HHsearch alignment for GI: 254780160 and conserved domain: pfam08308

>pfam08308 PEGA PEGA domain. This domain is found in both archaea and bacteria and has similarity to S-layer (surface layer) proteins. It is named after the characteristic PEGA sequence motif found in this domain. The secondary structure of this domain is predicted to be beta-strands [Adindla et al. Comparative and Functional Genomics 2004; 5:2-16].
Probab=93.89  E-value=0.39  Score=25.36  Aligned_cols=46  Identities=20%  Similarity=0.136  Sum_probs=35.9

Q ss_pred             CCCCCEEEEECCCCEEEEEEECCCCCEEEEEEEECCCCEEEEEEEEC
Q ss_conf             56751352106761799996157785445448842886378999934
Q gi|254780160|r  161 KVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNR  207 (298)
Q Consensus       161 ~~~~~~~~~L~~G~Y~v~et~a~~~~~~~~~i~V~~g~~~~~tv~~~  207 (298)
T Consensus        23 G~TP~~~~~l~~G~h~v~v~~-~GY~~~~~~v~V~~g~~~~v~~~L~   68 (71)
T pfam08308        23 GSTPVTLSDLPAGTHTLRLEK-EGYEDYSTTVTVTAGETVSVSLTLT   68 (71)
T ss_pred             CCCCCCCCCCCCCCEEEEEEE-CCCEEEEEEEEECCCCEEEEEEEEE
T ss_conf             249874132589668999995-9985079999996999899989998