>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3). Termination of protein synthesis by the ribosome requires two release factor (RF) classes. The class II RF3 is a GTPase that removes class I RFs (RF1 or RF2) from the ribosome after release of the nascent polypeptide. RF3 in the GDP state binds to the ribosomal class I RF complex, followed by an exchange of GDP for GTP and release of the class I RF. Sequence comparison of class II release factors with elongation factors shows that prokaryotic RF3 is more similar to EF-G whereas eukaryotic eRF3 is more similar to eEF1A, implying that their precise function may differ.

Probab=98.79 E-value=2.1e-09 Score=77.41 Aligned_cols=73 Identities=21% Similarity=0.286 Sum_probs=56.9 Q ss_pred CCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCC-CCCCCCCCCCCHHHHHHHCCCCCCEEECHHEEEC Q ss_conf 3554454301487424534896799950687432125412100-1211443210013666411245432202117732 Q gi|254780150|r 217 GIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEM-FRKKLDEAIAGDNVGLLLRGVNRADVPRGRVVCA 293 (392) Q Consensus 217 ~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~-~~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl~~ 293 (392) T Consensus 11 d~~h~grlaf~RV~SG~l~~G~~v~n~rtgK~~ri~r~~~~~a~~Re~ie~A~aGDIvav~----g~~~~~tGDTL~~ 84 (85) T cd03689 11 DPAHRDRIAFVRVCSGKFERGMKVKHVRLGKEVRLSNPQQFFAQDRETVDEAYPGDIIGLV----NPGNFQIGDTLTE 84 (85) T ss_pred CCCCCCEEEEEEEEEEEECCCCEEEECCCCCEEEECCHHHHHHCCCEEECEEECCCEEEEE----CCCCCEECCCCCC T ss_conf 9100771899999872986899999712796788354453322770080349389899982----7998731465137

HHsearch alignment for GI: 254780150 and conserved domain: cd03689