Query gi|254780154|ref|YP_003064567.1| hypothetical protein CLIBASIA_00185 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 68 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 23785 Date Mon May 23 03:22:44 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780154.hhm -d /home/congqian_1/database/pdb/pdb70.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 2z5i_A TM, general control pro 40.6 17 0.00073 17.4 2.9 39 22-60 12-50 (52) 2 1r5q_A KAI A, circadian oscill 12.8 70 0.003 14.2 1.6 16 39-54 12-27 (102) 3 2p7n_A Pathogenicity island 1 10.2 84 0.0035 13.8 1.2 38 19-59 176-214 (407) 4 1v2z_A Circadian clock protein 9.7 1E+02 0.0044 13.3 1.6 17 38-54 18-34 (111) 5 1j7n_A Lethal factor precursor 9.7 93 0.0039 13.5 1.3 31 26-56 205-240 (776) 6 2wh0_Q Pkcev3, protein kinase 7.6 94 0.004 13.5 0.6 16 18-33 9-24 (31) 7 1a93_B MAX protein, coiled coi 6.6 1.5E+02 0.0062 12.4 1.7 21 27-47 12-32 (34) 8 2dlg_A Filamin-B; beta-sandwic 5.4 1.8E+02 0.0074 12.0 1.1 18 49-66 58-75 (102) 9 2ee6_A Filamin-B; beta-sandwic 5.1 1.8E+02 0.0077 11.9 1.0 17 50-66 68-84 (105) 10 1gff_1 Bacteriophage G4 capsid 4.9 1.9E+02 0.0079 11.9 1.1 25 27-53 199-223 (426) No 1 >2z5i_A TM, general control protein GCN4 and tropomyosin alpha-1 chain; coiled coil, actin, troponin, cytoskeleton, cardiomyopathy; 2.10A {Saccharomyces cerevisiae} PDB: 2z5h_A 1kql_A 1mv4_A 2g9j_C Probab=40.63 E-value=17 Score=17.45 Aligned_cols=39 Identities=23% Similarity=0.374 Sum_probs=31.0 Q ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHCCEE Q ss_conf 105788852105544321122789999863230323715 Q gi|254780154|r 22 SESKKIEKNINDTRRENAKLSTKYREIVESYTPAMEGIS 60 (68) Q Consensus 22 seskkieknindtrrenaklstkyreivesytpamegis 60 (68) ..-.|.||+|.|-..|--.-.-||+.|-|....|...+. T Consensus 12 rsVakLeK~iDDLEDelYaqK~KykaiSEELD~aLNd~t 50 (52) T 2z5i_A 12 NEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDMT 50 (52) T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCC- T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 999999972458889999999887676799998998760 No 2 >1r5q_A KAI A, circadian oscillation regulator; four-helix-bundle, gene regulation; 2.00A {Nostoc SP} SCOP: a.186.1.1 Probab=12.84 E-value=70 Score=14.19 Aligned_cols=16 Identities=38% Similarity=0.677 Sum_probs=12.0 Q ss_pred HHHHHHHHHHHHHHCH Q ss_conf 1122789999863230 Q gi|254780154|r 39 AKLSTKYREIVESYTP 54 (68) Q Consensus 39 aklstkyreivesytp 54 (68) ..|...||+|+-+|-. T Consensus 12 ~~L~~~YR~ill~YF~ 27 (102) T 1r5q_A 12 QQLKSDYRQILLSYFT 27 (102) T ss_dssp HHHHHHHHHHHHHTTS T ss_pred HHHHHHHHHHHHHHHC T ss_conf 9999999999999918 No 3 >2p7n_A Pathogenicity island 1 effector protein; CVR69, structural genomics, PSI-2, protein structure initiative; 2.80A {Chromobacterium violaceum} Probab=10.23 E-value=84 Score=13.77 Aligned_cols=38 Identities=21% Similarity=0.317 Sum_probs=22.4 Q ss_pred CCCCCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHCCE Q ss_conf 565105-78885210554432112278999986323032371 Q gi|254780154|r 19 GCDSES-KKIEKNINDTRRENAKLSTKYREIVESYTPAMEGI 59 (68) Q Consensus 19 gcdses-kkieknindtrrenaklstkyreivesytpamegi 59 (68) -|++|- -+|++.|.+..-.-- -.|.+++++||--|.-+ T Consensus 176 ~s~aelwa~Is~~I~nI~~~Y~---d~Y~eivk~yte~~Q~f 214 (407) T 2p7n_A 176 MADSDLWDMISDQIGKIKDNYL---GVYENVVGQYTDFYKAF 214 (407) T ss_dssp CCHHHHHHHHHHHHHHHHHHTH---HHHHHHHHHHHHHHHHH T ss_pred CCCHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHH T ss_conf 7518999999999999988799---99999999999999999 No 4 >1v2z_A Circadian clock protein KAIA homolog; all alpha, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.80A {Thermosynechococcus elongatus bp-1} SCOP: a.186.1.1 PDB: 1q6a_A 1q6b_A 1suy_A 1sv1_A Probab=9.68 E-value=1e+02 Score=13.27 Aligned_cols=17 Identities=35% Similarity=0.452 Sum_probs=12.7 Q ss_pred HHHHHHHHHHHHHHHCH Q ss_conf 21122789999863230 Q gi|254780154|r 38 NAKLSTKYREIVESYTP 54 (68) Q Consensus 38 naklstkyreivesytp 54 (68) -..|...||+|+-+|-. T Consensus 18 l~~L~~~YR~ill~YF~ 34 (111) T 1v2z_A 18 LDELRSIYRTIVLEYFN 34 (111) T ss_dssp HHHHHHHHHHHHHHTTC T ss_pred HHHHHHHHHHHHHHHHC T ss_conf 99999999999999918 No 5 >1j7n_A Lethal factor precursor; anthrax, lethal toxin, zinc metalloprotease, mapkk, MEK; 2.30A {Bacillus anthracis} SCOP: d.92.1.14 d.92.1.14 d.166.1.1 PDB: 1jky_A 1pwp_A* 1pwq_A* 1pwv_A 1zxv_A* 1pwu_A* 1pww_A 1yqy_A* Probab=9.67 E-value=93 Score=13.54 Aligned_cols=31 Identities=26% Similarity=0.412 Sum_probs=19.8 Q ss_pred HHHHHHHHHHHHHHHHH-----HHHHHHHHHHCHHH Q ss_conf 88852105544321122-----78999986323032 Q gi|254780154|r 26 KIEKNINDTRRENAKLS-----TKYREIVESYTPAM 56 (68) Q Consensus 26 kieknindtrrenakls-----tkyreivesytpam 56 (68) -++.|+++-..--||-- ..|||+.++|.|+| T Consensus 205 ~ik~n~~efQ~iFakaFayy~eP~~re~l~~YAp~m 240 (776) T 1j7n_A 205 FLEQNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEA 240 (776) T ss_dssp HHHTCHHHHHHHHHHHHHHHHSHHHHHHHHHHCHHH T ss_pred HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCHHH T ss_conf 886506899999999878761820789999738788 No 6 >2wh0_Q Pkcev3, protein kinase C epsilon type, NPKC-epsilon; tandem binding, phosphoprotein, signaling protein, 14-3-3, cytoplasm, acetylation; HET: SEP; 2.25A {Homo sapiens} Probab=7.55 E-value=94 Score=13.50 Aligned_cols=16 Identities=44% Similarity=0.789 Sum_probs=13.1 Q ss_pred HCCCCCHHHHHHHHHH Q ss_conf 0565105788852105 Q gi|254780154|r 18 AGCDSESKKIEKNIND 33 (68) Q Consensus 18 agcdseskkieknind 33 (68) .-||.+-|..|.||.. T Consensus 9 spcdq~~kelennirk 24 (31) T 2wh0_Q 9 SPCDQEIKELENNIRK 24 (31) T ss_pred CCHHHHHHHHHHHHHH T ss_conf 9337899999999999 No 7 >1a93_B MAX protein, coiled coil, LZ; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Mus musculus} SCOP: h.1.3.1 PDB: 2a93_B Probab=6.62 E-value=1.5e+02 Score=12.45 Aligned_cols=21 Identities=33% Similarity=0.561 Sum_probs=17.1 Q ss_pred HHHHHHHHHHHHHHHHHHHHH Q ss_conf 885210554432112278999 Q gi|254780154|r 27 IEKNINDTRRENAKLSTKYRE 47 (68) Q Consensus 27 ieknindtrrenaklstkyre 47 (68) -...|.|-+|.|+-|....|. T Consensus 12 hQQDiDDLkrQN~lle~qira 32 (34) T 1a93_B 12 HQQDIDDLKRQNALLEQQVRA 32 (34) T ss_dssp HHHHHHHHHHHHHHHHHHHHH T ss_pred HHHHHHHHHHHHHHHHHHHHH T ss_conf 443369999988999999885 No 8 >2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Probab=5.35 E-value=1.8e+02 Score=12.03 Aligned_cols=18 Identities=17% Similarity=0.416 Sum_probs=14.7 Q ss_pred HHHHCHHHCCEEEEEEEE Q ss_conf 863230323715767888 Q gi|254780154|r 49 VESYTPAMEGISIIDVTL 66 (68) Q Consensus 49 vesytpamegisiidvtl 66 (68) .-+|+|.++|.-.|+|+. T Consensus 58 ~v~y~P~~~G~h~v~V~~ 75 (102) T 2dlg_A 58 CVRFVPQEMGVHTVSVKY 75 (102) T ss_dssp EEEBCCCTTCEEEEEEES T ss_pred EEEEEECCCCEEEEEEEE T ss_conf 999998146279999999 No 9 >2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Probab=5.11 E-value=1.8e+02 Score=11.94 Aligned_cols=17 Identities=18% Similarity=0.258 Sum_probs=14.6 Q ss_pred HHHCHHHCCEEEEEEEE Q ss_conf 63230323715767888 Q gi|254780154|r 50 ESYTPAMEGISIIDVTL 66 (68) Q Consensus 50 esytpamegisiidvtl 66 (68) -+|+|...|.-.|+|++ T Consensus 68 v~y~P~~~G~y~i~V~~ 84 (105) T 2ee6_A 68 VSYIAQEPGNYEVSIKF 84 (105) T ss_dssp EEEEESSCEEEEEEEEE T ss_pred EEEEECCCCCEEEEEEE T ss_conf 99997986228999999 No 10 >1gff_1 Bacteriophage G4 capsid proteins GPF, GPG, GPJ; coat protein, icosahedral virus; 3.00A {Enterobacteria phage G4} SCOP: b.121.5.1 Probab=4.93 E-value=1.9e+02 Score=11.87 Aligned_cols=25 Identities=24% Similarity=0.518 Sum_probs=17.5 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 885210554432112278999986323 Q gi|254780154|r 27 IEKNINDTRRENAKLSTKYREIVESYT 53 (68) Q Consensus 27 ieknindtrrenaklstkyreivesyt 53 (68) -.+-|++-||+-. + ++|+||..|.- T Consensus 199 ~a~ti~~lrr~~f-~-qRY~Ei~~sh~ 223 (426) T 1gff_1 199 YAKLHTEQERDYF-M-TRYRDIMKEFG 223 (426) T ss_dssp HHHHHHHHHHHHT-C-CSHHHHHHTTT T ss_pred HHHHHHHHHHHHH-H-HHHHHHHHHCC T ss_conf 7899999999999-9-99999999608 Done!