HHsearch alignment for GI: 254780150 and conserved domain: cd04107

>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are members of the Rab family of small GTPases. Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=98.78  E-value=1.1e-08  Score=72.86  Aligned_cols=142  Identities=19%  Similarity=0.108  Sum_probs=81.7

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEE--EEEEEEEECC-C--EEEEEEECCCCHHHHHH
Q ss_conf             79999904689887899999987644420013126868698629206--3789998219-9--08999847873024677
Q gi|254780150|r   13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITI--ATAHVSYETD-K--RFYSHIDCPGHADYVKN   87 (392)
Q Consensus        13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi--~~~~~~~~~~-~--~~i~iiD~PGH~~f~~~   87 (392)
T Consensus         1 fKvvllGd~gVGKTsLi~rf~~~~------------F~~~--y~~Tig~df~~k~i~~~~~~~v~l~iwDtaGqe~~~~l   66 (201)
T cd04107           1 LKVLVIGDLGVGKTSIIKRYVHGI------------FSQH--YKATIGVDFALKVIEWDPNTVVRLQLWDIAGQERFGGM   66 (201)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCC------------CCCC--CCCCCCEEEEEEEEEECCCEEEEEEEEECCCCCCCCCC
T ss_conf             979999999978999999998299------------9998--88875677899899967981999999868998322200


Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCHHHHH--HH------HHHCCCCCEEEEECCCCCCCCHHHHHHCCCCCCEEEEEEEE
Q ss_conf             98774002331452012344332106778--88------86318760233100233356122211012321001110145
Q gi|254780150|r   88 MITGATQADGAILVCAAEDGPKPQTREHI--LL------ARQIGISSIVVYMNKVDAVDDDELLDISEYEIRDLLKEHKY  159 (392)
Q Consensus        88 mi~g~~~~D~ailvVda~~G~~~QT~eh~--~l------~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i~~~l~~~~~  159 (392)
T Consensus        67 ~~~y~~~a~~~ilvydvt~~~Sf~~l~~w~~~i~~~~~~~~~~~ip-iilVgNK~DL~~~~~---v~~ee~~~~a~~~~~  142 (201)
T cd04107          67 TRVYYRGAVGAIIVFDVTRPSTFEAVLKWKADLDSKVTLPNGEPIP-CLLLANKCDLKKRLA---KDGEQMDQFCKENGF  142 (201)
T ss_pred             HHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCC-EEEEEECCCCCCCCC---CCHHHHHHHHHHCCC
T ss_conf             3755557764799982798899998999999999986213789871-899866556411256---899999999997799


Q ss_pred             EEEEECCCCEEEEEEE
Q ss_conf             3221023311467641
Q gi|254780150|r  160 SDDTPIIRGSALCALQ  175 (392)
Q Consensus       160 ~~~~pii~~sa~~g~~  175 (392)
T Consensus       143 ---~~~~EtSAktg~n  155 (201)
T cd04107         143 ---IGWFETSAKEGIN  155 (201)
T ss_pred             ---CEEEEECCCCCCC
T ss_conf             ---8099977999949