HHsearch alignment for GI: 254780150 and conserved domain: cd00880

>cd00880 Era_like Era (E. coli Ras-like protein)-like. This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons. FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control. Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain. EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=99.79  E-value=1.5e-19  Score=140.27  Aligned_cols=153  Identities=22%  Similarity=0.221  Sum_probs=108.5

Q ss_pred             EEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCC-EEEEEEECCCC-------HHHHHHH
Q ss_conf             990468988789999998764442001312686869862920637899982199-08999847873-------0246779
Q gi|254780150|r   17 TIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDK-RFYSHIDCPGH-------ADYVKNM   88 (392)
Q Consensus        17 ~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~-~~i~iiD~PGH-------~~f~~~m   88 (392)
T Consensus         1 ivG~~N~GKStL~N~L~~~~~~~------v-----s~~~gtT~~~~~~~~~~~~~~~i~lvDtpG~~~~~~~~~~~~~~~   69 (163)
T cd00880           1 LFGRTNAGKSSLLNALLGQEVAI------V-----SPVPGTTTDPVEYVWELGPLGPVVLIDTPGIDEAGGLGREREELA   69 (163)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCCE------E-----CCCCCEECCCEEEEEEECCCCEEEEEECCCCCCCCCHHHHHHHHH
T ss_conf             91979989999999995899610------1-----698998656458999954786599972798522231016899999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEECCCC
Q ss_conf             87740023314520123443321067788886318760233100233356122211012321001110145322102331
Q gi|254780150|r   89 ITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPIIRG  168 (392)
Q Consensus        89 i~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pii~~  168 (392)
T Consensus        70 ~~~~~~~D~il~viD~~~~~~~~~~~~l~~l~~~~~p-~i~v~NK~D~~~~~~~~~~~~-~~~~~~~~---~~~~~i~~i  144 (163)
T cd00880          70 RRVLERADLILFVVDADLRADEEEEKLLELLRERGKP-VLLVLNKIDLLPEEEEEELLE-LRLLILLL---LLGLPVIAV  144 (163)
T ss_pred             HHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCC-EEEEEECEECCCHHHHHHHHH-HHHHHHHH---CCCCEEEEE
T ss_conf             9999868989999878999755669999999971974-278853420678789999999-99999876---799859999


Q ss_pred             EEEEEEECCCCCCCCCCCCCHHHHHHC
Q ss_conf             146764114445652123320344310
Q gi|254780150|r  169 SALCALQGTNKELGEDSIHALMKAVDT  195 (392)
Q Consensus       169 sa~~g~~~~n~~~~~~~~~~Ll~~i~~  195 (392)
T Consensus       145 SA~~g~----------gi~~L~~~i~e  161 (163)
T cd00880         145 SALTGE----------GIDELREALIE  161 (163)
T ss_pred             ECCCCC----------CHHHHHHHHHH
T ss_conf             789897----------99999999995