HHsearch alignment of GI: 254780160 and MMDB domain: 3hr6_A_1-145

>3hr6_A (A:1-145) SPAA, putative surface-anchored fimbrial subunit; multiple IG-like domains, cell WALL, peptidoglycan-anchor, structural protein; 1.60A {Corynebacterium diphtheriae} PDB: 3htl_X*
Probab=97.25  E-value=0.0014  Score=40.84  Aligned_cols=33  Identities=12%  Similarity=0.092  Sum_probs=16.4

Q ss_pred             EEEECCCCCEEEEECCCCEEEEEEECCCCCEEE
Q ss_conf             675056751352106761799996157785445
Q gi|254780160|r  157 LITDKVRSGTLVRLGTNNYQITSHYGKYNAIVS  189 (298)
Q Consensus       157 ~~t~~~~~~~~~~L~~G~Y~v~et~a~~~~~~~  189 (298)
                      ..++..|...+.+|++|.|.|+|+++|.+|.+.
T Consensus        81 ~~Td~~G~~~~~~L~~G~Y~~~Etkap~gy~~~  113 (145)
T 3hr6_A           81 TKKTEGGVAKFDNLTPALYLVVQELNGAEAVVR  113 (145)
T ss_dssp             EEECBTTBEEEEEECSEEEEEEECSCSSSCEEC
T ss_pred             EEECCCCEEEECCCCCEEEEEEEECCCCCCCCC
T ss_conf             687688669988988576899995489874116