>cd06245 M14_CPD_III The third carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3.4.17.22), domain III. CPD differs from all other metallocarboxypeptidases in that it contains multiple CP-like domains. CPD belongs to the N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs).The M14 family are zinc-binding CPs which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. CPD is a single-chain protein containing a signal peptide, three tandem repeats of CP-like domains separated by short bridge regions, followed by a transmembrane domain, and a C-terminal cytosolic tail. The first two CP-like domains of CPD contain all of the essential active site and substrate-binding residues, the third CP-like domain lacks critical residues necessary for enzymatic activity and is inactive towards standard CP substrates. Domain I is optimally active a

Probab=96.76 E-value=0.017 Score=34.08 Aligned_cols=77 Identities=19% Similarity=0.102 Sum_probs=52.0 Q ss_pred CCEEEEEEEECCCCCCCCCEEEEEEECCCCCEEEEEEECCCCCEEEEECCCCEEEEEEECCCCCEEEEEEEECCCCEEEE Q ss_conf 64379998615788777551899998389743566750567513521067617999961577854454488428863789 Q gi|254780160|r 123 AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDV 202 (298) Q Consensus 123 ag~~~~~~~~~~~~~~~~~~~~f~i~~~~~~~~~~~t~~~~~~~~~~L~~G~Y~v~et~a~~~~~~~~~i~V~~g~~~~~ 202 (298) T Consensus 286 h~GIkG~V~d~~g~PI--~~A~I~V~--g~~~---v~t~~~Gdy~RlL~pG~Y~v~~sa-~GY~~~t~~v~V~~~~~~~v 357 (363) T cd06245 286 HKGVHGVVTDKAGKPI--SGATIVLN--GGHR---VYTKEGGYFHVLLAPGQHNINVIA-EGYQQEHLPVVVSHDEASSV 357 (363) T ss_pred HCCCEEEEECCCCCCC--CCCEEEEC--CCCC---EEECCCCCEEEECCCCEEEEEEEE-CCCCCEEEEEEECCCCCEEE T ss_conf 1773799999999967--88189983--8735---377789727997279437999996-79876248999889994799 Q ss_pred EEEEC Q ss_conf 99934 Q gi|254780160|r 203 TIQNR 207 (298) Q Consensus 203 tv~~~ 207 (298) T Consensus 358 ~f~L~ 362 (363) T cd06245 358 KIVLD 362 (363) T ss_pred EEEEE T ss_conf 99971

HHsearch alignment for GI: 254780160 and conserved domain: cd06245