HHsearch alignment of GI: 254780160 and MMDB domain: 2nsm_A_320-439

>2nsm_A (A:320-439) Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, hormone processing, peptide modification; HET: NAG; 2.10A {Homo sapiens}
Probab=97.65  E-value=0.00015  Score=47.09  Aligned_cols=67  Identities=18%  Similarity=0.108  Sum_probs=33.1

Q ss_pred             EEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEE-CCCCCEEEEEEECCCC
Q ss_conf             9999986887753467599999538887620588982468566302267218999961-5777527899806861
Q gi|254780160|r   40 TCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF-GHVGVVKKITVSSKEK  113 (298)
Q Consensus        40 ~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~-g~~~~~~~vtV~~~~~  113 (298)
                      +++.+..+..+.++.||+.+|    .+.  ... +++...|...++++||.|.+..++ |+......+.+.....
T Consensus         3 tI~G~V~D~~g~pl~ga~V~v----~~~--~~~-t~Td~~G~f~l~~~~g~~~~~~s~~g~~~~~~~~~~~~~~~   70 (120)
T 2nsm_A            3 GIKGMVLDQNYNNLANAVISV----SGI--NHD-VTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEP   70 (120)
T ss_dssp             SEEEEEECTTSCBCTTCEEEE----TTE--EEE-EECCTTSEEEECCCSEEEEEEEECTTEECEEEEEEECSSSC
T ss_pred             EEEEEEECCCCCCCCCEEEEE----CCC--CEE-EEECCCCCEEEECCCCCEEEEEEEECCCCEEEEEEECCCCC
T ss_conf             789999999998178659998----675--102-37779841999728972799999957455799999848981