BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780159|ref|YP_003064572.1| hypothetical protein CLIBASIA_00210 [Candidatus Liberibacter asiaticus str. psy62] (96 letters) Database: nr 13,984,884 sequences; 4,792,584,752 total letters Searching..................................................done >gi|254780159|ref|YP_003064572.1| hypothetical protein CLIBASIA_00210 [Candidatus Liberibacter asiaticus str. psy62] gi|254039836|gb|ACT56632.1| hypothetical protein CLIBASIA_00210 [Candidatus Liberibacter asiaticus str. psy62] Length = 96 Score = 179 bits (453), Expect = 1e-43, Method: Composition-based stats. Identities = 96/96 (100%), Positives = 96/96 (100%) Query: 1 MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSL 60 MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSL Sbjct: 1 MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSL 60 Query: 61 LIILSFTIVQDRRSSPRIDSDIETSEWNSDKNQDTT 96 LIILSFTIVQDRRSSPRIDSDIETSEWNSDKNQDTT Sbjct: 61 LIILSFTIVQDRRSSPRIDSDIETSEWNSDKNQDTT 96 >gi|315122759|ref|YP_004063248.1| hypothetical protein CKC_05065 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496161|gb|ADR52760.1| hypothetical protein CKC_05065 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 89 Score = 112 bits (280), Expect = 2e-23, Method: Composition-based stats. Identities = 63/73 (86%), Positives = 70/73 (95%) Query: 1 MSIFDSRAICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSL 60 M+IFDSRAICSNFPVS FFIFVVLYTIVCASIIG W+Y I+KRPALDMIASMICGLLMSL Sbjct: 1 MNIFDSRAICSNFPVSGFFIFVVLYTIVCASIIGTWKYGIYKRPALDMIASMICGLLMSL 60 Query: 61 LIILSFTIVQDRR 73 LIILSF+I+QD++ Sbjct: 61 LIILSFSIMQDKK 73 Database: nr Posted date: May 13, 2011 4:10 AM Number of letters in database: 999,999,932 Number of sequences in database: 2,987,209 Database: /data/usr2/db/fasta/nr.01 Posted date: May 13, 2011 4:17 AM Number of letters in database: 999,998,956 Number of sequences in database: 2,896,973 Database: /data/usr2/db/fasta/nr.02 Posted date: May 13, 2011 4:23 AM Number of letters in database: 999,999,979 Number of sequences in database: 2,907,862 Database: /data/usr2/db/fasta/nr.03 Posted date: May 13, 2011 4:29 AM Number of letters in database: 999,999,513 Number of sequences in database: 2,932,190 Database: /data/usr2/db/fasta/nr.04 Posted date: May 13, 2011 4:33 AM Number of letters in database: 792,586,372 Number of sequences in database: 2,260,650 Lambda K H 0.327 0.137 0.414 Lambda K H 0.267 0.0442 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 1,142,102,886 Number of Sequences: 13984884 Number of extensions: 43195792 Number of successful extensions: 132620 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 132617 Number of HSP's gapped (non-prelim): 8 length of query: 96 length of database: 4,792,584,752 effective HSP length: 65 effective length of query: 31 effective length of database: 3,883,567,292 effective search space: 120390586052 effective search space used: 120390586052 T: 11 A: 40 X1: 16 ( 7.6 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 76 (33.8 bits)