D  340 (445)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCCCCCHH---HHHHHCCCCCEEEEEEHHHCCCCCC-------------------C
T ss_conf             99999999999839999999879988872259---9998517998799985120466534-------------------7


Q ss_pred             EEECCCCEEEEEEECCCCCCCCCCCCCHHHHHHCCC
Q ss_conf             210233114676411444565212332034431025
Q gi|254780150|r  162 DTPIIRGSALCALQGTNKELGEDSIHALMKAVDTHI  197 (392)
Q Consensus       162 ~~pii~~sa~~g~~~~n~~~~~~~~~~Ll~~i~~~~  197 (392)
T Consensus       341 ~~~~i~iSak~g----------~Gi~~L~~~i~~~~  366 (445)
T PRK05291        341 GLPVIRISAKTG----------EGIDELEEALKQLV  366 (445)
T ss_pred             CCCEEEEECCCC----------CCHHHHHHHHHHHH
T ss_conf             897599983788----------69999999999997