BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780155|ref|YP_003064568.1| hypothetical protein CLIBASIA_00190 [Candidatus Liberibacter asiaticus str. psy62] (31 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780155|ref|YP_003064568.1| hypothetical protein CLIBASIA_00190 [Candidatus Liberibacter asiaticus str. psy62] Length = 31 Score = 63.2 bits (152), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 31/31 (100%), Positives = 31/31 (100%) Query: 1 MFTILYVIYLSNSMDCILGYMNKEEEKLILD 31 MFTILYVIYLSNSMDCILGYMNKEEEKLILD Sbjct: 1 MFTILYVIYLSNSMDCILGYMNKEEEKLILD 31 >gi|254780915|ref|YP_003065328.1| oligoendopeptidase F [Candidatus Liberibacter asiaticus str. psy62] Length = 626 Score = 21.2 bits (43), Expect = 3.2, Method: Compositional matrix adjust. Identities = 8/13 (61%), Positives = 10/13 (76%) Query: 5 LYVIYLSNSMDCI 17 LY IY SN++DC Sbjct: 564 LYDIYKSNTVDCF 576 >gi|254781119|ref|YP_003065532.1| hypothetical protein CLIBASIA_05105 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 20.8 bits (42), Expect = 4.7, Method: Compositional matrix adjust. Identities = 6/20 (30%), Positives = 11/20 (55%) Query: 7 VIYLSNSMDCILGYMNKEEE 26 V L +DC++ NK++ Sbjct: 13 VTLLKQKVDCLIAQFNKQQS 32 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.327 0.144 0.410 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,783 Number of Sequences: 1233 Number of extensions: 334 Number of successful extensions: 3 Number of sequences better than 100.0: 3 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 31 length of database: 328,796 effective HSP length: 6 effective length of query: 25 effective length of database: 321,398 effective search space: 8034950 effective search space used: 8034950 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.2 bits) S2: 31 (16.5 bits)