RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780159|ref|YP_003064572.1| hypothetical protein CLIBASIA_00210 [Candidatus Liberibacter asiaticus str. psy62] (96 letters) >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Score = 28.0 bits (62), Expect = 0.50 Identities = 9/43 (20%), Positives = 18/43 (41%), Gaps = 19/43 (44%) Query: 47 DMIASMICGLLMSLLIILSFTIVQDRRSSPRIDSDIETSEWNS 89 D++ ++ CGL ++ D+ +D SEW + Sbjct: 42 DVVCAL-CGL-----------VLSDKL----VD---TRSEWRT 65 >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Score = 27.7 bits (60), Expect = 0.62 Identities = 6/15 (40%), Positives = 9/15 (60%) Query: 38 YSIHKRPALDMIASM 52 Y+ PAL + A+M Sbjct: 32 YADDSAPALAIKATM 46 >2knc_B Integrin beta-3; transmembrane signaling, coiled coil, protein structure, alternative splicing, calcium, cell adhesion; NMR {Homo sapiens} Length = 79 Score = 25.9 bits (57), Expect = 2.6 Identities = 9/48 (18%), Positives = 24/48 (50%) Query: 45 ALDMIASMICGLLMSLLIILSFTIVQDRRSSPRIDSDIETSEWNSDKN 92 L ++ +++ L +LLI + DR+ + + + ++W++ N Sbjct: 14 LLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANN 61 >2o02_A 14-3-3 protein zeta/delta; 14-3-3, adapter protein, pathogen, protein binding/toxin complex; 1.50A {Homo sapiens} SCOP: a.118.7.1 PDB: 2v7d_A* 1qja_A* 1a37_A 1a38_A 1a4o_A* 1ib1_A* 1qjb_A* 2wh0_A* 3cu8_A* 2bq0_A 2c23_A 2b05_A* 2c63_A* 2c74_A* 1ywt_A* 1yz5_A Length = 230 Score = 24.0 bits (52), Expect = 7.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 67 TIVQDRRSSPRIDSDIETSEWNSDKNQ 93 +V RRSS R+ S IE ++K Q Sbjct: 50 NVVGARRSSWRVVSSIEQKTEGAEKKQ 76 >1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Length = 920 Score = 23.9 bits (51), Expect = 8.1 Identities = 14/63 (22%), Positives = 24/63 (38%), Gaps = 14/63 (22%) Query: 18 FFIFVVLYTIVCASIIGNWQYSIHKRPALDMIASMICGLLMSLLIILSFTIVQDRRSSPR 77 FV+ V A+ + +W +ICGL LL+ VQ+ ++ Sbjct: 123 PIQFVMEGAAVLAAGLEDWVD-----------FGVICGL---LLLNAVVGFVQEFQAGSI 168 Query: 78 IDS 80 +D Sbjct: 169 VDE 171 >2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Length = 38 Score = 24.0 bits (52), Expect = 9.3 Identities = 8/26 (30%), Positives = 16/26 (61%) Query: 49 IASMICGLLMSLLIILSFTIVQDRRS 74 I ++I GLL+ ++L + + RR+ Sbjct: 13 IVAVIFGLLLGAALLLGILVFRSRRA 38 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.327 0.137 0.414 Gapped Lambda K H 0.267 0.0486 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 765,887 Number of extensions: 25710 Number of successful extensions: 96 Number of sequences better than 10.0: 1 Number of HSP's gapped: 96 Number of HSP's successfully gapped: 17 Length of query: 96 Length of database: 5,693,230 Length adjustment: 62 Effective length of query: 34 Effective length of database: 4,190,102 Effective search space: 142463468 Effective search space used: 142463468 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.6 bits)