HHsearch alignment of GI: 254780160 and MMDB domain: 3csl_A_

>3csl_A (A:) HASR protein; outer membrane protein, beta-barrel, hemophore receptor, TONB BOX, heme, iron, metal-binding, secreted; HET: HEM; 2.70A {Serratia marcescens} PDB: 3csn_A 3ddr_A*
Probab=92.94  E-value=0.021  Score=33.13  Aligned_cols=49  Identities=6%  Similarity=-0.193  Sum_probs=36.4

Q ss_pred             EEEEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEE
Q ss_conf             2799999868877534675999995388876205889824685663022672189999
Q gi|254780160|r   38 RITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA   95 (298)
Q Consensus        38 ~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~   95 (298)
                      ..+++.++++..+.++.||...|      ..+   .+|+.+|.+.....+++.|.+..
T Consensus        23 ~~~i~G~V~d~~g~pl~ga~v~v------~~~---t~td~~G~f~l~~~~~~~~~~s~   71 (865)
T 3csl_A           23 LQSAMLRFAEQAGMQVFFDEVKL------DGM---QAAALNGSMSVEQGLRRLIGGNP   71 (865)
T ss_dssp             ----------------------------------------------------------
T ss_pred             HHHHHHHHHHHHCCEEEECHHHH------CCC---CCCCCCCCCCHHHHHHHHHCCCC
T ss_conf             99999999998597899778996------987---26875262789999999975798