>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p. This domain is homologous to domain II of the eukaryotic translational elongation factor EF-2. Yeast Snu114p is essential for cell viability and for splicing in vivo. U5-116 kD binds GTP. Experiments suggest that GTP binding and probably GTP hydrolysis is important for the function of the U5-116 kD/Snu114p. In complex with GTP, EF-2 promotes the translocation step of translation. During translocation the peptidyl-tRNA is moved from the A site to the P site, the uncharged tRNA from the P site to the E-site and, the mRNA is shifted one codon relative to the ribosome.

Probab=97.77 E-value=3.5e-05 Score=51.17 Aligned_cols=68 Identities=21% Similarity=0.323 Sum_probs=48.5 Q ss_pred CCCEEEEEEECCCCCCCEEEEEECCCC------CCCEEEECCCCC----CCCCCCCCCCHHHHHHHCCCCCCEEECHHEE Q ss_conf 543014874245348967999506874------321254121001----2114432100136664112454322021177 Q gi|254780150|r 222 GTVVTGCIKRGRIKAGSDVEIIGMGGK------KLKVKCTDVEMF----RKKLDEAIAGDNVGLLLRGVNRADVPRGRVV 291 (392) Q Consensus 222 G~Vv~GrV~sG~l~~Gd~i~i~p~~~~------~~~~kv~si~~~----~~~v~~a~aGd~v~l~Lkgi~~~di~rGdvl 291 (392) T Consensus 16 ~F~af~RV~SGtl~~G~~V~Vlg~~y~~~~~~d~~~~~V~~l~l~~Gr~~~~v~~v~AGniv~I--~Gld~~-i~KsaTi 92 (94) T cd04090 16 SFWAFGRIYSGTIKKGQKVKVLGENYSLDDEEDMTICTIGRLWILGGRYKIEVNEAPAGNWVLI--KGIDSS-IVKTATI 92 (94) T ss_pred EEEEEEEEEEEEECCCCEEEEECCCCCCCCCCCCEEEEEEEEEEECCCEEEECCCCCCCCEEEE--ECCCCC-EEEEEEE T ss_conf 8999999988678489999997999898985410498966899962114879782699889999--824003-8967996 Q ss_pred E Q ss_conf 3 Q gi|254780150|r 292 C 292 (392) Q Consensus 292 ~ 292 (392) T Consensus 93 s 93 (94) T cd04090 93 T 93 (94) T ss_pred E T ss_conf 1

HHsearch alignment for GI: 254780150 and conserved domain: cd04090