HHsearch alignment of GI: 254780160 and MMDB domain: 1ti6_B_194-274

>1ti6_B (B:194-274) Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici}
Probab=97.80  E-value=5.4e-05  Score=49.92  Aligned_cols=73  Identities=11%  Similarity=0.037  Sum_probs=50.2

Q ss_pred             CCEEEEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEE-CCCCCEEEEEEECCC
Q ss_conf             23279999986887753467599999538887620588982468566302267218999961-577752789980686
Q gi|254780160|r   36 AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF-GHVGVVKKITVSSKE  112 (298)
Q Consensus        36 ~~~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~-g~~~~~~~vtV~~~~  112 (298)
                      |+...++.+..+.+.++ +||...|++....   ....+|+++|.+.+.+|+||+|.|.+++ |+....+.+++..+.
T Consensus         1 ~q~~~I~G~V~d~~~pi-~gA~V~l~~~~~~---~~~t~Td~~G~f~~~~l~~G~Y~l~vs~~Gy~~~~~~v~~~~~~   74 (81)
T 1ti6_B            1 FEKNYVTAGILVQGDCF-EGAKVVLKSGGKE---VASAETNFFGEFKFDALDNGEYTVEIDADGKSYSDTVVIDDKSV   74 (81)
T ss_dssp             HHCEEEEEEEEETTEEC-TTCEEEEEETTEE---EEEEECCTTSEEEEEEECSEEEEEEEEETTEEEEEEEEESSSCE
T ss_pred             CCCCEECCEEECCCHHH-CCCEEEEECCCCE---EEEECCCCCCCEEECCCCCCEEEEEEEECCCCEEEEEEECCCCC
T ss_conf             88870243231242010-6710367048844---32503577555476651486069999827876068899637883