>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit; InterPro: IPR005809 There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site. These enzymes are: ATP citrate-lyase (4.1.3.8 from EC) , the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues, catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with the concomitant hydrolysis of ATP to ADP and phosphate. ATP-citrate lyase is a tetramer of identical subunits; Succinyl-CoA ligase (GDP-forming) (6.2.1.4 from EC) is a mitochondrial enzyme that catalyzes the substrate level phosphorylation step of the tricarboxylic acid cycle: the formation of succinyl-CoA from succinate with a concomitant hydrolysis of GTP to GDP and phosphate. This enzyme is a dimer composed of an alpha and a beta subunits; Succinyl-CoA ligase (ADP-forming) (6.2.1.5 from EC) is a bacterial enzyme that during aerobic metabolism functions in the citric acid cycle, coupling the hydrolysis of succinyl-CoA to the synthesis of ATP. It can also function in the other direction for anabolic purposes. This enzyme is a tetramer composed of two alpha and two beta subunits; and Malate-CoA ligase (6.2.1.9 from EC) (malyl-CoA synthetase) , is a bacterial enzyme that forms malyl-CoA from malate and CoA with the concomitant hydrolysis of ATP to ADP and phosphate. Malate-CoA ligase is composed of two different subunits. This entry corresponds to a conserved region located in the first half of ATP citrate lyase and in the beta subunits of succinyl-CoA ligases and malate-CoA ligase. ; GO: 0003824 catalytic activity, 0008152 metabolic process.

Probab=98.99 E-value=1.7e-08 Score=77.13 Aligned_cols=209 Identities=20% Similarity=0.231 Sum_probs=132.9 Q ss_pred HHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCC-CEEEEECCCCCCCCCC----CCCCCCHHHHHHHHHHCCC------ Q ss_conf 7888887650588674321000688886410013-1255402346755566----4544674677898751355------ Q gi|254780158|r 103 LYEKKFFQESGLTTVDFYEINSQESLTNILGGFK-GKGILKTRRLGYDGKG----QKVYHENDCTQNLYASLGN------ 171 (354) Q Consensus 103 ~~~K~~l~~~gipt~~~~~v~s~~el~~~~~~~g-~P~vlKp~~~GydGkG----~~~i~~~~~l~~~~~~~~~------ 171 (354) T Consensus 6 YqAK~if~~YGiPvp~g~v~~s~~e~~~~~~~~g~~~~VvKaQVh-aGGRGKAGGv~~a~s~ee~~~~a~~llg~~l~t~ 84 (389) T TIGR01016 6 YQAKEIFAKYGIPVPEGEVATSVEEVEEIAEELGEGKVVVKAQVH-AGGRGKAGGVKVAKSKEEALKAAEKLLGKELKTF 84 (389) T ss_pred HHHHHHHHHCCCCCCCCCEEECHHHHHHHHHHCCCCCEEEEEEEE-ECCCCCCCCEEEEECHHHHHHHHHHHHCCEEEEE T ss_conf 558999984789678860041678999999970799789998773-2671121576897087999999998708915786 Q ss_pred ---------CCEEHHHCCCCCCCC--CCEECCCCCCCEEEEEC-----CC---CCCCCCCEEEEEECC------------ Q ss_conf ---------501011114564433--20101466541399705-----33---454355505898527------------ Q gi|254780158|r 172 ---------VPLILERFTDFNCEI--SIIAARSLNGSICFYDP-----IQ---NTHVNGILHKSIVPA------------ 220 (354) Q Consensus 172 ---------~~~iiEe~I~~~~Ei--sviv~r~~~G~~~~~p~-----~e---n~~~~gil~~s~~Pa------------ 220 (354) T Consensus 85 Qt~~~g~~VnkiliE~~~~I~kEyY~s~v~DR~~~~pv~maS~eGGvdIEEvA~~~Pe~I~k~~idp~~~~~pYq~R~~a 164 (389) T TIGR01016 85 QTDPLGQPVNKILIEEKIDIDKEYYLSIVIDRSAKKPVIMASTEGGVDIEEVAEKSPEKIIKVAIDPLTGLLPYQARELA 164 (389) T ss_pred ECCCCCCEEEEEEECCCCCCCCEEEEEEEEEECCCCCEEEEECCCCCCHHHHHHCCCCCEEEEEECCCCCCCCHHHHHHH T ss_conf 40788863447873267741200147799980478717997067784178995219571688871777777878999999 Q ss_pred ---CCCHHHHHHHHHHHHHHHHHCCCCCCCCCE---EEECCCCEEEEEEECCCCCCCEEE---E-HHHCCCCHHHHHHHH Q ss_conf ---878789999999988677540246775310---455388408999412570456046---2-100135889999999 Q gi|254780158|r 221 ---SISQKTSLLAHSAMRKVLETLDYVGILCIE---FFVTNDGNVIANEMAPRVHNSGHW---T-EASCVISQFEQHIRS 290 (354) Q Consensus 221 ---~i~~~~~~~a~~~a~~i~~~L~~~Gv~~VE---ffv~~dg~i~vnEiaPR~Hnsgh~---t-~~~~~~sqfe~h~ra 290 (354) T Consensus 165 ~~~~l~~~~~~~~~~i~~~Ly~~F~e~Da~L~EINPLViT~~G~L~alDAKl~~DDnALFRH~~l~~~~D~~~~~~~e~~ 244 (389) T TIGR01016 165 KKLGLEGELIKQVASIIKKLYQIFLEKDASLVEINPLVITKDGNLVALDAKLTIDDNALFRHPDLEEMEDYTQEDQLEVE 244 (389) T ss_pred HHCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEECCEEECCCCCEEEEEEECCCCCCHHCCCCCHHHHCCCCCCCHHHHH T ss_conf 97089705778899999999998875371025452636878988899833224465510067116876388877733799 Q ss_pred HHCCCCCCCHHCCC-EEEEEEEC Q ss_conf 81889997000485-67999755 Q gi|254780158|r 291 ITNLPLGNPNRHSN-CVMYNIIG 312 (354) Q Consensus 291 i~glpl~~~~~~~~-~~m~nilg 312 (354) T Consensus 245 A~~~gL~Yv~LdGnIGc~vNGAG 267 (389) T TIGR01016 245 AKQLGLNYVKLDGNIGCMVNGAG 267 (389) T ss_pred HHHHCCCEEEECCCEEEECCCHH T ss_conf 98618836885477079704356

HHsearch alignment for GI: 254780158 and conserved domain: TIGR01016