BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780155|ref|YP_003064568.1| hypothetical protein CLIBASIA_00190 [Candidatus Liberibacter asiaticus str. psy62] (31 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done >gi|254780155|ref|YP_003064568.1| hypothetical protein CLIBASIA_00190 [Candidatus Liberibacter asiaticus str. psy62] gi|254039832|gb|ACT56628.1| hypothetical protein CLIBASIA_00190 [Candidatus Liberibacter asiaticus str. psy62] Length = 31 Score = 46.9 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 31/31 (100%), Positives = 31/31 (100%) Query: 1 MFTILYVIYLSNSMDCILGYMNKEEEKLILD 31 MFTILYVIYLSNSMDCILGYMNKEEEKLILD Sbjct: 1 MFTILYVIYLSNSMDCILGYMNKEEEKLILD 31 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.327 0.144 0.410 Lambda K H 0.267 0.0466 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 400,801,819 Number of Sequences: 13984884 Number of extensions: 9188477 Number of successful extensions: 26642 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 26641 Number of HSP's gapped (non-prelim): 1 length of query: 31 length of database: 4,792,584,752 effective HSP length: 6 effective length of query: 25 effective length of database: 4,708,675,448 effective search space: 117716886200 effective search space used: 117716886200 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 76 (33.7 bits)