HHsearch alignment of GI: 254780160 and MMDB domain: 2ww8_A_734-893

>2ww8_A (A:734-893) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae}
Probab=98.25  E-value=6.1e-06  Score=56.02  Aligned_cols=78  Identities=9%  Similarity=-0.006  Sum_probs=52.2

Q ss_pred             CEEEEEEEECCCCCCCCCCEEEEEEECCCCCC----------CEEEEEEECCCCEEEECCCCCEEEEEEEECCCCCEE--
Q ss_conf             32799999868877534675999995388876----------205889824685663022672189999615777527--
Q gi|254780160|r   37 QRITCEARLTENSTSIDSGVSWHIFDSISNKK----------NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK--  104 (298)
Q Consensus        37 ~~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~----------g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~g~~~~~~--  104 (298)
                      .++++..+..+++ .+++|++|+||.......          .....+++++|.+.+.+|++|+|.|+|..+|.++..  
T Consensus         3 g~i~i~K~D~~~~-~~L~gA~F~i~~~~~~~~~~~~~~~~~~~~~~~~t~~~G~~~~~~L~~g~Y~i~E~~aP~GY~~~~   81 (160)
T 2ww8_A            3 GDIEFIKVNKNDK-KPLRGAVFSLQKQHPDYPDIYGAIDQNGTYQNVRTGEDGKLTFKNLSDGKYRLFENSEPAGYKPVQ   81 (160)
T ss_dssp             EEEEEEEEETTTC-CBCSSCEEEEEEECSSCSSCEECSSSSCTTSSEECCTTCEEEEEEECSEEEEEEEEECCTTBCCCE
T ss_pred             EEEEEEEEECCCC-CCCCCCEEEEEECCCCCCCEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCEECC
T ss_conf             6799999878999-885872899994689632100124677417899989997699788898059999997899866068


Q ss_pred             ---EEEEECCCCEE
Q ss_conf             ---89980686136
Q gi|254780160|r  105 ---KITVSSKEKNQ  115 (298)
Q Consensus       105 ---~vtV~~~~~~~  115 (298)
                         .+++..+....
T Consensus        82 ~~~~~~i~~~~~~~   95 (160)
T 2ww8_A           82 NKPIVAFQIVNGEV   95 (160)
T ss_dssp             EEEEEEEEEETTEE
T ss_pred             CCCEEEEEEECCCE
T ss_conf             88669999936965