HHsearch alignment for GI: 254780160 and conserved domain: pfam05738

>pfam05738 Cna_B Cna protein B-type domain. This domain is found in Staphylococcus aureus collagen-binding surface protein. However, this region does not mediate collagen binding, the pfam05737 region carries out that function. The structure of the repetitive B-region has been solved and forms a beta sandwich structure. It is thought that this region forms a stalk in Staphylococcus aureus collagen-binding protein that presents the ligand binding domain away from the bacterial cell surface.
Probab=97.94  E-value=4.3e-05  Score=50.97  Aligned_cols=59  Identities=19%  Similarity=0.239  Sum_probs=32.3

Q ss_pred             CEEEEEEECCCCCEEE--EEEECCCCCEEEEECCCCEEEEEEECCCCCEEEE---EEEECCCCE
Q ss_conf             5189999838974356--6750567513521067617999961577854454---488428863
Q gi|254780160|r  141 DELTFSIYSNPNHKAL--LITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKI  199 (298)
Q Consensus       141 ~~~~f~i~~~~~~~~~--~~t~~~~~~~~~~L~~G~Y~v~et~a~~~~~~~~---~i~V~~g~~  199 (298)
T Consensus         2 ~Ga~f~L~~~~~~~~~~~~tTd~~G~~~f~~L~~G~Y~v~E~~ap~GY~~~~~~~~~~~~~~~~   65 (69)
T pfam05738         2 EGAEFTLLDNGGKVVGETLTTDSNGKYTFTNLPPGTYTVKETKAPAGYTLTTTPTEFTIEAGQE   65 (69)
T ss_pred             CCCEEEEEECCCCEEEEEEEECCCCEEEECCCCCCEEEEEEEECCCCCEECCCEEEEEECCCCE
T ss_conf             9819999989999998679999998699898799659999981999849899488999948999