RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780159|ref|YP_003064572.1| hypothetical protein CLIBASIA_00210 [Candidatus Liberibacter asiaticus str. psy62] (96 letters) >gnl|CDD|146941 pfam04547, Anoctamin, Calcium-activated chloride channel. The family carries eight putative transmembrane domains, and, although it has no similarity to other known channel proteins, it is clearly a calcium-activated ionic channel. It is expressed in various secretory epithelia, the retina and sensory neurons, and mediates receptor-activated chloride currents in diverse physiological processes. Length = 446 Score = 33.7 bits (78), Expect = 0.011 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query: 9 ICSNFPVSAFFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSLLI-ILSF 66 + PV FI +V+ I+ I+ + I+ P + S + +L S++I IL+F Sbjct: 120 QLLSIPVVLLFIGLVIGIIIGIFILRIFLSEIYSGPFKQTLESFLPAILNSVIILILNF 178 >gnl|CDD|32444 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis]. Length = 198 Score = 28.3 bits (63), Expect = 0.48 Identities = 15/59 (25%), Positives = 21/59 (35%), Gaps = 6/59 (10%) Query: 30 ASIIGNWQYSIHKRPALDMIASMICGLLMSLLIILSFTIVQDRRSS------PRIDSDI 82 A I + YSIHK + D + L ++ I R RI+ DI Sbjct: 133 ALEISDVVYSIHKAGSRDFVEKFAADLGGTVTHIERARFPIPRTYPFHRKRVRRIEVDI 191 >gnl|CDD|34014 COG4292, COG4292, Predicted membrane protein [Function unknown]. Length = 387 Score = 27.2 bits (60), Expect = 1.1 Identities = 10/66 (15%), Positives = 28/66 (42%), Gaps = 5/66 (7%) Query: 6 SRAICSNFPVSAFFIFVVLYTIV-----CASIIGNWQYSIHKRPALDMIASMICGLLMSL 60 S + +F ++ F +++L + + N + + L ++ M G+L++ Sbjct: 39 SHLLLGDFSLALFGEYLLLILALWWAWIHTTWFTNRLGTEIEPVRLLLLVLMFFGVLLAA 98 Query: 61 LIILSF 66 + +F Sbjct: 99 SLPPAF 104 >gnl|CDD|39458 KOG4257, KOG4257, KOG4257, Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms]. Length = 974 Score = 25.4 bits (55), Expect = 3.2 Identities = 13/56 (23%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Query: 23 VLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSLLIILSFTIVQDRRSSPRI 78 LY+++ W Y KRP I +++ +L I S + + R+ + I Sbjct: 620 ALYSLMSKC----WAYEPSKRPRFTEIKAILSDVLQEEKINSSEQLRRQRKVASMI 671 >gnl|CDD|32610 COG2717, COG2717, Predicted membrane protein [Function unknown]. Length = 209 Score = 24.8 bits (54), Expect = 5.2 Identities = 14/59 (23%), Positives = 24/59 (40%), Gaps = 7/59 (11%) Query: 19 FIFVVLYTIVCASIIGNWQYS-----IHKRPALDMIASMICGLLMSLLIILSFTIVQDR 72 F + +L+ + + + KRP + MI LL+ L + SF V+ R Sbjct: 85 FFYALLHFTAYLVLDLGLDLALLGLDLLKRPY--ITIGMIAFLLLIPLALTSFKWVRRR 141 >gnl|CDD|33583 COG3788, COG3788, Uncharacterized relative of glutathione S-transferase, MAPEG superfamily [General function prediction only]. Length = 131 Score = 24.9 bits (54), Expect = 5.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Query: 48 MIASMICGLLMSLLIILSFTIVQDRR 73 M++++ L LL+ LSF +V+ R Sbjct: 5 MVSALYAVLNALLLLKLSFDVVRLRM 30 >gnl|CDD|32724 COG2899, COG2899, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 346 Score = 24.8 bits (54), Expect = 5.7 Identities = 12/49 (24%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Query: 18 FFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSLLIILSF 66 +F + + T++ ++ Y A IC +L L I LSF Sbjct: 6 YFGWSFIVTVIALALAAWLGYE---YGGTMWTALFICAVLAVLEISLSF 51 >gnl|CDD|147245 pfam04971, Lysis_S, Lysis protein S. The lysis S protein is a cytotoxic protein forming holes in membranes causing cell lysis. The action of Lysis S is independent of the proportion of acidic phospholipids in the membrane. Length = 68 Score = 24.2 bits (52), Expect = 8.0 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 45 ALDMIASMICGLLMSLLIILSFTIVQDRRSSPR 77 A+ ++ S++ GLL + L L F I +DRR + R Sbjct: 35 AIGVLGSLVFGLL-TYLTNLYFKIREDRRKAAR 66 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.327 0.137 0.414 Gapped Lambda K H 0.267 0.0721 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,145,643 Number of extensions: 50384 Number of successful extensions: 250 Number of sequences better than 10.0: 1 Number of HSP's gapped: 248 Number of HSP's successfully gapped: 37 Length of query: 96 Length of database: 6,263,737 Length adjustment: 64 Effective length of query: 32 Effective length of database: 4,880,761 Effective search space: 156184352 Effective search space used: 156184352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (23.4 bits)