BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780154|ref|YP_003064567.1| hypothetical protein CLIBASIA_00185 [Candidatus Liberibacter asiaticus str. psy62] (68 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780154|ref|YP_003064567.1| hypothetical protein CLIBASIA_00185 [Candidatus Liberibacter asiaticus str. psy62] Length = 68 Score = 135 bits (341), Expect = 1e-34, Method: Compositional matrix adjust. Identities = 68/68 (100%), Positives = 68/68 (100%) Query: 1 MDHRKKTIVLITILSTLAGCDSESKKIEKNINDTRRENAKLSTKYREIVESYTPAMEGIS 60 MDHRKKTIVLITILSTLAGCDSESKKIEKNINDTRRENAKLSTKYREIVESYTPAMEGIS Sbjct: 1 MDHRKKTIVLITILSTLAGCDSESKKIEKNINDTRRENAKLSTKYREIVESYTPAMEGIS 60 Query: 61 IIDVTLVI 68 IIDVTLVI Sbjct: 61 IIDVTLVI 68 >gi|255764478|ref|YP_003065205.2| aminopeptidase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 418 Score = 21.9 bits (45), Expect = 2.2, Method: Composition-based stats. Identities = 10/32 (31%), Positives = 19/32 (59%) Query: 37 ENAKLSTKYREIVESYTPAMEGISIIDVTLVI 68 ++ K+S + +++Y PA+E IS D+ I Sbjct: 121 DSDKVSRVNQAYLKAYKPALERISNFDINWSI 152 >gi|254780859|ref|YP_003065272.1| NADH dehydrogenase subunit G [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Score = 21.6 bits (44), Expect = 2.9, Method: Composition-based stats. Identities = 10/36 (27%), Positives = 15/36 (41%) Query: 33 DTRRENAKLSTKYREIVESYTPAMEGISIIDVTLVI 68 D R+ L Y + P ++GI D L+I Sbjct: 347 DCRQNGEYLDPSYGRASYIFNPTIQGIEEADAMLII 382 >gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Score = 20.8 bits (42), Expect = 4.1, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 14/26 (53%) Query: 37 ENAKLSTKYREIVESYTPAMEGISII 62 EN LS K EIV +P+ G S I Sbjct: 27 ENVHLSLKKGEIVALVSPSGTGKSTI 52 >gi|254780849|ref|YP_003065262.1| chaperonin GroEL [Candidatus Liberibacter asiaticus str. psy62] Length = 551 Score = 20.8 bits (42), Expect = 4.9, Method: Compositional matrix adjust. Identities = 14/61 (22%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Query: 6 KTIVLITILSTLAGCDSESKKIEKNINDTRR--ENAKLSTKYREIVESYTPAMEGISIID 63 K +V+ +T+ G + S++IE IN+ ++ E+ K ++ E G+++++ Sbjct: 321 KKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLE 380 Query: 64 V 64 V Sbjct: 381 V 381 >gi|254780791|ref|YP_003065204.1| exodeoxyribonuclease VII large subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 529 Score = 20.8 bits (42), Expect = 5.1, Method: Compositional matrix adjust. Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 42 STKYREIVESYTPAMEG 58 S+KY+ I+ES P+ G Sbjct: 98 SSKYQIIIESLIPSGSG 114 >gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter asiaticus str. psy62] Length = 884 Score = 20.4 bits (41), Expect = 5.3, Method: Compositional matrix adjust. Identities = 7/23 (30%), Positives = 12/23 (52%) Query: 8 IVLITILSTLAGCDSESKKIEKN 30 + +T L +AGC K+E+ Sbjct: 798 VFAVTKLGNVAGCKVSEGKVERG 820 >gi|254781000|ref|YP_003065413.1| tRNA (uracil-5-)-methyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 371 Score = 20.4 bits (41), Expect = 5.8, Method: Composition-based stats. Identities = 10/35 (28%), Positives = 19/35 (54%) Query: 27 IEKNINDTRRENAKLSTKYREIVESYTPAMEGISI 61 ++++ D R A + YR+I S+T GI++ Sbjct: 162 LDRDYVDERLTVAGRTLIYRQIENSFTQPNAGINV 196 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.130 0.341 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,221 Number of Sequences: 1233 Number of extensions: 1187 Number of successful extensions: 15 Number of sequences better than 100.0: 15 Number of HSP's better than 100.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of query: 68 length of database: 328,796 effective HSP length: 39 effective length of query: 29 effective length of database: 280,709 effective search space: 8140561 effective search space used: 8140561 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 31 (16.5 bits)