HHsearch alignment for GI: 254780160 and conserved domain: cd03866

>cd03866 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs).The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPM is an extracellular glycoprotein, bound to cell membranes via a glycosyl-phosphatidylinositol on the C-terminus of the protein. It specifically removes C-terminal basic residues such as lysine and arginine from peptides and proteins. The highest levels of CPM have been found in human lung and placenta, but significant amounts are present in kidney, blood vessels, intestine, brain, and peripheral nerves. CPM has also been found in soluble form in various body fluids, including amniotic fluid, seminal plasma and urine. Due to its wide distribution in a variety of tissues, it is believed that it plays an important role in the cont
Probab=94.30  E-value=0.18  Score=27.53  Aligned_cols=69  Identities=13%  Similarity=0.018  Sum_probs=42.4

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEEECCCCCEEEEEEECCCCCEEEEECCCCEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             43799986157887775518999983897435667505675135210676179999615778544544884288
Q gi|254780160|r  124 GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPG  197 (298)
Q Consensus       124 g~~~~~~~~~~~~~~~~~~~~f~i~~~~~~~~~~~t~~~~~~~~~~L~~G~Y~v~et~a~~~~~~~~~i~V~~g  197 (298)
T Consensus       295 ~GIkG~V~d~~g~--pi~~A~I~V~g--~~hv~~~~t~~~GdywRLL~pG~Y~vtasa-~GY~~~t~~V~V~~~  363 (376)
T cd03866         295 LGVKGQVFDSNGN--PIPNAIVEVKG--RKHICPYRTNVNGEYFLLLLPGKYMINVTA-PGFKTVITNVIIPYN  363 (376)
T ss_pred             CCCEEEEECCCCC--CCCCCEEEEEC--CCCCCCCCCCCCCCEEEEECCCEEEEEEEE-CCCCCCCEEEEECCC
T ss_conf             6873899899999--47880899958--745556445888656988178327999996-797554569998999