>gi|254780155|ref|YP_003064568.1| hypothetical protein CLIBASIA_00190 [Candidatus Liberibacter asiaticus str. psy62]
MFTILYVIYLSNSMDCILGYMNKEEEKLILD