HHsearch alignment of GI: 254780160 and MMDB domain: 2pz4_A_122-239

>2pz4_A (A:122-239) Protein GBS052; SPAB, GRAM-positive pilins, adhesions, IGG-like domain, cell adhesion; 1.80A {Streptococcus agalactiae}
Probab=98.51  E-value=9.1e-07  Score=61.37  Aligned_cols=83  Identities=19%  Similarity=0.255  Sum_probs=46.5

Q ss_pred             CCEEEEEEEECC--CCCCCCCEEEEEECCCCC-------------------EEEECCCCEEECCCCCEEEEEEEECCCCE
Q ss_conf             523899998347--886327608999838997-------------------97421252121244870289999538824
Q gi|254780160|r  208 AAKITFKLVSEM--GGEAVADTAWSILTASGD-------------------TVGESANASPSMVLSEGDYTVIARNKERN  266 (298)
Q Consensus       208 ~~~~~~~~v~~~--~G~~l~ga~~~i~~~~g~-------------------~vt~~~G~~~~~~L~~G~Y~v~a~~~~~~  266 (298)
                      .+.+.+.+++.+  ++.+|+||+|.|.+.++.                   ..++.+|.+.+.+|++|+|.+.+...|.+
T Consensus         4 ~g~v~i~K~d~~~~~~~~L~Ga~F~l~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~dG~~~~~~L~~G~Y~l~EtkaP~G   83 (118)
T 2pz4_A            4 TGELDLLKVGVDGDTKKPLAGVVFELYEKNGRTPIRVKNGVHSQDIDAAKHLETDSSGHIRISGLIHGDYVLKEIETQSG   83 (118)
T ss_dssp             EEEEEEEEEEEETTEEEECCSCEEEEEETTCSSCBCEETTEECCSTTCBSCEECCTTSEEEEEEEESEEEEEEEEECCTT
T ss_pred             CCCEEEEECCCCCCCCCCCCCCEEEEEECCCCEEEEECCCEECCCCCEEEEEEECCCCEEEECCCCCCEEEEEEEECCCC
T ss_conf             47316875044556653248858999983695722200101035773124799899981987887883499999999999


Q ss_pred             EEE---EEEEEECCCCEEEEEEECHHC
Q ss_conf             677---799972885048999741010
Q gi|254780160|r  267 YSR---EFSVLTGKSTIVEVLMRQKRM  290 (298)
Q Consensus       267 y~~---~ftV~~g~~~~veV~~~~~~~  290 (298)
                      |..   ++++....+..+++.+.++..
T Consensus        84 Y~l~~~~~~~~i~~~~~~~~~~~n~~~  110 (118)
T 2pz4_A           84 YQIGQAETAVTIEKSKTVTVTIENKKV  110 (118)
T ss_dssp             BCCCCSEEEEEECTTSEEEEEEEEEBC
T ss_pred             CCCCCCEEEEEEECCCEEEEEEEEEEC
T ss_conf             384896589999499889999995246