HHsearch alignment for GI: 254780160 and conserved domain: cd03858

>cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. The N/E subfamily includes eight members, of which five (CPN, CPE, CPM, CPD, CPZ) are considered enzymatically active, while the other three are non-active (CPX1, PCX2, ACLP/AEBP1) and lack the critical active site and substrate-binding residues considered necessary for CP activity. These non-active members may function as binding proteins or display catalytic activity towards other substrates. Unlike the A/B CP subfamily, enzymes belonging to the N/E subfamily are not produced as inactive precursors that require proteolysis to produce the active form; rather, they rely on their substrate specificity and subcellular compartmentalization to prevent inappr
Probab=97.18  E-value=0.0039  Score=38.29  Aligned_cols=73  Identities=16%  Similarity=0.192  Sum_probs=52.1

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCEEEECCCCEEECCCCCEEEEEEEECCCCEE-EEEEEEEE-CCCCEEEEE
Q ss_conf             899998347886327608999838997974212521212448702899995388246-77799972-885048999
Q gi|254780160|r  211 ITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNY-SREFSVLT-GKSTIVEVL  284 (298)
Q Consensus       211 ~~~~~v~~~~G~~l~ga~~~i~~~~g~~vt~~~G~~~~~~L~~G~Y~v~a~~~~~~y-~~~ftV~~-g~~~~veV~  284 (298)
T Consensus       299 GIkG~V~d~~g~pi~~A~I~V~g~~~~v~t~~~G~ywR-lL~pG~Y~v~~sa~GY~~~t~~v~v~~~~~~~~~~f~  373 (374)
T cd03858         299 GIKGFVRDANGNPIANATISVEGINHDVTTAEDGDYWR-LLLPGTYNVTASAPGYEPQTKSVVVPNDNSAVVVDFT  373 (374)
T ss_pred             CEEEEEECCCCCCCCCEEEEEECCCCCEEECCCCCEEE-ECCCCEEEEEEEECCCCCEEEEEEECCCCCEEEEEEE
T ss_conf             73899988999987773999937535356579986689-7389247999997797761279998899966999768