>cd04106 Rab23_lke Rab23-like subfamily. Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina. Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system. GTPase activating proteins (GAPs) interact with G

Probab=98.75 E-value=2.7e-08 Score=70.47 Aligned_cols=143 Identities=17% Similarity=0.188 Sum_probs=81.0 Q ss_pred EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEE--EEEEEECCCE--EEEEEECCCCHHHHHHH Q ss_conf 7999990468988789999998764442001312686869862920637--8999821990--89998478730246779 Q gi|254780150|r 13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIAT--AHVSYETDKR--FYSHIDCPGHADYVKNM 88 (392) Q Consensus 13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~--~~~~~~~~~~--~i~iiD~PGH~~f~~~m 88 (392) T Consensus 1 iKivvlGd~~VGKTsLi~r~~~~------------~f~~~y~~Tig~~~~~k~i~~~~~~~~v~l~iwDtaG~e~~~~l~ 68 (162) T cd04106 1 IKVIVVGNGNVGKSSMIQRFVKG------------IFTKDYKKTIGVDFLEKQIFLRQSDEDVRLMLWDTAGQEEFDAIT 68 (162) T ss_pred CEEEEECCCCCCHHHHHHHHHHC------------CCCCCCCCCCCCEEEEEEEEECCCCEEEEEEEEECCCCCCCCCCH T ss_conf 98999999998899999999849------------689876885562578878998679979999999789970134152 Q ss_pred HHHHHCCCCEEEEECCCCCCCCCHHHHH-HHH-H-HCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEEEEEEEC Q ss_conf 8774002331452012344332106778-888-6-318760233100233356122211012321001110145322102 Q gi|254780150|r 89 ITGATQADGAILVCAAEDGPKPQTREHI-LLA-R-QIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKYSDDTPI 165 (392) Q Consensus 89 i~g~~~~D~ailvVda~~G~~~QT~eh~-~l~-~-~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~~~~~pi 165 (392) T Consensus 69 ~~~~~~a~~~ilvydvt~~~Sf~~l~~w~~~~~~~~~~~p-iilVgNK~DL~~~r~---V~~~e~~~~a~~~----~~~~ 140 (162) T cd04106 69 KAYYRGAQACILVFSTTDRESFEAIESWKEKVEAECGDIP-MVLVQTKIDLLDQAV---ITNEEAEALAKRL----QLPL 140 (162) T ss_pred HHHHHHHCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCC-EEEEECCHHHHHCCC---CCHHHHHHHHHHC----CCEE T ss_conf 4561230312688406988999999999999997669962-999840544410177---8999999999986----9879 Q ss_pred CCCEEEEEEE Q ss_conf 3311467641 Q gi|254780150|r 166 IRGSALCALQ 175 (392) Q Consensus 166 i~~sa~~g~~ 175 (392) T Consensus 141 ~E~SAk~~~n 150 (162) T cd04106 141 FRTSVKDDFN 150 (162) T ss_pred EEECCCCCCC T ss_conf 9986888829

HHsearch alignment for GI: 254780150 and conserved domain: cd04106