RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254780154|ref|YP_003064567.1| hypothetical protein
CLIBASIA_00185 [Candidatus Liberibacter asiaticus str. psy62]
         (68 letters)



>gnl|CDD|31237 COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75
           kD subunit (chain G) [Energy production and conversion].
          Length = 693

 Score = 26.9 bits (59), Expect = 1.2
 Identities = 13/36 (36%), Positives = 17/36 (47%)

Query: 33  DTRRENAKLSTKYREIVESYTPAMEGISIIDVTLVI 68
           D R+E+A+L  K       Y P +  I   D  LVI
Sbjct: 336 DHRQEDARLDPKVARAGYLYNPTIAEIESADAVLVI 371


>gnl|CDD|38857 KOG3652, KOG3652, KOG3652, Uncharacterized conserved protein
           [Function unknown].
          Length = 1215

 Score = 26.3 bits (57), Expect = 2.0
 Identities = 14/50 (28%), Positives = 18/50 (36%)

Query: 8   IVLITILSTLAGCDSESKKIEKNINDTRRENAKLSTKYREIVESYTPAME 57
           IV  + L    GC  E    E N    +RE   +S+      E   P  E
Sbjct: 372 IVEDSALFDAGGCQMEMGGGELNEEQHKREMIGISSASGGSTEPTAPDSE 421


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.314    0.130    0.341 

Gapped
Lambda     K      H
   0.267   0.0709    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 681,575
Number of extensions: 24439
Number of successful extensions: 54
Number of sequences better than 10.0: 1
Number of HSP's gapped: 54
Number of HSP's successfully gapped: 10
Length of query: 68
Length of database: 6,263,737
Length adjustment: 39
Effective length of query: 29
Effective length of database: 5,420,986
Effective search space: 157208594
Effective search space used: 157208594
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 51 (23.5 bits)