>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination. Sup35NM

Probab=99.81 E-value=1.2e-20 Score=147.13 Aligned_cols=83 Identities=31% Similarity=0.593 Sum_probs=79.1 Q ss_pred CCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEE Q ss_conf 11000000013554454301487424534896799950687432125412100121144321001366641124543220 Q gi|254780150|r 207 PFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVP 286 (392) Q Consensus 207 p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~ 286 (392) T Consensus 1 P~R~pI~~v~~~~g-G~vv~G~v~sG~i~~Gd~v~i~P~~---~~~~VksI~~~~~~~~~A~aG~~V~l~L~gid~~~i~ 76 (83) T cd03698 1 PFRLPISDKYKDQG-GTVVSGKVESGSIQKGDTLLVMPSK---ESVEVKSIYVDDEEVDYAVAGENVRLKLKGIDEEDIS 76 (83) T ss_pred CEEEEEEEEEECCC-CCEEEEEEEECEECCCCEEEEECCC---CEEEEEEEEECCEEECEECCCCEEEEEECCCCHHHCC T ss_conf 97989974798699-7399999902587289999997899---8899999999991729888999799998489899947 Q ss_pred CHHEEEC Q ss_conf 2117732 Q gi|254780150|r 287 RGRVVCA 293 (392) Q Consensus 287 rGdvl~~ 293 (392) T Consensus 77 rG~vlcs 83 (83) T cd03698 77 PGDVLCS 83 (83) T ss_pred CCCEEEC T ss_conf 9889949

HHsearch alignment for GI: 254780150 and conserved domain: cd03698