>cd04150 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins. Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation. Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state. GDP/GTP exchange exposes the helix, which anchors to the membrane. Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein. A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site. Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned. Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI. It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins. Humans, but not rodents

Probab=99.12 E-value=3.2e-10 Score=82.48 Aligned_cols=139 Identities=17% Similarity=0.114 Sum_probs=84.9 Q ss_pred EEEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHHHHHHH Q ss_conf 79999904689887899999987644420013126868698629206378999821990899984787302467798774 Q gi|254780150|r 13 LGLSTIGHVDHGKTTLTAAITKYYSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKNMITGA 92 (392) Q Consensus 13 ~ni~~iGhvd~GKSTL~~~L~~~~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~mi~g~ 92 (392) T Consensus 1 ~KililG~~~sGKTsll~~l~~~~--------~~~~-------~pT~g~~~~~~~~~~~~l~iwD~~G~~~~r~l~~~Y~ 65 (159) T cd04150 1 MRILMVGLDAAGKTTILYKLKLGE--------IVTT-------IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYF 65 (159) T ss_pred CEEEEECCCCCCHHHHHHHHHCCC--------CCCC-------CCCCCCCEEEEEECCEEEEEEECCCCCCCCHHHHHHC T ss_conf 999999999999899999997299--------6775-------8968701799998989999997899721465678647 Q ss_pred HCCCCEEEEECCCCC-CCCCHHHHHHH----HHHCCCCCEEEEECCCCCCCCHHHHHHCCCCC--CEEEEEEEEEEEEEC Q ss_conf 002331452012344-33210677888----86318760233100233356122211012321--001110145322102 Q gi|254780150|r 93 TQADGAILVCAAEDG-PKPQTREHILL----ARQIGISSIVVYMNKVDAVDDDELLDISEYEI--RDLLKEHKYSDDTPI 165 (392) Q Consensus 93 ~~~D~ailvVda~~G-~~~QT~eh~~l----~~~lgi~~iIv~iNKmD~v~~~~~~~~i~~~i--~~~l~~~~~~~~~pi 165 (392) T Consensus 66 ~~a~~iI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~p-ili~~NK~Dl~~~~~~-~ei~~~l~l~~-~~~----~~~~i 138 (159) T cd04150 66 QNTQGLIFVVDSNDRERIGEAREELQRMLNEDELRDAV-LLVFANKQDLPNAMSA-AEVTDKLGLHS-LRN----RNWYI 138 (159) T ss_pred CCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCE-EEEEEECCCCCCCCCH-HHHHHHHCHHH-HHC----CCEEE T ss_conf 68738999997777789999999999996235336982-9999975667789899-99999968666-637----98599 Q ss_pred CCCEEEEE Q ss_conf 33114676 Q gi|254780150|r 166 IRGSALCA 173 (392) Q Consensus 166 i~~sa~~g 173 (392) T Consensus 139 ~~~SA~tG 146 (159) T cd04150 139 QATCATSG 146 (159) T ss_pred EEEECCCC T ss_conf 98268679

HHsearch alignment for GI: 254780150 and conserved domain: cd04150