HHsearch alignment for GI: 254780160 and conserved domain: KOG2649

>KOG2649 consensus.
Probab=97.33  E-value=0.002  Score=40.18  Aligned_cols=81  Identities=15%  Similarity=0.161  Sum_probs=62.9

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCEEEECCCCEEECCCCCEEEEEEEECCCC-EEEEEEEEEECCCCEEEEEEECHH
Q ss_conf             8999983478863276089998389979742125212124487028999953882-467779997288504899974101
Q gi|254780160|r  211 ITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKER-NYSREFSVLTGKSTIVEVLMRQKR  289 (298)
Q Consensus       211 ~~~~~v~~~~G~~l~ga~~~i~~~~g~~vt~~~G~~~~~~L~~G~Y~v~a~~~~~-~y~~~ftV~~g~~~~veV~~~~~~  289 (298)
T Consensus       379 GIkG~V~D~~G~~I~NA~IsV~ginHdv~T~~~GDYWR-LL~PG~y~vta~A~Gy~~~tk~v~V~~~~a~~~df~L~~~~  457 (500)
T KOG2649         379 GIKGLVFDDTGNPIANATISVDGINHDVTTAKEGDYWR-LLPPGKYIITASAEGYDPVTKTVTVPPDRAARVNFTLQRSI  457 (500)
T ss_pred             CCCEEEECCCCCCCCCEEEEEECCCCCEEECCCCCEEE-EECCCCEEEEEECCCCCCEEEEEEECCCCCCCEEEEEECCC
T ss_conf             22335886899804764899724767604668885587-50786348998657876510489867887540468984278


Q ss_pred             CCC
Q ss_conf             035
Q gi|254780160|r  290 MDK  292 (298)
Q Consensus       290 ~~~  292 (298)
T Consensus       458 ~~~  460 (500)
T KOG2649         458 PQP  460 (500)
T ss_pred             CCC
T ss_conf             751