HHsearch alignment of GI: 254780160 and MMDB domain: 2ww8_A_1-142_722-733

>2ww8_A (A:1-142,A:722-733) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae}
Probab=98.25  E-value=7.9e-06  Score=55.30  Aligned_cols=57  Identities=11%  Similarity=0.193  Sum_probs=25.2

Q ss_pred             EEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEE
Q ss_conf             9999986887753467599999538887620588982468566302267218999961
Q gi|254780160|r   40 TCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF   97 (298)
Q Consensus        40 ~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~   97 (298)
                      .++.+..+..+.+++||.|+|++...+.. ....+|+++|.+.+.+||||.|.|.+..
T Consensus        49 ~i~G~V~D~~g~pl~GA~v~l~~~~~g~~-~~~~~Td~~G~f~~~~l~~G~Y~l~~~~  105 (154)
T 2ww8_A           49 KVVIKETGEGGALLGDAVFELKNNTDGTT-VSQRTEAQTGEAIFSNIKPGTYTLTEAQ  105 (154)
T ss_dssp             EEEEEEECSTTCBCCCCEEEEEETTTCCE-EEEECCTTTCEEEEEEECSEEEEEEEEE
T ss_pred             EEEEEEECCCCCCCCCCEEEEEECCCCEE-EEEEEECCCCEEEECCCCCEEEEEEEEE
T ss_conf             89999978999877898899998999979-6899989987799898088789999984