>cd04132 Rho4_like Rho4-like subfamily. Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis. Rho4 also plays a role in cell morphogenesis. Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules. The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP. In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.

Probab=98.65 E-value=9.8e-08 Score=67.03 Aligned_cols=144 Identities=17% Similarity=0.133 Sum_probs=80.8 Q ss_pred EEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEE-EEEC-CC--EEEEEEECCCCHHHHHHHH Q ss_conf 999990468988789999998764442001312686869862920637899-9821-99--0899984787302467798 Q gi|254780150|r 14 GLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHV-SYET-DK--RFYSHIDCPGHADYVKNMI 89 (392) Q Consensus 14 ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~-~~~~-~~--~~i~iiD~PGH~~f~~~mi 89 (392) T Consensus 2 KivlvGd~~VGKTsli~r~~~~------------~F~~~--~~pTi~~~~~~~~~~~~~~~v~l~iwDtaG~e~~~~l~~ 67 (187) T cd04132 2 KIVVVGDGGCGKTCLLIVYSQG------------KFPEE--YVPTVFENYVTNIQGPNGKIIELALWDTAGQEEYDRLRP 67 (187) T ss_pred EEEEECCCCCCHHHHHHHHHHC------------CCCCC--CCCCEEEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHH T ss_conf 8999994997699999999639------------89997--589664799999995499899999996999711053434 Q ss_pred HHHHCCCCEEEEECCCCCCC-CCHHHHH-HHHHH--CCCCCEEEEECCCCCCCCHHHHHHC-CCCCCEEEEEEEEEEEEE Q ss_conf 77400233145201234433-2106778-88863--1876023310023335612221101-232100111014532210 Q gi|254780150|r 90 TGATQADGAILVCAAEDGPK-PQTREHI-LLARQ--IGISSIVVYMNKVDAVDDDELLDIS-EYEIRDLLKEHKYSDDTP 164 (392) Q Consensus 90 ~g~~~~D~ailvVda~~G~~-~QT~eh~-~l~~~--lgi~~iIv~iNKmD~v~~~~~~~~i-~~~i~~~l~~~~~~~~~p 164 (392) T Consensus 68 ~~~~~a~~~ilvydit~~~Sf~~i~~~W~~~i~~~~~~~p-iilVgnK~DL~~~~~~~~~v~~e~~~~~a~~~~---~~~ 143 (187) T cd04132 68 LSYPDVDVLLICYAVDNPTSLDNVEDKWFPEVNHFCPGTP-IMLVGLKTDLRKDKNLDRKVTPAQAESVAKKQG---AFA 143 (187) T ss_pred HHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCC-EEEEEECCHHHHHHCCCCCCCHHHHHHHHHHCC---CCE T ss_conf 4530034888950368767799999999999998689999-799998722122122376578999999999859---978 Q ss_pred CCCCEEEEEEE Q ss_conf 23311467641 Q gi|254780150|r 165 IIRGSALCALQ 175 (392) Q Consensus 165 ii~~sa~~g~~ 175 (392) T Consensus 144 y~EtSAk~g~n 154 (187) T cd04132 144 YLECSAKTMEN 154 (187) T ss_pred EEEECCCCCCC T ss_conf 99957688929

HHsearch alignment for GI: 254780150 and conserved domain: cd04132