HHsearch alignment for GI: 254780160 and conserved domain: cd06245

>cd06245 M14_CPD_III The third carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3.4.17.22), domain III. CPD differs from all other metallocarboxypeptidases in that it contains multiple CP-like domains. CPD belongs to the N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs).The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPD is a single-chain protein containing a signal peptide, three tandem repeats of CP-like domains separated by short bridge regions, followed by a transmembrane domain, and a C-terminal cytosolic tail. The first two CP-like domains of CPD contain all of the essential active site and substrate-binding residues, the third CP-like domain lacks critical residues necessary for enzymatic activity and is inactive towards standard CP substrates. Domain I is optimally active a
Probab=97.67  E-value=0.00047  Score=44.26  Aligned_cols=75  Identities=8%  Similarity=0.095  Sum_probs=58.5

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCEEEECCCCEEECCCCCEEEEEEEECCCCE-EEEEEEEEECCCCEEEEEEEC
Q ss_conf             89999834788632760899983899797421252121244870289999538824-677799972885048999741
Q gi|254780160|r  211 ITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERN-YSREFSVLTGKSTIVEVLMRQ  287 (298)
Q Consensus       211 ~~~~~v~~~~G~~l~ga~~~i~~~~g~~vt~~~G~~~~~~L~~G~Y~v~a~~~~~~-y~~~ftV~~g~~~~veV~~~~  287 (298)
T Consensus       288 GIkG~V~d~~g~PI~~A~I~V~g-~~~v~t~~~Gdy~R-lL~pG~Y~v~~sa~GY~~~t~~v~V~~~~~~~v~f~L~~  363 (363)
T cd06245         288 GVHGVVTDKAGKPISGATIVLNG-GHRVYTKEGGYFHV-LLAPGQHNINVIAEGYQQEHLPVVVSHDEASSVKIVLDM  363 (363)
T ss_pred             CCEEEEECCCCCCCCCCEEEECC-CCCEEECCCCCEEE-ECCCCEEEEEEEECCCCCEEEEEEECCCCCEEEEEEEEC
T ss_conf             73799999999967881899838-73537778972799-727943799999679876248999889994799999719