Query         gi|254780160|ref|YP_003064573.1| hypothetical protein CLIBASIA_00215 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 298
No_of_seqs    193 out of 319
Neff          8.3 
Searched_HMMs 33803
Date          Mon May 23 01:40:03 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780160.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >3kpt_A Collagen adhesion prot  98.6 9.6E-08 2.8E-12   67.7   7.2   94  124-219     8-106 (107)
  2 >3kpt_A Collagen adhesion prot  98.6 8.5E-08 2.5E-12   68.0   6.7   58  211-268     3-70  (105)
  3 >3kpt_A Collagen adhesion prot  98.6 2.8E-07 8.4E-12   64.6   9.1   93   40-134     9-106 (107)
  4 >2ww8_A RRGA, cell WALL surfac  98.6 3.8E-07 1.1E-11   63.8   9.6   66  124-190     3-81  (160)
  5 >2ww8_A RRGA, cell WALL surfac  98.6 1.8E-07 5.2E-12   66.0   7.6   86  203-289    42-135 (154)
  6 >2pz4_A Protein GBS052; SPAB,   98.5 2.8E-07 8.4E-12   64.6   7.2   86  123-208     4-109 (118)
  7 >2pz4_A Protein GBS052; SPAB,   98.5 9.1E-07 2.7E-11   61.4   9.3   83  208-290     4-110 (118)
  8 >1h8l_A Carboxypeptidase GP180  98.4 8.8E-07 2.6E-11   61.5   7.7   78  209-287     2-80  (81)
  9 >1nkg_A Rhamnogalacturonase B;  98.3 1.4E-06   4E-11   60.2   6.4   80  208-288    13-93  (93)
 10 >3kpt_A Collagen adhesion prot  98.3 9.8E-07 2.9E-11   61.2   5.6   64  125-189     2-72  (105)
 11 >2ww8_A RRGA, cell WALL surfac  98.3 6.1E-06 1.8E-10   56.0   8.4   78   37-115     3-95  (160)
 12 >2ww8_A RRGA, cell WALL surfac  98.3 7.9E-06 2.3E-10   55.3   9.0   57   40-97     49-105 (154)
 13 >3hr6_A SPAA, putative surface  98.0 1.1E-05 3.4E-10   54.3   6.0   33  164-196    92-127 (147)
 14 >1ti6_B Pyrogallol hydroxytran  98.0 1.4E-05 4.2E-10   53.6   6.1   66  209-276     4-73  (81)
 15 >3hr6_A SPAA, putative surface  97.9 6.7E-05   2E-09   49.3   8.3   75  205-279    14-131 (147)
 16 >1ti6_B Pyrogallol hydroxytran  97.8 5.4E-05 1.6E-09   49.9   6.2   73   36-112     1-74  (81)
 17 >2nsm_A Carboxypeptidase N cat  97.6 0.00015 4.3E-09   47.1   6.5   67   40-113     3-70  (120)
 18 >3kcp_A Cellulosomal-scaffoldi  97.5 0.00024 7.1E-09   45.7   6.4   81  207-288     2-91  (98)
 19 >1uwy_A Carboxypeptidase M; me  97.5 0.00038 1.1E-08   44.4   7.3   67   40-111     3-70  (132)
 20 >1nkg_A Rhamnogalacturonase B;  97.5 0.00072 2.1E-08   42.6   8.1   74   36-115    11-85  (93)
 21 >3hr6_A SPAA, putative surface  97.2  0.0014   4E-08   40.8   7.3   33  157-189    81-113 (145)
 22 >3hr6_A SPAA, putative surface  97.2  0.0013 3.9E-08   40.9   7.2   32   72-103    80-111 (145)
 23 >1h8l_A Carboxypeptidase GP180  96.8   0.015 4.4E-07   34.1   9.4   72   40-118     3-76  (81)
 24 >1uwy_A Carboxypeptidase M; me  96.6   0.008 2.4E-07   35.8   6.7   65  211-277     4-71  (132)
 25 >2nsm_A Carboxypeptidase N cat  96.4   0.027   8E-07   32.5   8.4   76  210-287     3-79  (120)
 26 >1cwv_A Invasin; integrin-bind  95.8    0.12 3.4E-06   28.4   9.5   71   39-111    28-102 (104)
 27 >3kcp_A Cellulosomal-scaffoldi  95.7   0.073 2.1E-06   29.7   7.9   70   38-113     3-82  (98)
 28 >3e8v_A Possible transglutamin  95.7    0.13 3.8E-06   28.1   9.6   71  211-286     3-81  (82)
 29 >1xpn_A Hypothetical protein P  95.5    0.04 1.2E-06   31.3   6.1   22  239-260   112-133 (170)
 30 >1xpn_A Hypothetical protein P  95.5   0.036 1.1E-06   31.6   5.7   50  155-204   109-168 (170)
 31 >1cwv_A Invasin; integrin-bind  94.9    0.21 6.3E-06   26.6   8.9   64   39-107    22-90  (98)
 32 >3e8v_A Possible transglutamin  93.9    0.36 1.1E-05   25.1   9.2   77  126-206     3-80  (82)
 33 >2pz4_A Protein GBS052; SPAB,   93.0    0.21 6.2E-06   26.7   5.2   53   46-98     25-97  (121)
 34 >3csl_A HASR protein; outer me  92.9   0.021 6.3E-07   33.1   0.0   49   38-95     23-71  (865)
 35 >1cwv_A Invasin; integrin-bind  90.4     0.9 2.7E-05   22.6   6.1   58   39-99     23-84  (99)
 36 >3pcg_A Protocatechuate 3,4-di  89.4     1.1 3.4E-05   21.9   6.2   59   35-93     45-116 (200)
 37 >1f00_I Intimin; immunoglobuli  88.6     1.3 3.8E-05   21.6   6.6   62   39-102    21-84  (95)
 38 >3pcg_M Protocatechuate 3,4-di  87.5     1.5 4.5E-05   21.1   6.9   76   35-110    74-167 (238)
 39 >2h0e_A Transthyretin-like pro  86.7     1.1 3.3E-05   22.0   4.5   23  211-233    11-33  (121)
 40 >2pn5_A TEP1R, thioester-conta  85.9     1.8 5.5E-05   20.6   9.2   48  227-274    40-99  (102)
 41 >2azq_A Catechol 1,2-dioxygena  83.6     2.3 6.9E-05   19.9   6.9   61   35-95     80-152 (262)
 42 >1tmx_A Hydroxyquinol 1,2-diox  81.8     2.7 8.1E-05   19.5   6.7   60   36-95     25-95  (187)
 43 >1dmh_A 1,2-CTD, catechol 1,2-  81.7     2.8 8.1E-05   19.4   6.6   60   36-95     18-91  (187)
 44 >1f86_A Transthyretin Thr119Me  81.5     2.8 8.3E-05   19.4   5.9   21   74-94     39-63  (115)
 45 >2bum_B Protocatechuate 3,4-di  79.0     3.4 9.9E-05   18.9   7.6   60   35-94     75-151 (241)
 46 >2h4e_A Transthyretin; amyloid  78.9     3.4  0.0001   18.9   5.9   58   37-95     10-73  (127)
 47 >1s9a_A Pyrocatechase, chloroc  78.2     3.6 0.00011   18.7   9.3   59   35-93     74-145 (231)
 48 >1d2o_A Collagen adhesin, CNA;  78.1     3.6 0.00011   18.7   8.7   64  126-189     5-80  (97)
 49 >2p9r_A Alpha-2-M, alpha-2-mac  77.7     3.7 0.00011   18.6   9.3   57  218-274    27-97  (102)
 50 >3hhy_A 1,2-CTD, catechol 1,2-  77.2     3.8 0.00011   18.5   7.4   61   35-95     74-146 (226)
 51 >3d33_A Domain of unknown func  75.6     4.2 0.00012   18.3   6.1   54  221-274    45-108 (108)
 52 >2bum_A Protocatechuate 3,4-di  75.5     4.2 0.00012   18.2   5.2   59   35-93     49-125 (209)
 53 >1wgo_A VPS10 domain-containin  75.1     3.9 0.00012   18.5   3.9   27  166-192    87-113 (123)
 54 >2g2n_A Transthyretin-like pro  74.8     4.4 0.00013   18.1   5.9   55   39-94      6-65  (114)
 55 >3hrz_A Cobra venom factor; se  74.7     4.4 0.00013   18.1   8.9   48  227-274    38-94  (97)
 56 >2boy_A 3-chlorocatechol 1,2-d  71.9     5.1 0.00015   17.7   9.2   59   36-94     27-97  (181)
 57 >2hr0_A Complement C3 beta cha  71.4     5.3 0.00016   17.6   9.4   13  250-262    72-84  (102)
 58 >2c9r_A COPC, copper resistanc  70.1     5.6 0.00017   17.4   5.0   24  250-273    73-101 (102)
 59 >3eja_A Protein GH61E; beta sa  68.4       4 0.00012   18.4   2.7   10  169-178   126-135 (208)
 60 >1lyq_A PCOC copper resistance  65.2       7 0.00021   16.8   4.4   27  247-273    72-103 (104)
 61 >3hn5_A Putative exported prot  64.0     7.4 0.00022   16.7   7.4   78   35-113     7-94  (100)
 62 >2zuy_A YESX protein; beta-pro  63.2     6.6  0.0002   17.0   3.0   15  165-179    49-64  (81)
 63 >2v5m_A Dscam; neurobiology SP  62.8     7.8 0.00023   16.5   8.6  100  172-276    69-175 (175)
 64 >2b39_A C3; thioester, immune   61.5     8.2 0.00024   16.4   7.2   26  249-274    71-99  (102)
 65 >3cu7_A Complement C5; Mg doma  60.5     8.5 0.00025   16.3   7.8   25  250-274    71-98  (199)
 66 >1d2o_A Collagen adhesin, CNA;  59.2       9 0.00027   16.1   7.3   68  126-194     5-84  (90)
 67 >1d2p_A Collagen adhesin, CNA;  59.2       9 0.00027   16.1   7.3   68  126-194     5-84  (90)
 68 >1d2p_A Collagen adhesin, CNA;  57.7     9.5 0.00028   16.0   7.0   68  126-194     6-85  (91)
 69 >1qxp_A MU-like calpain; M-cal  55.7      10  0.0003   15.8   4.2   27  249-275   127-153 (165)
 70 >1d2p_A Collagen adhesin, CNA;  55.1      10 0.00031   15.7   8.7   64  126-189     5-80  (96)
 71 >1d2p_A Collagen adhesin, CNA;  55.1      10 0.00031   15.7   9.2   64  126-189     5-80  (96)
 72 >3bow_A Calpain-2 catalytic su  45.6      15 0.00044   14.7   3.7   12  169-180   127-138 (161)
 73 >2hsi_A Putative peptidase M23  43.4      16 0.00047   14.5   3.7   24  253-276    82-105 (130)
 74 >1nqj_A Class 1 collagenase; b  41.5      17  0.0005   14.3  11.0   15  167-181    92-106 (119)
 75 >2h6u_A 5-hydroxyisourate hydr  41.3      17 0.00051   14.3   4.6   23   73-95     22-48  (75)
 76 >2f82_A HMG-COA synthase; HMGS  40.2      11 0.00033   15.5   1.1   14  167-180    12-25  (36)
 77 >3gld_A Pilin; all-beta, cell   38.9      19 0.00055   14.1  10.6   25  165-189    71-97  (136)
 78 >1ut9_A Cellulose 1,4-beta-cel  38.7      19 0.00055   14.1   5.1   23  252-274    72-97  (100)
 79 >1ej6_A Lambda2; icosahedral,   35.1      21 0.00063   13.7   3.0   15  245-259    54-68  (70)
 80 >1w8o_A Bacterial sialidase; 3  33.6      23 0.00067   13.5  11.1   74  191-274    11-99  (104)
 81 >2pn5_A TEP1R, thioester-conta  33.5      23 0.00067   13.5   6.2   35   11-50     13-47  (106)
 82 >3e7j_A Heparinase II protein;  33.2      23 0.00067   13.5   8.8   22  245-268    47-68  (93)
 83 >2p8u_A Hydroxymethylglutaryl-  32.2      18 0.00053   14.2   1.1   14  167-180    10-23  (35)
 84 >1xf1_A C5A peptidase, SCP; hy  32.1      24  0.0007   13.4   5.3   10  251-260   178-187 (213)
 85 >1kmo_A FECA, iron(III) dicitr  28.9      14  0.0004   15.0   0.0   22   73-94     69-90  (774)
 86 >3c5e_A Acyl-coenzyme A synthe  28.7      27  0.0008   13.0   2.9   25  219-243   164-188 (189)
 87 >2o14_A Hypothetical protein Y  28.5      27 0.00081   13.0   9.8   58  165-222    79-143 (159)
 88 >1w0n_A Endo-1,4-beta-xylanase  28.0      28 0.00083   12.9   8.5   26   83-108    49-75  (131)
 89 >3dmk_A DOWN syndrome cell adh  26.0      30  0.0009   12.7   7.6  106  165-274    65-179 (183)
 90 >1qfh_A Protein (gelation fact  25.3      31 0.00092   12.6   6.2   11   88-98     60-70  (103)
 91 >1wlh_A Gelation factor; ABP-1  25.3      31 0.00092   12.6   6.5   11   88-98     60-70  (103)
 92 >2eyq_A TRCF, transcription-re  24.9      32 0.00094   12.6   3.6   47   84-130    19-65  (85)
 93 >1xf1_A C5A peptidase, SCP; hy  24.3      33 0.00096   12.5   4.4   19  189-207    67-85  (137)
 94 >3bwu_D FIMD, outer membrane u  24.0      33 0.00097   12.5   4.0   12   86-97      1-12  (98)
 95 >1wlh_A Gelation factor; ABP-1  23.7      33 0.00099   12.4   3.6   10   88-97     76-85  (104)
 96 >3cwf_A Alkaline phosphatase s  22.8      35   0.001   12.3   3.9   68  225-292    47-119 (122)
 97 >2eny_A Obscurin; beta-sandwic  22.0      36  0.0011   12.2   2.9   22  252-273    76-97  (104)
 98 >2d7p_A Filamin-C; beta-sandwi  21.1      38  0.0011   12.1   4.6   24  253-276    76-100 (112)
 99 >3gld_A Pilin; all-beta, cell   20.6      39  0.0011   12.0   1.4   10  172-181    95-104 (159)
100 >2blf_A SORA, sulfite\:cytochr  20.5      39  0.0011   12.0   5.9   62  121-183    16-83  (113)
101 >2v5y_A Receptor-type tyrosine  20.4      25 0.00073   13.3   0.0   96  160-255   158-265 (268)

No 1  
>>3kpt_A Collagen adhesion protein; intramolecular amide bond, pilin subunit, beta sheet; 2.10A {Bacillus cereus atcc 14579} (A:1-107)
Probab=98.64  E-value=9.6e-08  Score=67.71  Aligned_cols=94  Identities=13%  Similarity=0.091  Sum_probs=58.2

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEEECCCCCE--EEEEEECCCCCEEEEECCCCEEEEEEECCCCCEEEE---EEEECCCC
Q ss_conf             4379998615788777551899998389743--566750567513521067617999961577854454---48842886
Q gi|254780160|r  124 GGIRLYSIYKPGSPIVDDELTFSIYSNPNHK--ALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGK  198 (298)
Q Consensus       124 g~~~~~~~~~~~~~~~~~~~~f~i~~~~~~~--~~~~t~~~~~~~~~~L~~G~Y~v~et~a~~~~~~~~---~i~V~~g~  198 (298)
                      +.+.+.+++.++.  ++.+++|.|+..++..  ....++..|...+.+|++|.|+|+|+.+|.||.+..   .|+|..++
T Consensus         8 g~i~i~K~d~~g~--~l~GA~f~l~~~~~~~~~~~~tTd~~G~~~~~~l~~G~Y~l~E~~aP~GY~~~~~~~~~~v~~~~   85 (107)
T 3kpt_A            8 GAVDLIKTGVNEK--AXAGAVFSLFKKDGTEVKKELATDANGHIRVQGLEYGEYYFQETKAPKGYVIDPTKREFFVKNSG   85 (107)
T ss_dssp             EEEEEEEECGGGC--BCCSCEEEEEETTSCEEEEEEECCTTSEEEEEEEESEEEEEEEEECCTTBCCCCCCEEEEECSCE
T ss_pred             EEEEEEEECCCCC--CCCCCEEEEEECCCCEEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCCCCCCCCEEEECCCC
T ss_conf             8999999899998--21882899998999999788999999869999808657999999899996133344013651576


Q ss_pred             EEEEEEEECCCEEEEEEEECC
Q ss_conf             378999934523899998347
Q gi|254780160|r  199 IIDVTIQNRAAKITFKLVSEM  219 (298)
Q Consensus       199 ~~~~tv~~~~~~~~~~~v~~~  219 (298)
                      ...+++.+..+.+.+.+++.+
T Consensus        86 ~~~~~~~~~~~~i~i~K~d~~  106 (107)
T 3kpt_A           86 TINEDGTITSGTVVKXEVKNN  106 (107)
T ss_dssp             EECTTSSCEEECEEEEEEECC
T ss_pred             EEEEEEEECCCEEEEEEEEEC
T ss_conf             056521042550456775411


No 2  
>>3kpt_A Collagen adhesion protein; intramolecular amide bond, pilin subunit, beta sheet; 2.10A {Bacillus cereus atcc 14579} (A:251-355)
Probab=98.63  E-value=8.5e-08  Score=68.04  Aligned_cols=58  Identities=10%  Similarity=0.204  Sum_probs=26.3

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCCE----------EEECCCCEEECCCCCEEEEEEEECCCCEEE
Q ss_conf             8999983478863276089998389979----------742125212124487028999953882467
Q gi|254780160|r  211 ITFKLVSEMGGEAVADTAWSILTASGDT----------VGESANASPSMVLSEGDYTVIARNKERNYS  268 (298)
Q Consensus       211 ~~~~~v~~~~G~~l~ga~~~i~~~~g~~----------vt~~~G~~~~~~L~~G~Y~v~a~~~~~~y~  268 (298)
                      +.+.+++.+++++|+||.|.|++.++..          +++++|.+.+.+|++|+|++.+..+|.+|.
T Consensus         3 i~i~K~d~~~~~~l~ga~F~l~~~~~~~~~~~~~~~~~tt~~~G~~~~~~L~~G~Y~l~E~~aP~GY~   70 (105)
T 3kpt_A            3 IELTKIDSANKNKXKGAEFVLKDNNGKIVVVAGKEVTGVSDENGVIKWSNIPYGDYQIFETKAPTYTK   70 (105)
T ss_dssp             EEEEEEETTTCCBCSCCEEEEEETTSCBCBSSSSBCEEECCTTSEEEEEEEESSEEEEEEEECCEEEC
T ss_pred             EEEEEECCCCCCCCCCCEEEEECCCCCEEEECCCEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCC
T ss_conf             26887727887323784788881799899506747899989998799899877049999998998842


No 3  
>>3kpt_A Collagen adhesion protein; intramolecular amide bond, pilin subunit, beta sheet; 2.10A {Bacillus cereus atcc 14579} (A:1-107)
Probab=98.62  E-value=2.8e-07  Score=64.64  Aligned_cols=93  Identities=12%  Similarity=0.124  Sum_probs=58.5

Q ss_pred             EEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEECCCCCE-----EEEEEECCCCE
Q ss_conf             9999986887753467599999538887620588982468566302267218999961577752-----78998068613
Q gi|254780160|r   40 TCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKEKN  114 (298)
Q Consensus        40 ~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~g~~~~~-----~~vtV~~~~~~  114 (298)
                      .|+..+.+..+.+++||+|+||....+.. ...++|+++|.+.+.+|+||+|.|+|..+|.+|.     ..++|..++..
T Consensus         9 ~i~i~K~d~~g~~l~GA~f~l~~~~~~~~-~~~~tTd~~G~~~~~~l~~G~Y~l~E~~aP~GY~~~~~~~~~~v~~~~~~   87 (107)
T 3kpt_A            9 AVDLIKTGVNEKAXAGAVFSLFKKDGTEV-KKELATDANGHIRVQGLEYGEYYFQETKAPKGYVIDPTKREFFVKNSGTI   87 (107)
T ss_dssp             EEEEEEECGGGCBCCSCEEEEEETTSCEE-EEEEECCTTSEEEEEEEESEEEEEEEEECCTTBCCCCCCEEEEECSCEEE
T ss_pred             EEEEEEECCCCCCCCCCEEEEEECCCCEE-EEEEEECCCCEEEECCCCCEEEEEEEEECCCCCCCCCCCCEEEECCCCEE
T ss_conf             99999989999821882899998999999-78899999986999980865799999989999613334401365157605


Q ss_pred             EEEEEECCCCEEEEEEEECC
Q ss_conf             67875136643799986157
Q gi|254780160|r  115 QKQVFILNAGGIRLYSIYKP  134 (298)
Q Consensus       115 ~~~~~~~~ag~~~~~~~~~~  134 (298)
                      . ....+..+.+.+.+++..
T Consensus        88 ~-~~~~~~~~~i~i~K~d~~  106 (107)
T 3kpt_A           88 N-EDGTITSGTVVKXEVKNN  106 (107)
T ss_dssp             C-TTSSCEEECEEEEEEECC
T ss_pred             E-EEEEECCCEEEEEEEEEC
T ss_conf             6-521042550456775411


No 4  
>>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} (A:734-893)
Probab=98.61  E-value=3.8e-07  Score=63.85  Aligned_cols=66  Identities=14%  Similarity=0.069  Sum_probs=36.5

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEEECCCCC-------------EEEEEEECCCCCEEEEECCCCEEEEEEECCCCCEEEE
Q ss_conf             437999861578877755189999838974-------------3566750567513521067617999961577854454
Q gi|254780160|r  124 GGIRLYSIYKPGSPIVDDELTFSIYSNPNH-------------KALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST  190 (298)
Q Consensus       124 g~~~~~~~~~~~~~~~~~~~~f~i~~~~~~-------------~~~~~t~~~~~~~~~~L~~G~Y~v~et~a~~~~~~~~  190 (298)
                      +.+.+.+++.. .+.++++++|.|+.....             .....++..|...+.+|++|+|+|+|+.+|.+|....
T Consensus         3 g~i~i~K~D~~-~~~~L~gA~F~i~~~~~~~~~~~~~~~~~~~~~~~~t~~~G~~~~~~L~~g~Y~i~E~~aP~GY~~~~   81 (160)
T 2ww8_A            3 GDIEFIKVNKN-DKKPLRGAVFSLQKQHPDYPDIYGAIDQNGTYQNVRTGEDGKLTFKNLSDGKYRLFENSEPAGYKPVQ   81 (160)
T ss_dssp             EEEEEEEEETT-TCCBCSSCEEEEEEECSSCSSCEECSSSSCTTSSEECCTTCEEEEEEECSEEEEEEEEECCTTBCCCE
T ss_pred             EEEEEEEEECC-CCCCCCCCEEEEEECCCCCCCEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCEECC
T ss_conf             67999998789-99885872899994689632100124677417899989997699788898059999997899866068


No 5  
>>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} (A:1-142,A:722-733)
Probab=98.60  E-value=1.8e-07  Score=65.99  Aligned_cols=86  Identities=15%  Similarity=0.232  Sum_probs=63.1

Q ss_pred             EEEECCCEEEEEEEECCCCCCCCCEEEEEECCCCC-----EEEECCCCEEECCCCCEEEEEEEECCCCEE---EEEEEEE
Q ss_conf             99934523899998347886327608999838997-----974212521212448702899995388246---7779997
Q gi|254780160|r  203 TIQNRAAKITFKLVSEMGGEAVADTAWSILTASGD-----TVGESANASPSMVLSEGDYTVIARNKERNY---SREFSVL  274 (298)
Q Consensus       203 tv~~~~~~~~~~~v~~~~G~~l~ga~~~i~~~~g~-----~vt~~~G~~~~~~L~~G~Y~v~a~~~~~~y---~~~ftV~  274 (298)
                      ......+.+.++++| +.|+||+||.|.|.+.+..     .+|+++|.|.+.+||+|+|++.+...+.+|   .+++++.
T Consensus        42 ~~~~~~~~i~G~V~D-~~g~pl~GA~v~l~~~~~g~~~~~~~Td~~G~f~~~~l~~G~Y~l~~~~s~~GY~~~~~~v~v~  120 (154)
T 2ww8_A           42 ETSPAIGKVVIKETG-EGGALLGDAVFELKNNTDGTTVSQRTEAQTGEAIFSNIKPGTYTLTEAQPPVGYKPSTKQWTVE  120 (154)
T ss_dssp             ----CCEEEEEEEEC-STTCBCCCCEEEEEETTTCCEEEEECCTTTCEEEEEEECSEEEEEEEEECCTTBCCCCCEEEEE
T ss_pred             CCCCCEEEEEEEEEC-CCCCCCCCCEEEEEECCCCEEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCEEECCCEEEEE
T ss_conf             777606789999978-9998778988999989999796899989987799898088789999984899818379779999


Q ss_pred             ECCCCEEEEEEECHH
Q ss_conf             288504899974101
Q gi|254780160|r  275 TGKSTIVEVLMRQKR  289 (298)
Q Consensus       275 ~g~~~~veV~~~~~~  289 (298)
                      .++...+.|.++...
T Consensus       121 ~~~~~~~~i~L~~~~  135 (154)
T 2ww8_A          121 VEKNGRTTVQGEQVE  135 (154)
T ss_dssp             ECTTCCEEETTCCCE
T ss_pred             ECCCCCEEEEEEEEC
T ss_conf             917982899875101


No 6  
>>2pz4_A Protein GBS052; SPAB, GRAM-positive pilins, adhesions, IGG-like domain, cell adhesion; 1.80A {Streptococcus agalactiae} (A:122-239)
Probab=98.53  E-value=2.8e-07  Score=64.64  Aligned_cols=86  Identities=20%  Similarity=0.261  Sum_probs=48.0

Q ss_pred             CCEEEEEEEECCC-CCCCCCEEEEEEECCCCC----------------EEEEEEECCCCCEEEEECCCCEEEEEEECCCC
Q ss_conf             6437999861578-877755189999838974----------------35667505675135210676179999615778
Q gi|254780160|r  123 AGGIRLYSIYKPG-SPIVDDELTFSIYSNPNH----------------KALLITDKVRSGTLVRLGTNNYQITSHYGKYN  185 (298)
Q Consensus       123 ag~~~~~~~~~~~-~~~~~~~~~f~i~~~~~~----------------~~~~~t~~~~~~~~~~L~~G~Y~v~et~a~~~  185 (298)
                      .+.+.+.+++..+ ...++++++|.|+..++.                .....++.+|...+.+|++|+|+|+|+++|.+
T Consensus         4 ~g~v~i~K~d~~~~~~~~L~Ga~F~l~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~dG~~~~~~L~~G~Y~l~EtkaP~G   83 (118)
T 2pz4_A            4 TGELDLLKVGVDGDTKKPLAGVVFELYEKNGRTPIRVKNGVHSQDIDAAKHLETDSSGHIRISGLIHGDYVLKEIETQSG   83 (118)
T ss_dssp             EEEEEEEEEEEETTEEEECCSCEEEEEETTCSSCBCEETTEECCSTTCBSCEECCTTSEEEEEEEESEEEEEEEEECCTT
T ss_pred             CCCEEEEECCCCCCCCCCCCCCEEEEEECCCCEEEEECCCEECCCCCEEEEEEECCCCEEEECCCCCCEEEEEEEECCCC
T ss_conf             47316875044556653248858999983695722200101035773124799899981987887883499999999999


Q ss_pred             CEEEE---EEEECCCCEEEEEEEECC
Q ss_conf             54454---488428863789999345
Q gi|254780160|r  186 AIVST---VVKVEPGKIIDVTIQNRA  208 (298)
Q Consensus       186 ~~~~~---~i~V~~g~~~~~tv~~~~  208 (298)
                      |.++.   +|++..++..++++.+..
T Consensus        84 Y~l~~~~~~~~i~~~~~~~~~~~n~~  109 (118)
T 2pz4_A           84 YQIGQAETAVTIEKSKTVTVTIENKK  109 (118)
T ss_dssp             BCCCCSEEEEEECTTSEEEEEEEEEB
T ss_pred             CCCCCCEEEEEEECCCEEEEEEEEEE
T ss_conf             38489658999949988999999524


No 7  
>>2pz4_A Protein GBS052; SPAB, GRAM-positive pilins, adhesions, IGG-like domain, cell adhesion; 1.80A {Streptococcus agalactiae} (A:122-239)
Probab=98.51  E-value=9.1e-07  Score=61.37  Aligned_cols=83  Identities=19%  Similarity=0.255  Sum_probs=46.5

Q ss_pred             CCEEEEEEEECC--CCCCCCCEEEEEECCCCC-------------------EEEECCCCEEECCCCCEEEEEEEECCCCE
Q ss_conf             523899998347--886327608999838997-------------------97421252121244870289999538824
Q gi|254780160|r  208 AAKITFKLVSEM--GGEAVADTAWSILTASGD-------------------TVGESANASPSMVLSEGDYTVIARNKERN  266 (298)
Q Consensus       208 ~~~~~~~~v~~~--~G~~l~ga~~~i~~~~g~-------------------~vt~~~G~~~~~~L~~G~Y~v~a~~~~~~  266 (298)
                      .+.+.+.+++.+  ++.+|+||+|.|.+.++.                   ..++.+|.+.+.+|++|+|.+.+...|.+
T Consensus         4 ~g~v~i~K~d~~~~~~~~L~Ga~F~l~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~dG~~~~~~L~~G~Y~l~EtkaP~G   83 (118)
T 2pz4_A            4 TGELDLLKVGVDGDTKKPLAGVVFELYEKNGRTPIRVKNGVHSQDIDAAKHLETDSSGHIRISGLIHGDYVLKEIETQSG   83 (118)
T ss_dssp             EEEEEEEEEEEETTEEEECCSCEEEEEETTCSSCBCEETTEECCSTTCBSCEECCTTSEEEEEEEESEEEEEEEEECCTT
T ss_pred             CCCEEEEECCCCCCCCCCCCCCEEEEEECCCCEEEEECCCEECCCCCEEEEEEECCCCEEEECCCCCCEEEEEEEECCCC
T ss_conf             47316875044556653248858999983695722200101035773124799899981987887883499999999999


Q ss_pred             EEE---EEEEEECCCCEEEEEEECHHC
Q ss_conf             677---799972885048999741010
Q gi|254780160|r  267 YSR---EFSVLTGKSTIVEVLMRQKRM  290 (298)
Q Consensus       267 y~~---~ftV~~g~~~~veV~~~~~~~  290 (298)
                      |..   ++++....+..+++.+.++..
T Consensus        84 Y~l~~~~~~~~i~~~~~~~~~~~n~~~  110 (118)
T 2pz4_A           84 YQIGQAETAVTIEKSKTVTVTIENKKV  110 (118)
T ss_dssp             BCCCCSEEEEEECTTSEEEEEEEEEBC
T ss_pred             CCCCCCEEEEEEECCCEEEEEEEEEEC
T ss_conf             384896589999499889999995246


No 8  
>>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} (A:300-380)
Probab=98.44  E-value=8.8e-07  Score=61.48  Aligned_cols=78  Identities=13%  Similarity=0.124  Sum_probs=68.7

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCEEEECCCCEEECCCCCEEEEEEEECCCC-EEEEEEEEEECCCCEEEEEEEC
Q ss_conf             238999983478863276089998389979742125212124487028999953882-4677799972885048999741
Q gi|254780160|r  209 AKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKER-NYSREFSVLTGKSTIVEVLMRQ  287 (298)
Q Consensus       209 ~~~~~~~v~~~~G~~l~ga~~~i~~~~g~~vt~~~G~~~~~~L~~G~Y~v~a~~~~~-~y~~~ftV~~g~~~~veV~~~~  287 (298)
                      ..+.+++.+..+|+||++|.+.+.+.....+++.+|.|.+ .|++|+|++.++..++ ...+.+.+..+....+++.|+.
T Consensus         2 ~~i~G~V~d~~t~~pl~ga~V~i~~~~~~~~Td~~G~f~~-~l~~G~y~l~vs~~Gy~~~~~~i~v~~~~~~~~~i~L~p   80 (81)
T 1h8l_A            2 RGIWGFVLDATDGRGILNATISVADINHPVTTYKDGDYWR-LLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVNFTLSR   80 (81)
T ss_dssp             CEEEEEEEETTTCSBCTTCEEEETTEEEEEECCTTSEEEE-CCCSEEEEEEEECTTBCCEEEEEEECSSCEEECCEEECB
T ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCEEECCCCCEEE-EECCCEEEEEEEEECCCCEEEEEEEECCCCEEEEEEEEC
T ss_conf             2025899977889736873999942225416668973899-955832799999857742257899948983899999831


No 9  
>>1nkg_A Rhamnogalacturonase B; polysaccharide lyase, carbohydrate active enzyme, pectin; 1.50A {Aspergillus aculeatus} (A:245-337)
Probab=98.32  E-value=1.4e-06  Score=60.25  Aligned_cols=80  Identities=19%  Similarity=0.105  Sum_probs=66.3

Q ss_pred             CCEEEEEEEECCCCCCCCCEEEEEECCCCCEEEECCCCEEECCCCCEEEEEEEECCCC-EEEEEEEEEECCCCEEEEEEE
Q ss_conf             5238999983478863276089998389979742125212124487028999953882-467779997288504899974
Q gi|254780160|r  208 AAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKER-NYSREFSVLTGKSTIVEVLMR  286 (298)
Q Consensus       208 ~~~~~~~~v~~~~G~~l~ga~~~i~~~~g~~vt~~~G~~~~~~L~~G~Y~v~a~~~~~-~y~~~ftV~~g~~~~veV~~~  286 (298)
                      .+.+.++ |.+..|+|+++|.+.+.+......++.+|.|.+..+++|+|.+.++..++ ..++.+++..+++..+.+.++
T Consensus        13 ~~~i~G~-V~d~~g~pi~~a~V~i~~~~~~~~Td~~G~f~l~~~~~g~y~l~~s~~Gy~~~~~~i~~~~~~~~~i~l~l~   91 (93)
T 1nkg_A           13 RGKVAGT-ASGADSSMDWVVHWYNDAAQYWTYTSSSGSFTSPAMKPGTYTMVYYQGEYAVATSSVTVSAGSTTTKNISGS   91 (93)
T ss_dssp             CBEEEEE-EESSCTTSCEEEEEECSSCEEEEECCTTCEEECCCBCSEEEEEEEEETTEEEEEEEEEECTTCEEECCEECC
T ss_pred             CCEEEEE-EEECCCCCCCEEEEECCCEEEEEEECCCCCEECCCCCCCEEEEEEEECCEEEEEEEEEECCCCCEEEEEECC
T ss_conf             7279999-970488887157872375388999258886774771255168999968718886469985686245435616


Q ss_pred             CH
Q ss_conf             10
Q gi|254780160|r  287 QK  288 (298)
Q Consensus       287 ~~  288 (298)
                      .|
T Consensus        92 ~e   93 (93)
T 1nkg_A           92 VK   93 (93)
T ss_dssp             CC
T ss_pred             CC
T ss_conf             88


No 10 
>>3kpt_A Collagen adhesion protein; intramolecular amide bond, pilin subunit, beta sheet; 2.10A {Bacillus cereus atcc 14579} (A:251-355)
Probab=98.32  E-value=9.8e-07  Score=61.16  Aligned_cols=64  Identities=14%  Similarity=0.041  Sum_probs=32.9

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEEECCCCCE-------EEEEEECCCCCEEEEECCCCEEEEEEECCCCCEEE
Q ss_conf             379998615788777551899998389743-------56675056751352106761799996157785445
Q gi|254780160|r  125 GIRLYSIYKPGSPIVDDELTFSIYSNPNHK-------ALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVS  189 (298)
Q Consensus       125 ~~~~~~~~~~~~~~~~~~~~f~i~~~~~~~-------~~~~t~~~~~~~~~~L~~G~Y~v~et~a~~~~~~~  189 (298)
                      .+.+.+++.. ...+++++.|.|+..++..       ....++..|...+.+|++|+|+|+|+.+|.||.+.
T Consensus         2 ~i~i~K~d~~-~~~~l~ga~F~l~~~~~~~~~~~~~~~~~tt~~~G~~~~~~L~~G~Y~l~E~~aP~GY~~~   72 (105)
T 3kpt_A            2 IIELTKIDSA-NKNKXKGAEFVLKDNNGKIVVVAGKEVTGVSDENGVIKWSNIPYGDYQIFETKAPTYTKED   72 (105)
T ss_dssp             EEEEEEEETT-TCCBCSCCEEEEEETTSCBCBSSSSBCEEECCTTSEEEEEEEESSEEEEEEEECCEEECTT
T ss_pred             EEEEEEECCC-CCCCCCCCEEEEECCCCCEEEECCCEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCCCC
T ss_conf             0268877278-8732378478888179989950674789998999879989987704999999899884257


No 11 
>>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} (A:734-893)
Probab=98.25  E-value=6.1e-06  Score=56.02  Aligned_cols=78  Identities=9%  Similarity=-0.006  Sum_probs=52.2

Q ss_pred             CEEEEEEEECCCCCCCCCCEEEEEEECCCCCC----------CEEEEEEECCCCEEEECCCCCEEEEEEEECCCCCEE--
Q ss_conf             32799999868877534675999995388876----------205889824685663022672189999615777527--
Q gi|254780160|r   37 QRITCEARLTENSTSIDSGVSWHIFDSISNKK----------NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK--  104 (298)
Q Consensus        37 ~~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~----------g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~g~~~~~~--  104 (298)
                      .++++..+..+++ .+++|++|+||.......          .....+++++|.+.+.+|++|+|.|+|..+|.++..  
T Consensus         3 g~i~i~K~D~~~~-~~L~gA~F~i~~~~~~~~~~~~~~~~~~~~~~~~t~~~G~~~~~~L~~g~Y~i~E~~aP~GY~~~~   81 (160)
T 2ww8_A            3 GDIEFIKVNKNDK-KPLRGAVFSLQKQHPDYPDIYGAIDQNGTYQNVRTGEDGKLTFKNLSDGKYRLFENSEPAGYKPVQ   81 (160)
T ss_dssp             EEEEEEEEETTTC-CBCSSCEEEEEEECSSCSSCEECSSSSCTTSSEECCTTCEEEEEEECSEEEEEEEEECCTTBCCCE
T ss_pred             EEEEEEEEECCCC-CCCCCCEEEEEECCCCCCCEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEEECCCCCEECC
T ss_conf             6799999878999-885872899994689632100124677417899989997699788898059999997899866068


Q ss_pred             ---EEEEECCCCEE
Q ss_conf             ---89980686136
Q gi|254780160|r  105 ---KITVSSKEKNQ  115 (298)
Q Consensus       105 ---~vtV~~~~~~~  115 (298)
                         .+++..+....
T Consensus        82 ~~~~~~i~~~~~~~   95 (160)
T 2ww8_A           82 NKPIVAFQIVNGEV   95 (160)
T ss_dssp             EEEEEEEEEETTEE
T ss_pred             CCCEEEEEEECCCE
T ss_conf             88669999936965


No 12 
>>2ww8_A RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} (A:1-142,A:722-733)
Probab=98.25  E-value=7.9e-06  Score=55.30  Aligned_cols=57  Identities=11%  Similarity=0.193  Sum_probs=25.2

Q ss_pred             EEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEE
Q ss_conf             9999986887753467599999538887620588982468566302267218999961
Q gi|254780160|r   40 TCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF   97 (298)
Q Consensus        40 ~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~   97 (298)
                      .++.+..+..+.+++||.|+|++...+.. ....+|+++|.+.+.+||||.|.|.+..
T Consensus        49 ~i~G~V~D~~g~pl~GA~v~l~~~~~g~~-~~~~~Td~~G~f~~~~l~~G~Y~l~~~~  105 (154)
T 2ww8_A           49 KVVIKETGEGGALLGDAVFELKNNTDGTT-VSQRTEAQTGEAIFSNIKPGTYTLTEAQ  105 (154)
T ss_dssp             EEEEEEECSTTCBCCCCEEEEEETTTCCE-EEEECCTTTCEEEEEEECSEEEEEEEEE
T ss_pred             EEEEEEECCCCCCCCCCEEEEEECCCCEE-EEEEEECCCCEEEECCCCCEEEEEEEEE
T ss_conf             89999978999877898899998999979-6899989987799898088789999984


No 13 
>>3hr6_A SPAA, putative surface-anchored fimbrial subunit; multiple IG-like domains, cell WALL, peptidoglycan-anchor, structural protein; 1.60A {Corynebacterium diphtheriae} PDB: 3htl_X* (A:290-436)
Probab=98.03  E-value=1.1e-05  Score=54.29  Aligned_cols=33  Identities=9%  Similarity=-0.019  Sum_probs=20.2

Q ss_pred             CCEEEEECCCCEEEEEEECCCCCEEEE---EEEECC
Q ss_conf             513521067617999961577854454---488428
Q gi|254780160|r  164 SGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEP  196 (298)
Q Consensus       164 ~~~~~~L~~G~Y~v~et~a~~~~~~~~---~i~V~~  196 (298)
                      ...+.+|++|+|+|+|++||.||.+..   .|+|..
T Consensus        92 ~~~~~~L~~G~Y~l~E~kAP~GY~l~~~~~~f~i~~  127 (147)
T 3hr6_A           92 YTDAWAGKGTEFCLVETATASGYELLPKPVIVKLEA  127 (147)
T ss_dssp             EEETTTTSCSEEEEEEEECCTTCBCCSSCEEECCCC
T ss_pred             EEEECCCCCCEEEEEEEECCCCCCCCCCCEEEEEEE
T ss_conf             032067898619999966899959899768999962


No 14 
>>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} (B:194-274)
Probab=98.00  E-value=1.4e-05  Score=53.64  Aligned_cols=66  Identities=11%  Similarity=0.074  Sum_probs=48.3

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCE---EEECCCCEEECCCCCEEEEEEEECCCC-EEEEEEEEEEC
Q ss_conf             238999983478863276089998389979---742125212124487028999953882-46777999728
Q gi|254780160|r  209 AKITFKLVSEMGGEAVADTAWSILTASGDT---VGESANASPSMVLSEGDYTVIARNKER-NYSREFSVLTG  276 (298)
Q Consensus       209 ~~~~~~~v~~~~G~~l~ga~~~i~~~~g~~---vt~~~G~~~~~~L~~G~Y~v~a~~~~~-~y~~~ftV~~g  276 (298)
                      +.+..++.  +.|+||++|.+.|.+.++.+   +++++|.|.+.+|++|+|++.++..++ .+.+.+++..+
T Consensus         4 ~~I~G~V~--d~~~pi~gA~V~l~~~~~~~~~t~Td~~G~f~~~~l~~G~Y~l~vs~~Gy~~~~~~v~~~~~   73 (81)
T 1ti6_B            4 NYVTAGIL--VQGDCFEGAKVVLKSGGKEVASAETNFFGEFKFDALDNGEYTVEIDADGKSYSDTVVIDDKS   73 (81)
T ss_dssp             EEEEEEEE--ETTEECTTCEEEEEETTEEEEEEECCTTSEEEEEEECSEEEEEEEEETTEEEEEEEEESSSC
T ss_pred             CEECCEEE--CCCHHHCCCEEEEECCCCEEEEECCCCCCCEEECCCCCCEEEEEEEECCCCEEEEEEECCCC
T ss_conf             70243231--24201067103670488443250357755547665148606999982787606889963788


No 15 
>>3hr6_A SPAA, putative surface-anchored fimbrial subunit; multiple IG-like domains, cell WALL, peptidoglycan-anchor, structural protein; 1.60A {Corynebacterium diphtheriae} PDB: 3htl_X* (A:290-436)
Probab=97.92  E-value=6.7e-05  Score=49.31  Aligned_cols=75  Identities=9%  Similarity=0.107  Sum_probs=41.7

Q ss_pred             EECCCEEEEEEEECC-CCCCCCCEEEEEECCCCC-------------------------------------EEEECCCCE
Q ss_conf             934523899998347-886327608999838997-------------------------------------974212521
Q gi|254780160|r  205 QNRAAKITFKLVSEM-GGEAVADTAWSILTASGD-------------------------------------TVGESANAS  246 (298)
Q Consensus       205 ~~~~~~~~~~~v~~~-~G~~l~ga~~~i~~~~g~-------------------------------------~vt~~~G~~  246 (298)
                      ....+.+.+.+++.. .+++|+||+|.|+...+.                                     .+++..|.+
T Consensus        14 ~~~~g~i~i~K~d~~~~~~~L~GA~F~l~~~~~~~~~~~~~~~~~~~~~~~~~t~~~g~~~~~~~~~~~~~~~~~~~g~~   93 (147)
T 3hr6_A           14 SSKFGQITIEKSFDGNTPGADRTATFQLHRCEADGSLVKSDPPISLDGKQEFVTGQDGKAVLSGIHLGTLQLESNVMKYT   93 (147)
T ss_dssp             EEEEEEEEEEEEETTBCCCTTCCCEEEEEEECTTSCBCTTCCCCCBTTBCCEECCTTSEEEEEEEEEEEEEEETTEEEEE
T ss_pred             CCCCCCEEEEEECCCCCCCCCCCCEEEEEECCCCCEEEECCCCEECCCEEEEEECCCCEEEECCCCCCEEEECCCCCCEE
T ss_conf             00134215787126775412355179999523551143014311205506999789863997475211144014543303


Q ss_pred             EECCCCCEEEEEEEECCCCEEEE-----EEEEEECCCC
Q ss_conf             21244870289999538824677-----7999728850
Q gi|254780160|r  247 PSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKST  279 (298)
Q Consensus       247 ~~~~L~~G~Y~v~a~~~~~~y~~-----~ftV~~g~~~  279 (298)
                      ...+|++|+|.+.+..+|.+|..     .|+|......
T Consensus        94 ~~~~L~~G~Y~l~E~kAP~GY~l~~~~~~f~i~~~~~~  131 (147)
T 3hr6_A           94 DAWAGKGTEFCLVETATASGYELLPKPVIVKLEANEST  131 (147)
T ss_dssp             ETTTTSCSEEEEEEEECCTTCBCCSSCEEECCCCCTTC
T ss_pred             EECCCCCCEEEEEEEECCCCCCCCCCCEEEEEEECCCC
T ss_conf             20678986199999668999598997689999627742


No 16 
>>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} (B:194-274)
Probab=97.80  E-value=5.4e-05  Score=49.92  Aligned_cols=73  Identities=11%  Similarity=0.037  Sum_probs=50.2

Q ss_pred             CCEEEEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEE-CCCCCEEEEEEECCC
Q ss_conf             23279999986887753467599999538887620588982468566302267218999961-577752789980686
Q gi|254780160|r   36 AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF-GHVGVVKKITVSSKE  112 (298)
Q Consensus        36 ~~~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~-g~~~~~~~vtV~~~~  112 (298)
                      |+...++.+..+.+.++ +||...|++....   ....+|+++|.+.+.+|+||+|.|.+++ |+....+.+++..+.
T Consensus         1 ~q~~~I~G~V~d~~~pi-~gA~V~l~~~~~~---~~~t~Td~~G~f~~~~l~~G~Y~l~vs~~Gy~~~~~~v~~~~~~   74 (81)
T 1ti6_B            1 FEKNYVTAGILVQGDCF-EGAKVVLKSGGKE---VASAETNFFGEFKFDALDNGEYTVEIDADGKSYSDTVVIDDKSV   74 (81)
T ss_dssp             HHCEEEEEEEEETTEEC-TTCEEEEEETTEE---EEEEECCTTSEEEEEEECSEEEEEEEEETTEEEEEEEEESSSCE
T ss_pred             CCCCEECCEEECCCHHH-CCCEEEEECCCCE---EEEECCCCCCCEEECCCCCCEEEEEEEECCCCEEEEEEECCCCC
T ss_conf             88870243231242010-6710367048844---32503577555476651486069999827876068899637883


No 17 
>>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, hormone processing, peptide modification; HET: NAG; 2.10A {Homo sapiens} (A:320-439)
Probab=97.65  E-value=0.00015  Score=47.09  Aligned_cols=67  Identities=18%  Similarity=0.108  Sum_probs=33.1

Q ss_pred             EEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEE-CCCCCEEEEEEECCCC
Q ss_conf             9999986887753467599999538887620588982468566302267218999961-5777527899806861
Q gi|254780160|r   40 TCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF-GHVGVVKKITVSSKEK  113 (298)
Q Consensus        40 ~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~-g~~~~~~~vtV~~~~~  113 (298)
                      +++.+..+..+.++.||+.+|    .+.  ... +++...|...++++||.|.+..++ |+......+.+.....
T Consensus         3 tI~G~V~D~~g~pl~ga~V~v----~~~--~~~-t~Td~~G~f~l~~~~g~~~~~~s~~g~~~~~~~~~~~~~~~   70 (120)
T 2nsm_A            3 GIKGMVLDQNYNNLANAVISV----SGI--NHD-VTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEP   70 (120)
T ss_dssp             SEEEEEECTTSCBCTTCEEEE----TTE--EEE-EECCTTSEEEECCCSEEEEEEEECTTEECEEEEEEECSSSC
T ss_pred             EEEEEEECCCCCCCCCEEEEE----CCC--CEE-EEECCCCCEEEECCCCCEEEEEEEECCCCEEEEEEECCCCC
T ss_conf             789999999998178659998----675--102-37779841999728972799999957455799999848981


No 18 
>>3kcp_A Cellulosomal-scaffolding protein A; dockerin, X-module, carbohydrate metabolism, cell WALL biogenesis/degradation; 1.94A {Clostridium thermocellum atcc 27405} PDB: 2b59_B (A:155-252)
Probab=97.54  E-value=0.00024  Score=45.71  Aligned_cols=81  Identities=15%  Similarity=0.059  Sum_probs=59.0

Q ss_pred             CCCEEEEEEEECCCCCC------CCCEEEEEECCCCCEEEECCCCEEECCCCCEE--EEEEEECCCC-EEEEEEEEEECC
Q ss_conf             45238999983478863------27608999838997974212521212448702--8999953882-467779997288
Q gi|254780160|r  207 RAAKITFKLVSEMGGEA------VADTAWSILTASGDTVGESANASPSMVLSEGD--YTVIARNKER-NYSREFSVLTGK  277 (298)
Q Consensus       207 ~~~~~~~~~v~~~~G~~------l~ga~~~i~~~~g~~vt~~~G~~~~~~L~~G~--Y~v~a~~~~~-~y~~~ftV~~g~  277 (298)
                      +...+.+++.+..++++      |++|.+.+.+.....++|.+|.|.+..+|+|.  |++..+.-++ ...+.+....+ 
T Consensus         2 Q~~~i~G~V~d~~~~~~~~~~~~L~~a~v~~~~~~~gt~TD~~G~F~l~~~~~g~~~y~l~iS~iGy~~~~~~v~~~~~-   80 (98)
T 3kcp_A            2 EGYKVSGYILPDFSFDATVAPLVKAGFKVEIVGTELYAVTDANGYFEITGVPANASGYTLKISRATYLDRVIANVVVTG-   80 (98)
T ss_dssp             SSEEEEEEEEESSCCCTTTHHHHHSCCEEEETTSSCEEECCTTSEEEEEEECCEEEEEEEEEECTEECCEEEEEEEESS-
T ss_pred             CCEEEEEEECCCCEECCCCCCCCCCEEEEECCCCEEEEEECCCCEEEEECCCCCCEEEEEEECCCCCEEEEECCCCCCC-
T ss_conf             6338887871551012555424541279732575169996466258840358884478999706872578730310001-


Q ss_pred             CCEEEEEEECH
Q ss_conf             50489997410
Q gi|254780160|r  278 STIVEVLMRQK  288 (298)
Q Consensus       278 ~~~veV~~~~~  288 (298)
                      ...+.+.|+.+
T Consensus        81 ~~~~~i~L~~~   91 (98)
T 3kcp_A           81 DTSVSTSQAPI   91 (98)
T ss_dssp             CEECCCSSSCE
T ss_pred             CCCEEECCCCC
T ss_conf             01012101355


No 19 
>>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} (A:295-426)
Probab=97.53  E-value=0.00038  Score=44.40  Aligned_cols=67  Identities=18%  Similarity=0.273  Sum_probs=39.5

Q ss_pred             EEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEE-CCCCCEEEEEEECC
Q ss_conf             9999986887753467599999538887620588982468566302267218999961-57775278998068
Q gi|254780160|r   40 TCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF-GHVGVVKKITVSSK  111 (298)
Q Consensus        40 ~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~-g~~~~~~~vtV~~~  111 (298)
                      +++.+..+..+.++.||...|-+..   .+. . +++...|...++||||.|.|..++ |+......+.+...
T Consensus         3 tI~G~V~D~~g~pl~~atV~i~~~~---~~~-~-t~Td~~G~f~l~~~~g~y~i~vs~~Gy~~~~~~i~~~~~   70 (132)
T 1uwy_A            3 GVKGQVFDQNGNPLPNVIVEVQDRK---HIC-P-YRTNKYGEYYLLLLPGSYIINVTVPGHDPHITKVIIPEK   70 (132)
T ss_dssp             SEEEEEECTTSCBCCSCEEEETTCC---CSS-C-CBCCTTCEEEECCCSEEEEEEEECSSSCCEEEEEEECSS
T ss_pred             CCEEEEECCCCCCCCCEEEEEECCC---CCE-E-EECCCCCEEEEEECCEEEEEEEEEECCCCEEEEEEECCC
T ss_conf             8489998889986898699996165---734-6-640899539998177669999999477547899997878


No 20 
>>1nkg_A Rhamnogalacturonase B; polysaccharide lyase, carbohydrate active enzyme, pectin; 1.50A {Aspergillus aculeatus} (A:245-337)
Probab=97.48  E-value=0.00072  Score=42.64  Aligned_cols=74  Identities=19%  Similarity=0.131  Sum_probs=54.0

Q ss_pred             CCEEEEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEE-CCCCCEEEEEEECCCCE
Q ss_conf             23279999986887753467599999538887620588982468566302267218999961-57775278998068613
Q gi|254780160|r   36 AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF-GHVGVVKKITVSSKEKN  114 (298)
Q Consensus        36 ~~~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~-g~~~~~~~vtV~~~~~~  114 (298)
                      .+...++.+..+..+.+++||.+++.    +.  ....+|+.+|.+....++||+|.|.+++ ||....+.+++..+...
T Consensus        11 ~~~~~i~G~V~d~~g~pi~~a~V~i~----~~--~~~~~Td~~G~f~l~~~~~g~y~l~~s~~Gy~~~~~~i~~~~~~~~   84 (93)
T 1nkg_A           11 SGRGKVAGTASGADSSMDWVVHWYND----AA--QYWTYTSSSGSFTSPAMKPGTYTMVYYQGEYAVATSSVTVSAGSTT   84 (93)
T ss_dssp             GGCBEEEEEEESSCTTSCEEEEEECS----SC--EEEEECCTTCEEECCCBCSEEEEEEEEETTEEEEEEEEEECTTCEE
T ss_pred             CCCCEEEEEEEECCCCCCCEEEEECC----CE--EEEEEECCCCCEECCCCCCCEEEEEEEECCEEEEEEEEEECCCCCE
T ss_conf             67727999997048888715787237----53--8899925888677477125516899996871888646998568624


Q ss_pred             E
Q ss_conf             6
Q gi|254780160|r  115 Q  115 (298)
Q Consensus       115 ~  115 (298)
                      .
T Consensus        85 ~   85 (93)
T 1nkg_A           85 T   85 (93)
T ss_dssp             E
T ss_pred             E
T ss_conf             5


No 21 
>>3hr6_A SPAA, putative surface-anchored fimbrial subunit; multiple IG-like domains, cell WALL, peptidoglycan-anchor, structural protein; 1.60A {Corynebacterium diphtheriae} PDB: 3htl_X* (A:1-145)
Probab=97.25  E-value=0.0014  Score=40.84  Aligned_cols=33  Identities=12%  Similarity=0.092  Sum_probs=16.4

Q ss_pred             EEEECCCCCEEEEECCCCEEEEEEECCCCCEEE
Q ss_conf             675056751352106761799996157785445
Q gi|254780160|r  157 LITDKVRSGTLVRLGTNNYQITSHYGKYNAIVS  189 (298)
Q Consensus       157 ~~t~~~~~~~~~~L~~G~Y~v~et~a~~~~~~~  189 (298)
                      ..++..|...+.+|++|.|.|+|+++|.+|.+.
T Consensus        81 ~~Td~~G~~~~~~L~~G~Y~~~Etkap~gy~~~  113 (145)
T 3hr6_A           81 TKKTEGGVAKFDNLTPALYLVVQELNGAEAVVR  113 (145)
T ss_dssp             EEECBTTBEEEEEECSEEEEEEECSCSSSCEEC
T ss_pred             EEECCCCEEEECCCCCEEEEEEEECCCCCCCCC
T ss_conf             687688669988988576899995489874116


No 22 
>>3hr6_A SPAA, putative surface-anchored fimbrial subunit; multiple IG-like domains, cell WALL, peptidoglycan-anchor, structural protein; 1.60A {Corynebacterium diphtheriae} PDB: 3htl_X* (A:1-145)
Probab=97.24  E-value=0.0013  Score=40.94  Aligned_cols=32  Identities=25%  Similarity=0.205  Sum_probs=19.0

Q ss_pred             EEEEECCCCEEEECCCCCEEEEEEEECCCCCE
Q ss_conf             88982468566302267218999961577752
Q gi|254780160|r   72 STTKKIIGGKVSFDLFPGDYLISASFGHVGVV  103 (298)
Q Consensus        72 ~~tt~~~G~~~~~~L~pG~Y~v~~s~g~~~~~  103 (298)
                      .++|+++|...+.+|++|.|.|+|+.++.++.
T Consensus        80 ~~~Td~~G~~~~~~L~~G~Y~~~Etkap~gy~  111 (145)
T 3hr6_A           80 ATKKTEGGVAKFDNLTPALYLVVQELNGAEAV  111 (145)
T ss_dssp             EEEECBTTBEEEEEECSEEEEEEECSCSSSCE
T ss_pred             EEEECCCCEEEECCCCCEEEEEEEECCCCCCC
T ss_conf             56876886699889885768999954898741


No 23 
>>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} (A:300-380)
Probab=96.82  E-value=0.015  Score=34.13  Aligned_cols=72  Identities=19%  Similarity=0.074  Sum_probs=46.5

Q ss_pred             EEEEEECCC-CCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEE-CCCCCEEEEEEECCCCEEEE
Q ss_conf             999998688-7753467599999538887620588982468566302267218999961-57775278998068613678
Q gi|254780160|r   40 TCEARLTEN-STSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF-GHVGVVKKITVSSKEKNQKQ  117 (298)
Q Consensus        40 ~l~a~~~~~-~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~-g~~~~~~~vtV~~~~~~~~~  117 (298)
                      +++.+..+. .+.+++||...|-    +  .....+++ ..|...++|++|+|.|.+++ ||......+.+..+......
T Consensus         3 ~i~G~V~d~~t~~pl~ga~V~i~----~--~~~~~~Td-~~G~f~~~l~~G~y~l~vs~~Gy~~~~~~i~v~~~~~~~~~   75 (81)
T 1h8l_A            3 GIWGFVLDATDGRGILNATISVA----D--INHPVTTY-KDGDYWRLLVQGTYKVTASARGYDPVTKTVEVDSKGGVQVN   75 (81)
T ss_dssp             EEEEEEEETTTCSBCTTCEEEET----T--EEEEEECC-TTSEEEECCCSEEEEEEEECTTBCCEEEEEEECSSCEEECC
T ss_pred             EEEEEEEECCCCCCCCCEEEEEE----C--CCCCEEEC-CCCCEEEEECCCEEEEEEEEECCCCEEEEEEEECCCCEEEE
T ss_conf             02589997788973687399994----2--22541666-89738999558327999998577422578999489838999


Q ss_pred             E
Q ss_conf             7
Q gi|254780160|r  118 V  118 (298)
Q Consensus       118 ~  118 (298)
                      +
T Consensus        76 i   76 (81)
T 1h8l_A           76 F   76 (81)
T ss_dssp             E
T ss_pred             E
T ss_conf             9


No 24 
>>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} (A:295-426)
Probab=96.59  E-value=0.008  Score=35.84  Aligned_cols=65  Identities=8%  Similarity=0.033  Sum_probs=45.6

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCC--CEEEECCCCEEECCCCCEEEEEEEECCCC-EEEEEEEEEECC
Q ss_conf             89999834788632760899983899--79742125212124487028999953882-467779997288
Q gi|254780160|r  211 ITFKLVSEMGGEAVADTAWSILTASG--DTVGESANASPSMVLSEGDYTVIARNKER-NYSREFSVLTGK  277 (298)
Q Consensus       211 ~~~~~v~~~~G~~l~ga~~~i~~~~g--~~vt~~~G~~~~~~L~~G~Y~v~a~~~~~-~y~~~ftV~~g~  277 (298)
                      +.++ |.++.|+||++|.+.+.+.+.  ..++++.|.|.+ .||+|.|++..+..++ ..+..+.+....
T Consensus         4 I~G~-V~D~~g~pl~~atV~i~~~~~~~~t~Td~~G~f~l-~~~~g~y~i~vs~~Gy~~~~~~i~~~~~~   71 (132)
T 1uwy_A            4 VKGQ-VFDQNGNPLPNVIVEVQDRKHICPYRTNKYGEYYL-LLLPGSYIINVTVPGHDPHITKVIIPEKS   71 (132)
T ss_dssp             EEEE-EECTTSCBCCSCEEEETTCCCSSCCBCCTTCEEEE-CCCSEEEEEEEECSSSCCEEEEEEECSSC
T ss_pred             CEEE-EECCCCCCCCCEEEEEECCCCCEEEECCCCCEEEE-EECCEEEEEEEEEECCCCEEEEEEECCCC
T ss_conf             4899-98889986898699996165734664089953999-81776699999994775478999978787


No 25 
>>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, hormone processing, peptide modification; HET: NAG; 2.10A {Homo sapiens} (A:320-439)
Probab=96.39  E-value=0.027  Score=32.45  Aligned_cols=76  Identities=18%  Similarity=0.143  Sum_probs=56.7

Q ss_pred             EEEEEEEECCCCCCCCCEEEEEECCCCCEEEECCCCEEECCCCCEEEEEEEECCCCEEE-EEEEEEECCCCEEEEEEEC
Q ss_conf             38999983478863276089998389979742125212124487028999953882467-7799972885048999741
Q gi|254780160|r  210 KITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYS-REFSVLTGKSTIVEVLMRQ  287 (298)
Q Consensus       210 ~~~~~~v~~~~G~~l~ga~~~i~~~~g~~vt~~~G~~~~~~L~~G~Y~v~a~~~~~~y~-~~ftV~~g~~~~veV~~~~  287 (298)
                      .+.++ |.+..|+||++|.+.+.+.+-..+++.+|.|.+ .|++|.|.+.++..++.++ ..+.+.........+++..
T Consensus         3 tI~G~-V~D~~g~pl~ga~V~v~~~~~~t~Td~~G~f~l-~~~~g~~~~~~s~~g~~~~~~~~~~~~~~~~~~~~~l~~   79 (120)
T 2nsm_A            3 GIKGM-VLDQNYNNLANAVISVSGINHDVTSGDHGDYFR-LLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKR   79 (120)
T ss_dssp             SEEEE-EECTTSCBCTTCEEEETTEEEEEECCTTSEEEE-CCCSEEEEEEEECTTEECEEEEEEECSSSCEECCEECEE
T ss_pred             EEEEE-EECCCCCCCCCEEEEECCCCEEEEECCCCCEEE-ECCCCCEEEEEEEECCCCEEEEEEECCCCCEEEEEEECC
T ss_conf             78999-999999817865999867510237779841999-728972799999957455799999848981899999755


No 26 
>>1cwv_A Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} (A:1-104)
Probab=95.77  E-value=0.12  Score=28.36  Aligned_cols=71  Identities=13%  Similarity=0.025  Sum_probs=41.5

Q ss_pred             EEEEEEECCCCCCCCCC--EEEEEEECCCCCCCEEEEEEECCCCEEEE--CCCCCEEEEEEEECCCCCEEEEEEECC
Q ss_conf             79999986887753467--59999953888762058898246856630--226721899996157775278998068
Q gi|254780160|r   39 ITCEARLTENSTSIDSG--VSWHIFDSISNKKNTLSTTKKIIGGKVSF--DLFPGDYLISASFGHVGVVKKITVSSK  111 (298)
Q Consensus        39 i~l~a~~~~~~~~~~~G--~~~~vy~~~~~~~g~~~~tt~~~G~~~~~--~L~pG~Y~v~~s~g~~~~~~~vtV~~~  111 (298)
                      ..+++++.+..++++.|  +.|.+  ..+..-.....+++++|.+...  ...+|.|.|.++........++++.++
T Consensus        28 ~~i~v~v~D~~Gnpv~~~~V~~~~--~~~~~~~~~~~~Td~~G~a~~~l~s~~aG~~~VtAt~~g~~~~~~v~f~~~  102 (104)
T 1cwv_A           28 ITVEFTVADFEGKPLAGQEVVITT--NNGALPNKITEKTDANGVARIALTNTTDGVTVVTAEVEGQRQSVDTHFVKG  102 (104)
T ss_dssp             EEEEEEEECTTSCBCCSCEEEEEC--CTTCBSCEEEEECCTTSEEEEEEBCSSCEEEEEEEEETTEEEEEEEEEECC
T ss_pred             EEEEEEEECCCCCCCCCCEEEEEE--CCCCCCCCCCCCCCCCCEEEEEEECCCCCEEEEEEEECCEEEEEEEEEEEC
T ss_conf             899999994998998899899996--898202555301289838999997767837999999877420003699853


No 27 
>>3kcp_A Cellulosomal-scaffolding protein A; dockerin, X-module, carbohydrate metabolism, cell WALL biogenesis/degradation; 1.94A {Clostridium thermocellum atcc 27405} PDB: 2b59_B (A:155-252)
Probab=95.70  E-value=0.073  Score=29.66  Aligned_cols=70  Identities=10%  Similarity=-0.034  Sum_probs=46.9

Q ss_pred             EEEEEEEECCCCCCC-------CCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCE--EEEEEEE-CCCCCEEEEE
Q ss_conf             279999986887753-------46759999953888762058898246856630226721--8999961-5777527899
Q gi|254780160|r   38 RITCEARLTENSTSI-------DSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGD--YLISASF-GHVGVVKKIT  107 (298)
Q Consensus        38 ~i~l~a~~~~~~~~~-------~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~--Y~v~~s~-g~~~~~~~vt  107 (298)
                      ...++.+..+.....       +.|+.-.+  .. ...   ..+||.+|.+....+|+|.  |.|..+| ||......+.
T Consensus         3 ~~~i~G~V~d~~~~~~~~~~~~L~~a~v~~--~~-~~~---gt~TD~~G~F~l~~~~~g~~~y~l~iS~iGy~~~~~~v~   76 (98)
T 3kcp_A            3 GYKVSGYILPDFSFDATVAPLVKAGFKVEI--VG-TEL---YAVTDANGYFEITGVPANASGYTLKISRATYLDRVIANV   76 (98)
T ss_dssp             SEEEEEEEEESSCCCTTTHHHHHSCCEEEE--TT-SSC---EEECCTTSEEEEEEECCEEEEEEEEEECTEECCEEEEEE
T ss_pred             CEEEEEEECCCCEECCCCCCCCCCEEEEEC--CC-CEE---EEEECCCCEEEEECCCCCCEEEEEEECCCCCEEEEECCC
T ss_conf             338887871551012555424541279732--57-516---999646625884035888447899970687257873031


Q ss_pred             EECCCC
Q ss_conf             806861
Q gi|254780160|r  108 VSSKEK  113 (298)
Q Consensus       108 V~~~~~  113 (298)
                      ...+..
T Consensus        77 ~~~~~~   82 (98)
T 3kcp_A           77 VVTGDT   82 (98)
T ss_dssp             EESSCE
T ss_pred             CCCCCC
T ss_conf             000101


No 28 
>>3e8v_A Possible transglutaminase-family protein; structural genomics, unknown function, PSI-2, protein structure initiative; 2.40A {Bacteroides fragilis nctc 9343} (A:)
Probab=95.66  E-value=0.13  Score=28.08  Aligned_cols=71  Identities=18%  Similarity=0.298  Sum_probs=35.5

Q ss_pred             EEEEEEECCCCCCCCCE--EEEEECCCC-----CEEEECCCCEEECCCCCEEEEEEEECCCC-EEEEEEEEEECCCCEEE
Q ss_conf             89999834788632760--899983899-----79742125212124487028999953882-46777999728850489
Q gi|254780160|r  211 ITFKLVSEMGGEAVADT--AWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKER-NYSREFSVLTGKSTIVE  282 (298)
Q Consensus       211 ~~~~~v~~~~G~~l~ga--~~~i~~~~g-----~~vt~~~G~~~~~~L~~G~Y~v~a~~~~~-~y~~~ftV~~g~~~~ve  282 (298)
                      +.+++++. .|+|++||  .|+|+|-..     ...||++|..++. +-.|+.-+.|+++++ +|.   .+..|++..++
T Consensus         3 ~~V~V~d~-~G~Pv~gA~V~FkiyNYAEfy~va~k~TD~~G~a~lt-~G~Gdmlv~Ask~g~~g~~---k~~~gk~~~~~   77 (82)
T 3e8v_A            3 GSVLVTDA-EGQPVADATVEFKVYNYAEFYTVATKHTDRSGHASLT-AGKGDMLVWASKDGRFGYS---KLSFGKDNELK   77 (82)
T ss_dssp             EEEEEECT-TSCBCTTCEEEEEEEETTEEEEEEEEECCTTSEEEEE-CCSEEEEEEEEETTEEEEE---EEEETTBCEEE
T ss_pred             EEEEEECC-CCCCCCCCEEEEEEEEHHHEEEEEEEEECCCCEEEEE-ECCCCEEEEEECCCEEEEE---EEEECCCCEEE
T ss_conf             49999958-9999899999999970055478367898888649998-3687699999859956899---99717874289


Q ss_pred             EEEE
Q ss_conf             9974
Q gi|254780160|r  283 VLMR  286 (298)
Q Consensus       283 V~~~  286 (298)
                      +.++
T Consensus        78 i~L~   81 (82)
T 3e8v_A           78 ITLD   81 (82)
T ss_dssp             EECC
T ss_pred             EEEC
T ss_conf             9935


No 29 
>>1xpn_A Hypothetical protein PA1324; B-barrel, structural genomics, northeast structural genomics consortium, NESG; NMR {Pseudomonas aeruginosa PAO1} (A:)
Probab=95.53  E-value=0.04  Score=31.33  Aligned_cols=22  Identities=9%  Similarity=0.138  Sum_probs=10.9

Q ss_pred             EEECCCCEEECCCCCEEEEEEE
Q ss_conf             7421252121244870289999
Q gi|254780160|r  239 VGESANASPSMVLSEGDYTVIA  260 (298)
Q Consensus       239 vt~~~G~~~~~~L~~G~Y~v~a  260 (298)
                      ..|.+|.|.+.+||+|+|.+++
T Consensus       112 ~~D~~G~F~F~~lp~G~Yyl~a  133 (170)
T 1xpn_A          112 TTDQNGRFDFDHIPNGTYYISS  133 (170)
T ss_dssp             EECSSCEEEECSCCSEEEEEEE
T ss_pred             EECCCCCEEECCCCCCCEEEEE
T ss_conf             8758860877578996589999


No 30 
>>1xpn_A Hypothetical protein PA1324; B-barrel, structural genomics, northeast structural genomics consortium, NESG; NMR {Pseudomonas aeruginosa PAO1} (A:)
Probab=95.49  E-value=0.036  Score=31.64  Aligned_cols=50  Identities=18%  Similarity=0.156  Sum_probs=28.8

Q ss_pred             EEEEEECCCCCEEEEECCCCEEEEEEEC----------CCCCEEEEEEEECCCCEEEEEE
Q ss_conf             5667505675135210676179999615----------7785445448842886378999
Q gi|254780160|r  155 ALLITDKVRSGTLVRLGTNNYQITSHYG----------KYNAIVSTVVKVEPGKIIDVTI  204 (298)
Q Consensus       155 ~~~~t~~~~~~~~~~L~~G~Y~v~et~a----------~~~~~~~~~i~V~~g~~~~~tv  204 (298)
                      ....+|+.|.+.+.+||+|.|+|.....          +.++.+-..|+|..|++.++++
T Consensus       109 r~t~~D~~G~F~F~~lp~G~Yyl~a~~~~~~~~~~~~~~q~~~i~k~Vtv~~G~t~~v~L  168 (170)
T 1xpn_A          109 REATTDQNGRFDFDHIPNGTYYISSELTWSAQSDGKTITEGGTVTKLVTVSGSQPQKVLL  168 (170)
T ss_dssp             EEEEECSSCEEEECSCCSEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEECCSSCEEEEE
T ss_pred             EEEEECCCCCEEECCCCCCCEEEEEEEEECCCCCCCCCCCCEEEEEEEEECCCCEEEEEE
T ss_conf             166875886087757899658999988764557888774422799999956980899884


No 31 
>>1cwv_A Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} (A:105-202)
Probab=94.94  E-value=0.21  Score=26.64  Aligned_cols=64  Identities=16%  Similarity=0.052  Sum_probs=36.0

Q ss_pred             EEEEEEECCCCCCCCCC--EEEEEEECCCCCCCEEEEEEECCCCEEEE--CCCCCEEEEEEEECC-CCCEEEEE
Q ss_conf             79999986887753467--59999953888762058898246856630--226721899996157-77527899
Q gi|254780160|r   39 ITCEARLTENSTSIDSG--VSWHIFDSISNKKNTLSTTKKIIGGKVSF--DLFPGDYLISASFGH-VGVVKKIT  107 (298)
Q Consensus        39 i~l~a~~~~~~~~~~~G--~~~~vy~~~~~~~g~~~~tt~~~G~~~~~--~L~pG~Y~v~~s~g~-~~~~~~vt  107 (298)
                      ..|++++.+..++++.|  +.|++     ...+....+++++|.+...  ...+|.|.|.++... ......+.
T Consensus        22 ~~vt~~v~D~~Gnpv~~~~V~~~~-----~g~~~~~~~t~~~G~a~~~l~s~~~G~~tvta~~~g~~~~~~~~~   90 (98)
T 1cwv_A           22 STITLELKDTYGDPQAGANVAFDT-----TLGNMGVITDHNDGTYSAPLTSTTLGVATVTVKVDGAAFSVPSVT   90 (98)
T ss_dssp             EEEEEECBBTTSCBCCSCCEEEEE-----SSSEECCCEECSSSEEEEEEECSSCEEEEEEEEETTEEEEEEEEE
T ss_pred             EEEEEEEECCCCCEECCCEEEEEE-----CCCCEEEEEECCCCEEEEEEEECCCCEEEEEEEECCCCCCCCCEE
T ss_conf             799999985889830351788750-----478302588778955999986023651789999647655435348


No 32 
>>3e8v_A Possible transglutaminase-family protein; structural genomics, unknown function, PSI-2, protein structure initiative; 2.40A {Bacteroides fragilis nctc 9343} (A:)
Probab=93.88  E-value=0.36  Score=25.14  Aligned_cols=77  Identities=13%  Similarity=0.122  Sum_probs=38.2

Q ss_pred             EEEEEEECCCCCCCCCEEEEEEECCCC-CEEEEEEECCCCCEEEEECCCCEEEEEEECCCCCEEEEEEEECCCCEEEEEE
Q ss_conf             799986157887775518999983897-4356675056751352106761799996157785445448842886378999
Q gi|254780160|r  126 IRLYSIYKPGSPIVDDELTFSIYSNPN-HKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTI  204 (298)
Q Consensus       126 ~~~~~~~~~~~~~~~~~~~f~i~~~~~-~~~~~~t~~~~~~~~~~L~~G~Y~v~et~a~~~~~~~~~i~V~~g~~~~~tv  204 (298)
                      +.+..++..+.+.+.+.+.|.||+-.. -......++..+.....+-.|+..|-..+... +-.   ..+..++..++++
T Consensus         3 ~~V~V~d~~G~Pv~gA~V~FkiyNYAEfy~va~k~TD~~G~a~lt~G~Gdmlv~Ask~g~-~g~---~k~~~gk~~~~~i   78 (82)
T 3e8v_A            3 GSVLVTDAEGQPVADATVEFKVYNYAEFYTVATKHTDRSGHASLTAGKGDMLVWASKDGR-FGY---SKLSFGKDNELKI   78 (82)
T ss_dssp             EEEEEECTTSCBCTTCEEEEEEEETTEEEEEEEEECCTTSEEEEECCSEEEEEEEEETTE-EEE---EEEEETTBCEEEE
T ss_pred             EEEEEECCCCCCCCCCEEEEEEEEHHHEEEEEEEEECCCCEEEEEECCCCEEEEEECCCE-EEE---EEEEECCCCEEEE
T ss_conf             499999589999899999999970055478367898888649998368769999985995-689---9997178742899


Q ss_pred             EE
Q ss_conf             93
Q gi|254780160|r  205 QN  206 (298)
Q Consensus       205 ~~  206 (298)
                      .+
T Consensus        79 ~L   80 (82)
T 3e8v_A           79 TL   80 (82)
T ss_dssp             EC
T ss_pred             EE
T ss_conf             93


No 33 
>>2pz4_A Protein GBS052; SPAB, GRAM-positive pilins, adhesions, IGG-like domain, cell adhesion; 1.80A {Streptococcus agalactiae} (A:1-121)
Probab=93.02  E-value=0.21  Score=26.70  Aligned_cols=53  Identities=19%  Similarity=0.156  Sum_probs=41.3

Q ss_pred             CCCCCCCCCCEEEEEEECCCCCCCEE--------------------EEEEECCCCEEEECCCCCEEEEEEEEC
Q ss_conf             68877534675999995388876205--------------------889824685663022672189999615
Q gi|254780160|r   46 TENSTSIDSGVSWHIFDSISNKKNTL--------------------STTKKIIGGKVSFDLFPGDYLISASFG   98 (298)
Q Consensus        46 ~~~~~~~~~G~~~~vy~~~~~~~g~~--------------------~~tt~~~G~~~~~~L~pG~Y~v~~s~g   98 (298)
                      .+..+++.+|+.+|+|.-..+.++.+                    ..+|+++|.+.+.+||-|.|.=.+-.+
T Consensus        25 aP~~g~piEGi~YrLyqlk~~~~v~~lS~~~~ltl~eL~~qaq~Vfea~Td~qG~a~f~qLP~GiYyG~Avka   97 (121)
T 2pz4_A           25 APKEGTPIEGVLYQLYQLKSTEDGDLLAHWNSLTITELKKQAQQVFEATTNQQGKATFNQLPDGIYYGLAVKA   97 (121)
T ss_dssp             CCSSCEECSSCEEEEEEESCCCCTTHHHHHHTSCHHHHHHHEEEEEEEECCTTSEEEEEEEESEEEEEEEEET
T ss_pred             ECCCCCCCCCCEEEEEEECCCCCCCCCCCCCCEEEEECCCCCCEEEEEEECCCCEEEECCCCCCEEEEEEEEC
T ss_conf             2389954278389999941566464134443100000046885899999899956998987991199999989


No 34 
>>3csl_A HASR protein; outer membrane protein, beta-barrel, hemophore receptor, TONB BOX, heme, iron, metal-binding, secreted; HET: HEM; 2.70A {Serratia marcescens} PDB: 3csn_A 3ddr_A* (A:)
Probab=92.94  E-value=0.021  Score=33.13  Aligned_cols=49  Identities=6%  Similarity=-0.193  Sum_probs=36.4

Q ss_pred             EEEEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEE
Q ss_conf             2799999868877534675999995388876205889824685663022672189999
Q gi|254780160|r   38 RITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA   95 (298)
Q Consensus        38 ~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~   95 (298)
                      ..+++.++++..+.++.||...|      ..+   .+|+.+|.+.....+++.|.+..
T Consensus        23 ~~~i~G~V~d~~g~pl~ga~v~v------~~~---t~td~~G~f~l~~~~~~~~~~s~   71 (865)
T 3csl_A           23 LQSAMLRFAEQAGMQVFFDEVKL------DGM---QAAALNGSMSVEQGLRRLIGGNP   71 (865)
T ss_dssp             ----------------------------------------------------------
T ss_pred             HHHHHHHHHHHHCCEEEECHHHH------CCC---CCCCCCCCCCHHHHHHHHHCCCC
T ss_conf             99999999998597899778996------987---26875262789999999975798


No 35 
>>1cwv_A Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} (A:203-301)
Probab=90.45  E-value=0.9  Score=22.59  Aligned_cols=58  Identities=12%  Similarity=0.001  Sum_probs=36.3

Q ss_pred             EEEEEEECCCCCCCCCCE--EEEEEECCCCCCCEEEEEEECCCCEEEE--CCCCCEEEEEEEECC
Q ss_conf             799999868877534675--9999953888762058898246856630--226721899996157
Q gi|254780160|r   39 ITCEARLTENSTSIDSGV--SWHIFDSISNKKNTLSTTKKIIGGKVSF--DLFPGDYLISASFGH   99 (298)
Q Consensus        39 i~l~a~~~~~~~~~~~G~--~~~vy~~~~~~~g~~~~tt~~~G~~~~~--~L~pG~Y~v~~s~g~   99 (298)
                      .+|.+++.+..+++..|+  .|+.   ..+........++.+|.+...  .-.+|.|.|.++...
T Consensus        23 ~~i~~~v~D~~Gnpv~~~~v~~~~---~~g~~~~~~~~t~~~G~a~~~lt~~~~G~~~vta~~~g   84 (99)
T 1cwv_A           23 STLSFVPVDKNGHFISGMQGLSFT---QNGVPVSISPITEQPDSYTATVVGNSVGDVTITPQVDT   84 (99)
T ss_dssp             EEEEEECBCTTSCBCCSCCSEEEE---EEESCCEECCCEECSSCEEEEEECSSCEEEEEEEEETT
T ss_pred             EEEEEEECCCCCCCCCCCEEEEEE---CCCCEEEEEEEECCCCEEEEEEECCCCEEEEEEEEECC
T ss_conf             689998514578823562489994---59960445568778985999996774125999999947


No 36 
>>3pcg_A Protocatechuate 3,4-dioxygenase; iron, nonheme, metalloprotein, oxidoreductase; HET: 4HP; 1.96A {Pseudomonas putida} (A:)
Probab=89.44  E-value=1.1  Score=21.92  Aligned_cols=59  Identities=10%  Similarity=0.035  Sum_probs=42.6

Q ss_pred             ECCEEEEEEEECCCCCCCCCCEEEEEEECCCCCCC-------------EEEEEEECCCCEEEECCCCCEEEE
Q ss_conf             02327999998688775346759999953888762-------------058898246856630226721899
Q gi|254780160|r   35 DAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN-------------TLSTTKKIIGGKVSFDLFPGDYLI   93 (298)
Q Consensus        35 ~~~~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g-------------~~~~tt~~~G~~~~~~L~pG~Y~v   93 (298)
                      .+.-+.|..++.+....++.||.+.|+..+.....             .-..+|+++|.+.+.-+.||-|.+
T Consensus        45 ~G~~l~l~G~V~D~~g~Pi~gA~VeiWqad~~G~Y~~~~~~~~~~~~~rg~~~Td~~G~~~f~Ti~Pg~Y~~  116 (200)
T 3pcg_A           45 PGEHILLLGQVYDGNGHLVRDSFLEVWQADANGEYQDAYNLENAFNSFGRTATTFDAGEWTLHTVKPGVVNN  116 (200)
T ss_dssp             SSCEEEEEEEEECTTSCBCTTCEEEEECCCTTSCCCCBCCTTSSBCSEEEEECCSSSCEEEEEEECCCCCBC
T ss_pred             CCCEEEEEEEEECCCCCCCCCEEEEEEECCCCCEECCCCCCCCCCCCCCCEEEECCCCEEEEEECCCCCCCC
T ss_conf             898899999998789987586599999469980245877766575775565760899759999706701107


No 37 
>>1f00_I Intimin; immunoglobulin-like fold, C-type lectin-like fold, cell adhesion; 1.90A {Escherichia coli} (I:1-95)
Probab=88.65  E-value=1.3  Score=21.56  Aligned_cols=62  Identities=19%  Similarity=0.240  Sum_probs=34.0

Q ss_pred             EEEEEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEE--CCCCCEEEEEEEECCCCC
Q ss_conf             7999998688775346759999953888762058898246856630--226721899996157775
Q gi|254780160|r   39 ITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSF--DLFPGDYLISASFGHVGV  102 (298)
Q Consensus        39 i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~--~L~pG~Y~v~~s~g~~~~  102 (298)
                      .+|++++.+++.|+. |.... |....+.......+|+++|.+...  ...+|.|.|.+..+....
T Consensus        21 ~t~tatv~D~gnPv~-g~~V~-f~~~~g~~~~~~~~Td~~G~at~~ltst~aG~~~VtA~~~~~~~   84 (95)
T 1f00_I           21 ITYTVKVMKGDKPVS-NQEVT-FTTTLGKLSNSTEKTDTNGYAKVTLTSTTPGKSLVSARVSDVAV   84 (95)
T ss_dssp             EEEEEEEEETTEECT-TCEEE-EEESSSEESCSEEECCTTSEEEEEEECSSCEEECEEEEETTCCC
T ss_pred             EEEEEEEEECCCCCC-CCEEE-EEECCCEEECCEEEECCCCEEEEEEEECCCCEEEEEEEECCCCC
T ss_conf             999999961991878-98899-99789805023069779984999998125740899999878741


No 38 
>>3pcg_M Protocatechuate 3,4-dioxygenase; iron, nonheme, metalloprotein, oxidoreductase; HET: 4HP; 1.96A {Pseudomonas putida} (M:)
Probab=87.48  E-value=1.5  Score=21.10  Aligned_cols=76  Identities=11%  Similarity=0.018  Sum_probs=50.2

Q ss_pred             ECCEEEEEEEECCCCCCCCCCEEEEEEECCCCC-----------------CCEEEEEEECCCCEEEECCCCCEEEEEEE-
Q ss_conf             023279999986887753467599999538887-----------------62058898246856630226721899996-
Q gi|254780160|r   35 DAQRITCEARLTENSTSIDSGVSWHIFDSISNK-----------------KNTLSTTKKIIGGKVSFDLFPGDYLISAS-   96 (298)
Q Consensus        35 ~~~~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~-----------------~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s-   96 (298)
                      .+.-+.|+.++.+....++.||...|+..+...                 .++=...|+++|.+.+.-+.||-|.+... 
T Consensus        74 ~G~pl~l~G~V~D~~g~Pi~~A~veiWqad~~G~Y~~~~~~~~~~~~~~~~~RG~~~TD~~G~~~f~TI~Pg~Y~~r~~~  153 (238)
T 3pcg_M           74 IGERIIVAGRVVDQYGKPVPNTLVEMWQANAGGRYRHKNDRYLAPLDPNFGGVGRCLTDSDGYYSFRTIKPGPYPWRNGP  153 (238)
T ss_dssp             SSCEEEEEEEEEETTSCBCTTCEEEEECCCTTSCCSSTTCCCSSCCCTTCCCEEEEECCTTSEEEEEEECCCCEEESSST
T ss_pred             CCCEEEEEEEEEECCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEECCCCCCCCCCCC
T ss_conf             87789999999919998758857899736999507887666556668773117899857998599994488564567788


Q ss_pred             ECCCCCEEEEEEEC
Q ss_conf             15777527899806
Q gi|254780160|r   97 FGHVGVVKKITVSS  110 (298)
Q Consensus        97 ~g~~~~~~~vtV~~  110 (298)
                      .........+.|..
T Consensus       154 ~~~r~~HIH~~v~~  167 (238)
T 3pcg_M          154 NDWRPAHIHFGISG  167 (238)
T ss_dssp             TEEECSEEEEEECC
T ss_pred             CCCCCCEEEEEEEE
T ss_conf             87658717899985


No 39 
>>2h0e_A Transthyretin-like protein PUCM; beta sandwitch, hydrolase, HIU; 2.20A {Bacillus subtilis} PDB: 2h0f_A* 2h0j_A* (A:)
Probab=86.75  E-value=1.1  Score=22.02  Aligned_cols=23  Identities=13%  Similarity=0.218  Sum_probs=8.2

Q ss_pred             EEEEEEECCCCCCCCCEEEEEEC
Q ss_conf             89999834788632760899983
Q gi|254780160|r  211 ITFKLVSEMGGEAVADTAWSILT  233 (298)
Q Consensus       211 ~~~~~v~~~~G~~l~ga~~~i~~  233 (298)
                      ++..+.|...|.|-+|..++|..
T Consensus        11 lStHVLDt~~G~PAagv~V~L~~   33 (121)
T 2h0e_A           11 LTTHILDLTCGKPAANVKIGLKR   33 (121)
T ss_dssp             EECCEEETTTTEECTTCEEEEEE
T ss_pred             CEEEEECCCCCCCCCCCEEEEEE
T ss_conf             32778628888937899899998


No 40 
>>2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} (A:98-199)
Probab=85.92  E-value=1.8  Score=20.57  Aligned_cols=48  Identities=13%  Similarity=0.039  Sum_probs=28.8

Q ss_pred             EEEEEECCCCCEE------EECCCC----EEE-CCCCCEEEEEEEECCC-CEEEEEEEEE
Q ss_conf             0899983899797------421252----121-2448702899995388-2467779997
Q gi|254780160|r  227 TAWSILTASGDTV------GESANA----SPS-MVLSEGDYTVIARNKE-RNYSREFSVL  274 (298)
Q Consensus       227 a~~~i~~~~g~~v------t~~~G~----~~~-~~L~~G~Y~v~a~~~~-~~y~~~ftV~  274 (298)
                      ..+.|.++.|..+      ++..|.    |.+ ...+.|.|++.++.++ ..++..|.|+
T Consensus        40 v~~~i~dp~g~~v~~~~~~~~~~G~~~~~f~lp~~~~~G~y~i~~~~~~~~~~~~~f~V~   99 (102)
T 2pn5_A           40 VYVTIRDPQRNVIRKWSTAKLYAGVFESDLQIAPTPMLGVWNISVEVEGEELVSKTFEVK   99 (102)
T ss_dssp             EEEEEECTTCCEEEEEEEEECBTTEEEEEEECCSSCCCEEEEEEEEETTEEEEEEEEEEC
T ss_pred             EEEEEECCCCCEEEEEEEEECCCCEEEEEEECCCCCCCEEEEEEEEECCCCEEEEEEEEE
T ss_conf             899999899989999995608998899998889988881179999988995999999998


No 41 
>>2azq_A Catechol 1,2-dioxygenase; CTD, lipid, isozyme, intradiol, oxidoreductase; HET: PCF; 2.65A {Pseudomonas putida} (A:50-311)
Probab=83.65  E-value=2.3  Score=19.92  Aligned_cols=61  Identities=7%  Similarity=0.060  Sum_probs=46.4

Q ss_pred             ECCEEEEEEEECCCCCCCCCCEEEEEEECCC------------CCCCEEEEEEECCCCEEEECCCCCEEEEEE
Q ss_conf             0232799999868877534675999995388------------876205889824685663022672189999
Q gi|254780160|r   35 DAQRITCEARLTENSTSIDSGVSWHIFDSIS------------NKKNTLSTTKKIIGGKVSFDLFPGDYLISA   95 (298)
Q Consensus        35 ~~~~i~l~a~~~~~~~~~~~G~~~~vy~~~~------------~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~   95 (298)
                      .+.-+.|+.++.+....++.|+.+.|+..+.            +..++=...|+++|.+.+.-+.||-|....
T Consensus        80 ~G~~l~l~g~V~D~~g~Pi~ga~veiWqada~G~Ys~~~~~~~~~~lRG~~~TD~~G~~~f~Ti~Pg~Y~~r~  152 (262)
T 2azq_A           80 PGVVMFLQGQVFDANGKPLAGATVDLWHANTQGTYSYFDSTQSEFNLRRRIITDAEGRYRARSIVPSGYGCDP  152 (262)
T ss_dssp             CCCEEEEEEEEECSSSCBCTTCEEEEECCCTTSCCBTTBTTSCTTTTEEEEECCTTCEEEEEEECCCCEECCT
T ss_pred             CCCEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCEEEEEEEECCCCCCC
T ss_conf             9978999999998999895897888870489776552125788888646896189981999999966867899


No 42 
>>1tmx_A Hydroxyquinol 1,2-dioxygenase; beta barrel, oxidoreductase; HET: HGX; 1.75A {Pimelobacter simplex} (A:107-293)
Probab=81.83  E-value=2.7  Score=19.47  Aligned_cols=60  Identities=12%  Similarity=0.138  Sum_probs=45.3

Q ss_pred             CCEEEEEEEECCCCCCCCCCEEEEEEECC-----------CCCCCEEEEEEECCCCEEEECCCCCEEEEEE
Q ss_conf             23279999986887753467599999538-----------8876205889824685663022672189999
Q gi|254780160|r   36 AQRITCEARLTENSTSIDSGVSWHIFDSI-----------SNKKNTLSTTKKIIGGKVSFDLFPGDYLISA   95 (298)
Q Consensus        36 ~~~i~l~a~~~~~~~~~~~G~~~~vy~~~-----------~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~   95 (298)
                      +.-+.|..++.+....++.|+...|+..+           +...++-...|+++|...+.-+.||.|....
T Consensus        25 G~~l~l~g~V~D~~g~Pv~ga~veiWhad~~G~Ys~~~~~~~~~~RG~~~Td~~G~~~f~Ti~Pg~Y~~r~   95 (187)
T 1tmx_A           25 GEPCWVEGTVTDTDGNPVPDARIEVWEADDDGFYDVQYDDDRTAARAHLLSGPDGGYAFWAITPTPYPIPH   95 (187)
T ss_dssp             SCEEEEEEEEEETTSCBCTTCEEEEECCCTTSCCGGGSSSCCCCSEEEEECCTTSEEEEEEECCCCEECCC
T ss_pred             CCEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCEEEEEECCCCCEEEEEEEECCCCCCC
T ss_conf             87899999999899899767156565248996545664698866544787789980999999967878899


No 43 
>>1dmh_A 1,2-CTD, catechol 1,2-dioxygenase; aromatic hydrocarbon degradation, alpha/beta fold, metalloenzyme, substrate; HET: LIO; 1.70A {Acinetobacter SP} (A:114-300)
Probab=81.72  E-value=2.8  Score=19.45  Aligned_cols=60  Identities=8%  Similarity=0.050  Sum_probs=44.9

Q ss_pred             CCEEEEEEEECCCCCCCCCCEEEEEEECCCC--------------CCCEEEEEEECCCCEEEECCCCCEEEEEE
Q ss_conf             2327999998688775346759999953888--------------76205889824685663022672189999
Q gi|254780160|r   36 AQRITCEARLTENSTSIDSGVSWHIFDSISN--------------KKNTLSTTKKIIGGKVSFDLFPGDYLISA   95 (298)
Q Consensus        36 ~~~i~l~a~~~~~~~~~~~G~~~~vy~~~~~--------------~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~   95 (298)
                      +.-|.|+.++.+....++.||.+.|+..+..              ..++=...|+++|.+.+.-+.||-|....
T Consensus        18 G~~l~i~g~V~D~~g~Pi~~A~veiWqad~~G~Y~~~~~~~~~~~~~~rG~~~Td~~G~~~f~Ti~Pg~Y~~r~   91 (187)
T 1dmh_A           18 GHTLILHGTIFDADGKPLPNAKVEIWHANTKGFYSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPP   91 (187)
T ss_dssp             CCEEEEEEEEECTTSCBCTTCEEEEEECCTTSCCTTSCTTSCCSTTTTEEEEECCTTSEEEEEEECCCCEECCT
T ss_pred             CCEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEEECCCCCCCCC
T ss_conf             87899999999899988688457886069985305668777887667640794089975999998058877789


No 44 
>>1f86_A Transthyretin Thr119Met variant; protein stability, X-RAY amyloidogenesis, transport protein; HET: T44; 1.10A {Homo sapiens} (A:)
Probab=81.51  E-value=2.8  Score=19.40  Aligned_cols=21  Identities=14%  Similarity=0.256  Sum_probs=8.9

Q ss_pred             EEECCCCEEEE----CCCCCEEEEE
Q ss_conf             98246856630----2267218999
Q gi|254780160|r   74 TKKIIGGKVSF----DLFPGDYLIS   94 (298)
Q Consensus        74 tt~~~G~~~~~----~L~pG~Y~v~   94 (298)
                      .|+++|....+    ++.+|.|.|.
T Consensus        39 ~Td~dGR~~~~~~~~~~~~G~Y~l~   63 (115)
T 1f86_A           39 KTSESGELHGLTTEEEFVEGIYKVE   63 (115)
T ss_dssp             ECCTTSEECCSCCTTTCCSEEEEEE
T ss_pred             EECCCCCCCCCCCCCCCCCEEEEEE
T ss_conf             8689998778678455677579999


No 45 
>>2bum_B Protocatechuate 3,4-dioxygenase beta chain; oxidoreductase, aromatic degradation, non-heme iron, beta-sandwich, mixed alpha/beta structure; 1.8A {Acinetobacter SP} (B:)
Probab=79.04  E-value=3.4  Score=18.88  Aligned_cols=60  Identities=10%  Similarity=0.024  Sum_probs=42.5

Q ss_pred             ECCEEEEEEEECCCCCCCCCCEEEEEEECCCCC-----------------CCEEEEEEECCCCEEEECCCCCEEEEE
Q ss_conf             023279999986887753467599999538887-----------------620588982468566302267218999
Q gi|254780160|r   35 DAQRITCEARLTENSTSIDSGVSWHIFDSISNK-----------------KNTLSTTKKIIGGKVSFDLFPGDYLIS   94 (298)
Q Consensus        35 ~~~~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~-----------------~g~~~~tt~~~G~~~~~~L~pG~Y~v~   94 (298)
                      .+.-|.|+.++.+....++.||...|+..+...                 ..+=...|+++|.+.+.-+.||.|...
T Consensus        75 ~G~~l~l~g~V~D~~g~Pi~~A~veiWqad~~G~Y~~~~~~~~~~~~~~~~lRG~~~TD~~G~~~f~TI~Pg~Y~~r  151 (241)
T 2bum_B           75 IGERVIVHGYVRDQFGRPVKNALVEVWQANASGRYRHPNDQYIGAMDPNFGGCGRMLTDDNGYYVFRTIKPGPYPWR  151 (241)
T ss_dssp             SSCEEEEEEEEEETTSCBCCSCEEEEECCCTTSCCSSTTCCCSSCCCTTCCCEEEEECCTTSEEEEEEECCCCEEES
T ss_pred             CCCEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCCCCC
T ss_conf             86779999999999998977836899845899512786655566556665650799868998499996798564678


No 46 
>>2h4e_A Transthyretin; amyloid, sulfite, familial amyloidotic polyneuropathy, transport protein; HET: CSU; 1.45A {Homo sapiens} (A:)
Probab=78.87  E-value=3.4  Score=18.85  Aligned_cols=58  Identities=12%  Similarity=0.162  Sum_probs=28.0

Q ss_pred             CEEEEEEEECCCCCCCCCCEEEEEEECCCCCCCE--EEEEEECCCCEEEE----CCCCCEEEEEE
Q ss_conf             3279999986887753467599999538887620--58898246856630----22672189999
Q gi|254780160|r   37 QRITCEARLTENSTSIDSGVSWHIFDSISNKKNT--LSTTKKIIGGKVSF----DLFPGDYLISA   95 (298)
Q Consensus        37 ~~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~--~~~tt~~~G~~~~~----~L~pG~Y~v~~   95 (298)
                      ..|+.++..+..+.|. +|+..+||....+..-.  -...|+++|....+    ++.+|.|.|.-
T Consensus        10 ~~iStHVLDt~~G~PA-agv~V~L~~~~~~~~~~~i~~~~Td~DGR~~~l~~~~~~~~G~Y~L~F   73 (127)
T 2h4e_A           10 XPLMVKVLDAVRGSPA-INVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEI   73 (127)
T ss_dssp             CCEEEEEEETTTTEEC-TTCEEEEEEECTTSCEEEEEEEECCTTSEECCSCCTTTCCSEEEEEEE
T ss_pred             CCEEEEEEECCCCCCC-CCCEEEEEEECCCCCEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEEE
T ss_conf             8728999608988888-899999999679997699999994799831565576667777899999


No 47 
>>1s9a_A Pyrocatechase, chlorocatechol 1,2-dioxygenase; beta barrel, oxidoreductase; HET: HGP TAM; 2.47A {Rhodococcus opacus} (A:27-257)
Probab=78.20  E-value=3.6  Score=18.72  Aligned_cols=59  Identities=14%  Similarity=0.115  Sum_probs=45.0

Q ss_pred             ECCEEEEEEEECCCCCCCCCCEEEEEEECCCCC-------------CCEEEEEEECCCCEEEECCCCCEEEE
Q ss_conf             023279999986887753467599999538887-------------62058898246856630226721899
Q gi|254780160|r   35 DAQRITCEARLTENSTSIDSGVSWHIFDSISNK-------------KNTLSTTKKIIGGKVSFDLFPGDYLI   93 (298)
Q Consensus        35 ~~~~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~-------------~g~~~~tt~~~G~~~~~~L~pG~Y~v   93 (298)
                      .+..|.|+.++.+....++.|+...|+..+...             .++=...|+++|.+.+.-+.||-|.+
T Consensus        74 ~G~~l~l~G~V~D~~g~Pi~~a~vdiWqad~~G~Y~~~~~~~~~~~~lrG~~~TD~~G~~~f~Ti~Pg~Y~~  145 (231)
T 1s9a_A           74 PGDRMRFTGSVRDTSGTPITGAVIDVWHSTNDGNYSFFSPALPDQYLLRGRVVPAEDGSIEFHSIRPVPYEI  145 (231)
T ss_dssp             SSCEEEEEEEEEETTSCBCTTCEEEEECCCTTSCCTTSCTTSCSSCCSEEEECCCTTSEEEEEEECCCCEEC
T ss_pred             CCCEEEEEEEEECCCCCCCCCEEEEEECCCCCCEECCCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCCC
T ss_conf             987899999999899988256589997179885006766688987565002777899829999975677578


No 48 
>>1d2o_A Collagen adhesin, CNA; beta sandwich, IGG, IGSF, structural protein; 2.00A {Staphylococcus aureus} (A:91-187)
Probab=78.09  E-value=3.6  Score=18.70  Aligned_cols=64  Identities=8%  Similarity=0.092  Sum_probs=39.5

Q ss_pred             EEEEEEECCCC---CCCCCEEEEEEECCCCCEEEEE-EECCC--CCEEEEECCC------CEEEEEEECCCCCEEE
Q ss_conf             79998615788---7775518999983897435667-50567--5135210676------1799996157785445
Q gi|254780160|r  126 IRLYSIYKPGS---PIVDDELTFSIYSNPNHKALLI-TDKVR--SGTLVRLGTN------NYQITSHYGKYNAIVS  189 (298)
Q Consensus       126 ~~~~~~~~~~~---~~~~~~~~f~i~~~~~~~~~~~-t~~~~--~~~~~~L~~G------~Y~v~et~a~~~~~~~  189 (298)
                      +.+.++-.++.   ...+..++|.|+.++......+ .+..+  ...+.+||..      .|.|.|..-|.+|..+
T Consensus         5 i~V~K~W~d~~~~~~~rP~~I~v~L~~~g~~~~~~~~l~~~n~W~~tf~~Lp~~d~G~~~~Y~V~E~~v~~gY~~~   80 (97)
T 1d2o_A            5 ATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTH   80 (97)
T ss_dssp             EEEEEEEESSTTSSSCCCSCEEEEEEETTEEEEEEEEESGGGTTEEEEEEEESEETTEECCEEEEECSCCTTEEEE
T ss_pred             CCEEEEEECCCCCCCCCCCCEEEEEEECCCEECEEEEECCCCCEEEEECCCCCCCCCCEEEEEEEECCCCCCCEEE
T ss_conf             2104374579986654665259999508932031899637898899964887246996788999985679995889


No 49 
>>2p9r_A Alpha-2-M, alpha-2-macroglobulin; human alpha2-macroglobulin, Mg2 domain, X-RAY, signaling protein; 2.30A {Homo sapiens} (A:)
Probab=77.70  E-value=3.7  Score=18.63  Aligned_cols=57  Identities=16%  Similarity=0.212  Sum_probs=32.4

Q ss_pred             CCCCCCCCC--EEEEEECCCCCEE------EECCCC----EEE-CCCCCEEEEEEEECCC-CEEEEEEEEE
Q ss_conf             478863276--0899983899797------421252----121-2448702899995388-2467779997
Q gi|254780160|r  218 EMGGEAVAD--TAWSILTASGDTV------GESANA----SPS-MVLSEGDYTVIARNKE-RNYSREFSVL  274 (298)
Q Consensus       218 ~~~G~~l~g--a~~~i~~~~g~~v------t~~~G~----~~~-~~L~~G~Y~v~a~~~~-~~y~~~ftV~  274 (298)
                      +..+.++++  ..+.+.+++|..+      .+..|.    |.+ ..++.|.|++.++.++ ...+..|.|+
T Consensus        27 ~~~~~~~~~~~~~i~i~dp~g~~v~~~~~~~~~~G~~~~~f~lp~~~~~G~y~v~~~~~~~~~~~~~f~V~   97 (102)
T 2p9r_A           27 DENFHPLNELIPLVYIQDPKGNRIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVE   97 (102)
T ss_dssp             CGGGCBCCCEEEEEEEECTTSCEEEEEEEEECBTTEEEEEEECCSSCCCEEEEEEEECTTSCEEEEEEEEC
T ss_pred             CCCCCCCCCCCCEEEEECCCCCEEEEEEEECCCCCEEEEEEECCCCCCEEEEEEEEEECCCCEEEEEEEEE
T ss_conf             58676386773279999999989998886828886799999999865626799999978897899999999


No 50 
>>3hhy_A 1,2-CTD, catechol 1,2-dioxygenase; beta-sandwich, aromatic hydrocarbons catabolism, iron, metal-binding, oxidoreductase; HET: 6PL; 1.55A {Rhodococcus opacus} PDB: 3hgi_A* 3hj8_A* 3hjq_A* 3hjs_A* 3i4v_A* 3hkp_A* 3i51_A* 3i4y_A* (A:55-280)
Probab=77.19  E-value=3.8  Score=18.54  Aligned_cols=61  Identities=10%  Similarity=0.065  Sum_probs=45.0

Q ss_pred             ECCEEEEEEEECCCCCCCCCCEEEEEEECCC------------CCCCEEEEEEECCCCEEEECCCCCEEEEEE
Q ss_conf             0232799999868877534675999995388------------876205889824685663022672189999
Q gi|254780160|r   35 DAQRITCEARLTENSTSIDSGVSWHIFDSIS------------NKKNTLSTTKKIIGGKVSFDLFPGDYLISA   95 (298)
Q Consensus        35 ~~~~i~l~a~~~~~~~~~~~G~~~~vy~~~~------------~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~   95 (298)
                      .+.-+.|+.++.+....++.|+...|+..+.            +..++=...|+++|.+.+.-+.||-|....
T Consensus        74 ~G~~l~l~G~V~D~~g~Pi~~a~veiWqada~G~Ys~~~~~~~~~~~RG~~~Td~~G~y~f~TI~Pg~Y~~~~  146 (226)
T 3hhy_A           74 KITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPT  146 (226)
T ss_dssp             GSCEEEEEEEEECTTSCBCSSCEEEEECCCTTSCCTTSSTTSCTTTTEEEEECCTTSEEEEEEECCCCEECCC
T ss_pred             CCCEEEEEEEEECCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEEECCCCCCCCC
T ss_conf             8567999999988999996883899983589986467788887766467873589980999998266677888


No 51 
>>3d33_A Domain of unknown function with AN immunoglobulin-like beta-sandwich fold; YP_001297618.1; HET: MSE; 1.70A {Bacteroides vulgatus atcc 8482} (A:)
Probab=75.60  E-value=4.2  Score=18.27  Aligned_cols=54  Identities=15%  Similarity=0.151  Sum_probs=34.1

Q ss_pred             CCCCCCEEEEEEC-CCCCEEEEC-----CC---CEEECCCCCEEEEEEEECCC-CEEEEEEEEE
Q ss_conf             8632760899983-899797421-----25---21212448702899995388-2467779997
Q gi|254780160|r  221 GEAVADTAWSILT-ASGDTVGES-----AN---ASPSMVLSEGDYTVIARNKE-RNYSREFSVL  274 (298)
Q Consensus       221 G~~l~ga~~~i~~-~~g~~vt~~-----~G---~~~~~~L~~G~Y~v~a~~~~-~~y~~~ftV~  274 (298)
                      -+++.+..+++.+ ..|++|...     ++   .+.+.+.+.|+|++.-.++. .-..-.|+++
T Consensus        45 ~~~~~~vtI~I~~~~tG~vVY~~~~~~~~~~~i~I~L~~~~~G~Y~Lei~~~~g~~l~G~F~le  108 (108)
T 3d33_A           45 ASPDRDXTIRITDXAKGGVVYENDIPEVQSAYITISIANFPAEEYKLEITGTPSGHLTGYFTKE  108 (108)
T ss_dssp             SSCCSEEEEEEEETTTCCEEEEEEECGGGTTEEEEECTTSCSEEEEEEEEEESSCEEEEEEEEC
T ss_pred             CCCCCCEEEEEEECCCCCEEEEEEECCCCCCEEEEEECCCCCCEEEEEEECCCCCEEEEEEEEC
T ss_conf             3678966999998988719999864378886899982564673399999848888999999979


No 52 
>>2bum_A Protocatechuate 3,4-dioxygenase alpha chain; oxidoreductase, aromatic degradation, non-heme iron, beta-sandwich, mixed alpha/beta structure; 1.8A {Acinetobacter SP} (A:)
Probab=75.50  E-value=4.2  Score=18.25  Aligned_cols=59  Identities=17%  Similarity=-0.010  Sum_probs=39.7

Q ss_pred             ECCEEEEEEEECCCCCCCCCCEEEEEEECCCCCC-----------------CEE-EEEEECCCCEEEECCCCCEEEE
Q ss_conf             0232799999868877534675999995388876-----------------205-8898246856630226721899
Q gi|254780160|r   35 DAQRITCEARLTENSTSIDSGVSWHIFDSISNKK-----------------NTL-STTKKIIGGKVSFDLFPGDYLI   93 (298)
Q Consensus        35 ~~~~i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~-----------------g~~-~~tt~~~G~~~~~~L~pG~Y~v   93 (298)
                      .+..+.|..++.+....++.||...|+..+....                 |.. .++++++|.+.+.-+.||-|..
T Consensus        49 ~G~~l~l~g~V~D~~g~Pi~~A~veiWqad~~G~Y~~~~~~~~~~~~~n~~g~~r~~ttd~~G~~~f~TI~Pg~Y~~  125 (209)
T 2bum_A           49 QGQRIRLEGQVFDGLGLPLRDVLIEIWQADTNGVYPSQADTQGKQVDPNFLGWGRTGADFGTGFWSFNTIKPGAVPG  125 (209)
T ss_dssp             CSCEEEEEECEECTTSCBCSSCEEEEECCCTTSCCSSTTCCSCSCCCTTCCCEEEEECCTTTCCEEEEEECCCCCBC
T ss_pred             CCCEEEEEEEEECCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEEEECCCCCCCC
T ss_conf             89768999999899998966469999813888853565666565442123304677750899739999689813206


No 53 
>>1wgo_A VPS10 domain-containing receptor sorcs2; polycystic kidney disease, PKD, structural genomics, KIAA1329 protein; NMR {Homo sapiens} (A:)
Probab=75.06  E-value=3.9  Score=18.48  Aligned_cols=27  Identities=7%  Similarity=0.001  Sum_probs=13.8

Q ss_pred             EEEEECCCCEEEEEEECCCCCEEEEEE
Q ss_conf             352106761799996157785445448
Q gi|254780160|r  166 TLVRLGTNNYQITSHYGKYNAIVSTVV  192 (298)
Q Consensus       166 ~~~~L~~G~Y~v~et~a~~~~~~~~~i  192 (298)
                      ......+|.|.|..+..+..-.....+
T Consensus        87 ~~~~~~~G~Y~v~ltvtd~~gs~s~t~  113 (123)
T 1wgo_A           87 RHRYESPGIYRVSVRAENTAGHDEAVL  113 (123)
T ss_dssp             EECCSSCSCEEEEEEEECSSCEEEEEE
T ss_pred             EEEEEECCCEEEEEEEECCCCCEEEEE
T ss_conf             798850895589999997999688999


No 54 
>>2g2n_A Transthyretin-like protein; transthyretin-related protein, unknown function; 1.65A {Escherichia coli} PDB: 2g2p_A 2igl_A 2gpz_A (A:)
Probab=74.79  E-value=4.4  Score=18.13  Aligned_cols=55  Identities=13%  Similarity=0.130  Sum_probs=20.5

Q ss_pred             EEEEEEECCCCCCCCCCEEEEEEECCCCCCCEE-EEEEECCCCEEEE----CCCCCEEEEE
Q ss_conf             799999868877534675999995388876205-8898246856630----2267218999
Q gi|254780160|r   39 ITCEARLTENSTSIDSGVSWHIFDSISNKKNTL-STTKKIIGGKVSF----DLFPGDYLIS   94 (298)
Q Consensus        39 i~l~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~-~~tt~~~G~~~~~----~L~pG~Y~v~   94 (298)
                      |+.++..+..+.|. +|+..+||....+.--.+ ..+|+++|....+    ++.+|.|.|.
T Consensus         6 iStHVLDt~~G~PA-~gv~V~L~~~~~~~~~~i~~~~T~~dGR~~~l~~~~~~~~G~Y~l~   65 (114)
T 2g2n_A            6 LSVHILNQQTGKPA-ADVTVTLEKKADNGWLQLNTAKTDKDGRIKALWPEQTATTGDYRVV   65 (114)
T ss_dssp             EEEEEEETTTTEEC-CSCEEEEEEECSSSEEEEEEEECCTTSEESCCSCSSCCCSEEEEEE
T ss_pred             EEEEEECCCCCCCC-CCCEEEEEEECCCCCEEEEEEEECCCCCCCCCCCCCCCCCEEEEEE
T ss_conf             54878548998937-8998999996699818967878879984667657665665329999


No 55 
>>3hrz_A Cobra venom factor; serine protease, glycosilated, multi-domain, complement system, convertase, complement alternate pathway, complement pathway; HET: NAG P6G; 2.20A {Naja kaouthia} PDB: 3frp_A* 3hs0_A* (A:102-198)
Probab=74.67  E-value=4.4  Score=18.11  Aligned_cols=48  Identities=21%  Similarity=0.239  Sum_probs=32.9

Q ss_pred             EEEEEECCCCCEEEE--CC----CCEEE-CCCCCEEEEEEEEC--CCCEEEEEEEEE
Q ss_conf             089998389979742--12----52121-24487028999953--882467779997
Q gi|254780160|r  227 TAWSILTASGDTVGE--SA----NASPS-MVLSEGDYTVIARN--KERNYSREFSVL  274 (298)
Q Consensus       227 a~~~i~~~~g~~vt~--~~----G~~~~-~~L~~G~Y~v~a~~--~~~~y~~~ftV~  274 (298)
                      ..+.|.+++|+.+..  ..    +.|.+ .+++.|+|++.+..  ....++..|.|+
T Consensus        38 ~~v~i~dp~g~~v~~~~~~G~~~~~f~lp~~~~~G~y~i~~~~~~~~~~~~~~F~Ve   94 (97)
T 3hrz_A           38 VIVEFQTPEGILVSSNSVDLNFFWPYNLPDLVSLGTWRIVAKYEHSPENYTAYFDVR   94 (97)
T ss_dssp             EEEEEECTTCCEEEEEEEBTTBCCCEECCSSCCCEEEEEEEEETTCSCCEEEEEEEC
T ss_pred             EEEEEECCCCEEEEEEEECCEEEEEEECCCCCCCEEEEEEEEECCCCCEEEEEEEEE
T ss_conf             799998999809998873306899876687666126999999878873799999987


No 56 
>>2boy_A 3-chlorocatechol 1,2-dioxygenase; beta barrel, oxidoreductase; HET: BHO LPP; 1.9A {Rhodococcus opacus} (A:74-254)
Probab=71.90  E-value=5.1  Score=17.69  Aligned_cols=59  Identities=8%  Similarity=0.068  Sum_probs=44.9

Q ss_pred             CCEEEEEEEECCCCCCCCCCEEEEEEECCC------------CCCCEEEEEEECCCCEEEECCCCCEEEEE
Q ss_conf             232799999868877534675999995388------------87620588982468566302267218999
Q gi|254780160|r   36 AQRITCEARLTENSTSIDSGVSWHIFDSIS------------NKKNTLSTTKKIIGGKVSFDLFPGDYLIS   94 (298)
Q Consensus        36 ~~~i~l~a~~~~~~~~~~~G~~~~vy~~~~------------~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~   94 (298)
                      +.-+.|+.++.+....++.|+...|+..+.            ...++-.+.|+++|.+.+.-+.||.|...
T Consensus        27 G~~l~i~g~V~D~~g~Pv~~a~VeiWqad~~G~Y~~~~~~~~~~~~rG~~~Td~~G~~~f~Ti~Pg~Y~~~   97 (181)
T 2boy_A           27 GDTLIFRGEVVDQEGAPLADVLLDMWQADAAGEYSFINPTLPDYLFRGKIRTDENGRFTLRTIVPAPYEIP   97 (181)
T ss_dssp             SCEEEEEEEEECTTSCBCCSCEEEEECCCTTSCCBTTBTTSCTTTTEEEEECCTTSEEEEEEECCCCEECC
T ss_pred             CCEEEEEEEEECCCCCCCCCCEEEEEECCCCCEECCCCCCCCCCCCEEEEEECCCCEEEEEEEECCCCCCC
T ss_conf             97899999999899989688257887169862323336788887888789508998499999841774447


No 57 
>>2hr0_A Complement C3 beta chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2i07_A* 2wii_A* 2win_A* 2a74_A* 2a73_A* 2qki_A* 3g6j_A 2ice_A* 2icf_A* (A:105-206)
Probab=71.45  E-value=5.3  Score=17.63  Aligned_cols=13  Identities=15%  Similarity=0.363  Sum_probs=5.6

Q ss_pred             CCCCEEEEEEEEC
Q ss_conf             4487028999953
Q gi|254780160|r  250 VLSEGDYTVIARN  262 (298)
Q Consensus       250 ~L~~G~Y~v~a~~  262 (298)
                      .++.|.|++.+..
T Consensus        72 ~~~~G~y~i~~~~   84 (102)
T 2hr0_A           72 LVNMGQWKIRAYY   84 (102)
T ss_dssp             SCCCSEEEEEEEE
T ss_pred             CCCCCEEEEEEEE
T ss_conf             5675409999997


No 58 
>>2c9r_A COPC, copper resistance protein C; copper transport, copper proteins, copper dissociation constants, metal-binding, electron transport; 2.0A {Pseudomonas syringae PV} PDB: 1m42_A 1nm4_A 1ot4_A 2c9p_A 2c9q_A (A:)
Probab=70.09  E-value=5.6  Score=17.44  Aligned_cols=24  Identities=25%  Similarity=0.354  Sum_probs=14.6

Q ss_pred             CCCCEEEEEE---EECCCCEEEEE--EEE
Q ss_conf             4487028999---95388246777--999
Q gi|254780160|r  250 VLSEGDYTVI---ARNKERNYSRE--FSV  273 (298)
Q Consensus       250 ~L~~G~Y~v~---a~~~~~~y~~~--ftV  273 (298)
                      .|++|.|+|.   ...|++..+-.  |+|
T Consensus        73 ~L~~G~YtV~wrv~s~DGH~~~G~~~FtV  101 (102)
T 2c9r_A           73 PLTAGTYKVDWRAVSSDTFPITGSVTFKV  101 (102)
T ss_dssp             CCCSEEEEEEEEECCTTCCCEEEEEEEEE
T ss_pred             CCCCCEEEEEEEEEECCCCEECCEEEEEE
T ss_conf             67873399999999668986537799898


No 59 
>>3eja_A Protein GH61E; beta sandwich, fibronectin type III fold, metal site, magnesium, unknown function; HET: NAG; 1.90A {Thielavia terrestris} PDB: 3eii_A* (A:)
Probab=68.41  E-value=4  Score=18.41  Aligned_cols=10  Identities=10%  Similarity=0.295  Sum_probs=6.0

Q ss_pred             EECCCCEEEE
Q ss_conf             1067617999
Q gi|254780160|r  169 RLGTNNYQIT  178 (298)
Q Consensus       169 ~L~~G~Y~v~  178 (298)
                      +|++|.|-|+
T Consensus       126 ~lp~G~YLiR  135 (208)
T 3eja_A          126 CIKSGYYLLR  135 (208)
T ss_dssp             SBCSEEEEEE
T ss_pred             CCCCCCCEEE
T ss_conf             8899351888


No 60 
>>1lyq_A PCOC copper resistance protein; beta barrel, IG domain, metal binding protein; 1.50A {Escherichia coli} (A:)
Probab=65.24  E-value=7  Score=16.82  Aligned_cols=27  Identities=26%  Similarity=0.437  Sum_probs=16.2

Q ss_pred             EECCCCCEEEEEE---EECCCCEEEEE--EEE
Q ss_conf             2124487028999---95388246777--999
Q gi|254780160|r  247 PSMVLSEGDYTVI---ARNKERNYSRE--FSV  273 (298)
Q Consensus       247 ~~~~L~~G~Y~v~---a~~~~~~y~~~--ftV  273 (298)
                      ....|++|.|+|.   ...|++..+-.  |+|
T Consensus        72 ~~~~L~~G~YtV~wrvvs~DGH~~~G~~~FtV  103 (104)
T 1lyq_A           72 PREPLPAGTYRVDWRAVSSDTHPITGNYTFTV  103 (104)
T ss_dssp             ESSCCCSEEEEEEEEECCTTSCCEEEEEEEEE
T ss_pred             CCCCCCCEEEEEEEEEEECCCCEECCEEEEEE
T ss_conf             58878982599999998158986514699998


No 61 
>>3hn5_A Putative exported protein BF0290; YP_210027.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Bacteroides fragilis nctc 9343} (A:1-100)
Probab=63.96  E-value=7.4  Score=16.66  Aligned_cols=78  Identities=19%  Similarity=0.271  Sum_probs=50.3

Q ss_pred             ECCEEEEEEEECCCCCCC----CCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEE--EECCCC----CEE
Q ss_conf             023279999986887753----4675999995388876205889824685663022672189999--615777----527
Q gi|254780160|r   35 DAQRITCEARLTENSTSI----DSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA--SFGHVG----VVK  104 (298)
Q Consensus        35 ~~~~i~l~a~~~~~~~~~----~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~--s~g~~~----~~~  104 (298)
                      +.+.-.|+.++.+.++++    .+|+.+++|...-+......+ .-...|.....|-.|+|.+..  ..+|.-    .+.
T Consensus         7 d~P~s~l~G~ivdtgE~i~~~~~~Gv~i~l~e~gy~~~~~~~~-~v~qDGtfn~~lF~G~Ykl~~~~~ngPf~~~~~dtI   85 (100)
T 3hn5_A            7 DAPESXLTGRVXYNGEALQLRGNEAVQLQLYQHGYAKHDPINV-YVNQDGXYSANLFDGEYQXITKSGNGPWTSEGRDTI   85 (100)
T ss_dssp             ---CEEEEEEEEETTEECCCCCTTSCEEEEESSCGGGCCCEEE-EBCTTSEEEEEECSEEEEEEECTTCSSBCSTTCCCE
T ss_pred             CCCCCEEEEEEEECCCEEEEECCCCEEEEEEECCCCCCCCEEE-EECCCCCEEEEEECCEEEEEECCCCCCCCCCCCCEE
T ss_conf             7887446799998996610105883599999745577897688-976898475327565168997478878635777379


Q ss_pred             EEEEECCCC
Q ss_conf             899806861
Q gi|254780160|r  105 KITVSSKEK  113 (298)
Q Consensus       105 ~vtV~~~~~  113 (298)
                      .+.|.....
T Consensus        86 ~v~v~G~t~   94 (100)
T 3hn5_A           86 NVTVAGNTV   94 (100)
T ss_dssp             EEEESSSEE
T ss_pred             EEEECCCEE
T ss_conf             998088478


No 62 
>>2zuy_A YESX protein; beta-propeller, lyase; 1.65A {Bacillus subtilis} (A:12-92)
Probab=63.23  E-value=6.6  Score=16.98  Aligned_cols=15  Identities=13%  Similarity=0.042  Sum_probs=5.7

Q ss_pred             CEEEEECCCC-EEEEE
Q ss_conf             1352106761-79999
Q gi|254780160|r  165 GTLVRLGTNN-YQITS  179 (298)
Q Consensus       165 ~~~~~L~~G~-Y~v~e  179 (298)
                      +.+.+|.||. |+|..
T Consensus        49 ~t~~~L~p~t~Y~V~A   64 (81)
T 2zuy_A           49 FLDQNGTADSVYQVAA   64 (81)
T ss_dssp             EEETTCCTTCEEEEEE
T ss_pred             EECCCCCCCCCEEEEE
T ss_conf             3727987786589998


No 63 
>>2v5m_A Dscam; neurobiology SPL, immunoglobulin domain, cell adhesion, membrane, developmental protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* (A:214-388)
Probab=62.75  E-value=7.8  Score=16.52  Aligned_cols=100  Identities=16%  Similarity=0.242  Sum_probs=56.1

Q ss_pred             CCCEEEEEEECCCCCEEEEEEEECCCCEE----EEEEEECCCEEEEEEEECCCCCCCCCEEEEEECCCCCEEEECCCCEE
Q ss_conf             76179999615778544544884288637----89999345238999983478863276089998389979742125212
Q gi|254780160|r  172 TNNYQITSHYGKYNAIVSTVVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASP  247 (298)
Q Consensus       172 ~G~Y~v~et~a~~~~~~~~~i~V~~g~~~----~~tv~~~~~~~~~~~v~~~~G~~l~ga~~~i~~~~g~~vt~~~G~~~  247 (298)
                      .|.|+....-..........+.+..-...    ............+..  ...+.+.+...|..   .+..+....+.+.
T Consensus        69 ~G~Y~C~a~n~~g~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~p~~~~~w~~---~~~~i~~~~~~~~  143 (175)
T 2v5m_A           69 SGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTC--QYTGNPIKTVSWMK---DGKAIGHSESVLR  143 (175)
T ss_dssp             CEEEEEEEECSSCEEEEEEEEEEEEEEEEEEESSEEEECTTSCEEEEE--EEEEECCCEEEEEE---TTEECSCCSSEEE
T ss_pred             CCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCEEEEEE--EEEEECCCEEEEEE---CCEECCCCCCEEE
T ss_conf             110420113553210000011245653222489857994698099999--99685699899998---9999569999899


Q ss_pred             ECCCC---CEEEEEEEECCCCEEEEEEEEEEC
Q ss_conf             12448---702899995388246777999728
Q gi|254780160|r  248 SMVLS---EGDYTVIARNKERNYSREFSVLTG  276 (298)
Q Consensus       248 ~~~L~---~G~Y~v~a~~~~~~y~~~ftV~~g  276 (298)
                      +..+.   .|.|+..|+|..-.-+..+.|..+
T Consensus       144 i~~v~~~d~G~Y~C~a~N~~g~~~~~~~l~V~  175 (175)
T 2v5m_A          144 IESVKKEDKGMYQCFVRNDRESAEASAELKLG  175 (175)
T ss_dssp             ESSCCGGGCEEEEEEEECSSCEEEEEEEEEEC
T ss_pred             ECCCCHHHCEEEEEEEEECCCEEEEEEEEEEC
T ss_conf             99898684999999999589669999999989


No 64 
>>2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} (A:126-227)
Probab=61.53  E-value=8.2  Score=16.38  Aligned_cols=26  Identities=23%  Similarity=0.388  Sum_probs=13.8

Q ss_pred             CCCCCEEEEEEEECCCCE---EEEEEEEE
Q ss_conf             244870289999538824---67779997
Q gi|254780160|r  249 MVLSEGDYTVIARNKERN---YSREFSVL  274 (298)
Q Consensus       249 ~~L~~G~Y~v~a~~~~~~---y~~~ftV~  274 (298)
                      ..++.|.|++.+..++..   .+..|.|+
T Consensus        71 ~~~~~G~y~i~~~~~~~~~~~~~~~F~V~   99 (102)
T 2b39_A           71 ELVNMGVWKIKAYYEDSPQQVFSAEFEVK   99 (102)
T ss_dssp             SSCCCEEEEEEEEETTEEEEEEEEEEEEC
T ss_pred             CCCCCEEEEEEEEECCCCCEEEEEEEEEE
T ss_conf             99887318999998998733899999999


No 65 
>>3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage on PAIR of basic residues, complement alternate pathway, complement pathway; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 1xwe_A (A:123-225,A:675-770)
Probab=60.50  E-value=8.5  Score=16.27  Aligned_cols=25  Identities=28%  Similarity=0.231  Sum_probs=11.5

Q ss_pred             CCCCEEEEEEEECCCC---EEEEEEEEE
Q ss_conf             4487028999953882---467779997
Q gi|254780160|r  250 VLSEGDYTVIARNKER---NYSREFSVL  274 (298)
Q Consensus       250 ~L~~G~Y~v~a~~~~~---~y~~~ftV~  274 (298)
                      .++.|.|.+.|..++.   .+...|.|+
T Consensus        71 ~~~~G~w~I~a~~~~~~~~~~~~~F~Vk   98 (199)
T 3cu7_A           71 NPRYGMWTIKAKYKEDFSTTGTAYFEVK   98 (199)
T ss_dssp             SCCCEEEEEEEEBSSSCCCEEEEEEEEC
T ss_pred             CCCCEEEEEEEEECCCCCEEEEEEEEEE
T ss_conf             9897759999997997660899999998


No 66 
>>1d2o_A Collagen adhesin, CNA; beta sandwich, IGG, IGSF, structural protein; 2.00A {Staphylococcus aureus} (A:1-90)
Probab=59.19  E-value=9  Score=16.12  Aligned_cols=68  Identities=9%  Similarity=0.061  Sum_probs=40.9

Q ss_pred             EEEEEEECCCC---CCCCCEEEEEEECCCCCEEEEE--EECCCCCEEEEECCC------CEEEEEEECCCCCEEE-EEEE
Q ss_conf             79998615788---7775518999983897435667--505675135210676------1799996157785445-4488
Q gi|254780160|r  126 IRLYSIYKPGS---PIVDDELTFSIYSNPNHKALLI--TDKVRSGTLVRLGTN------NYQITSHYGKYNAIVS-TVVK  193 (298)
Q Consensus       126 ~~~~~~~~~~~---~~~~~~~~f~i~~~~~~~~~~~--t~~~~~~~~~~L~~G------~Y~v~et~a~~~~~~~-~~i~  193 (298)
                      +.+.++-.++.   ...+..+.|.|+.++.......  .++.-...+.+||..      .|+|.|..-+ ||... ..++
T Consensus         5 i~V~K~W~d~~~~~~~rP~sI~v~L~~~g~~~~~~~l~~~~~W~~~f~~Lp~~~~G~~~~Y~V~E~~v~-gY~~~~~~~t   83 (90)
T 1d2o_A            5 SIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVK-DYTTDINGTT   83 (90)
T ss_dssp             EEEEEEEESTTTTTSCCCSEEEEEEEETTEEEEEEEEEGGGTTEEEEEEEESEETTEECCEEEEECCCT-TEEEEEETTE
T ss_pred             EEEEEEECCCCCCCCCCCCEEEEEEEECCEECCCEEECCCCCCEEEECCCCCCCCCCEEEEEEEECCCC-CCEEEECCCE
T ss_conf             999999749997677789659999977994823389615898379967777667997589999500368-8277723620


Q ss_pred             E
Q ss_conf             4
Q gi|254780160|r  194 V  194 (298)
Q Consensus       194 V  194 (298)
                      |
T Consensus        84 I   84 (90)
T 1d2o_A           84 I   84 (90)
T ss_dssp             E
T ss_pred             E
T ss_conf             3


No 67 
>>1d2p_A Collagen adhesin, CNA; IGG, IGSF, mscramm, structural protein; 2.50A {Staphylococcus aureus} (A:1-90)
Probab=59.19  E-value=9  Score=16.12  Aligned_cols=68  Identities=9%  Similarity=0.061  Sum_probs=40.9

Q ss_pred             EEEEEEECCCC---CCCCCEEEEEEECCCCCEEEEE--EECCCCCEEEEECCC------CEEEEEEECCCCCEEE-EEEE
Q ss_conf             79998615788---7775518999983897435667--505675135210676------1799996157785445-4488
Q gi|254780160|r  126 IRLYSIYKPGS---PIVDDELTFSIYSNPNHKALLI--TDKVRSGTLVRLGTN------NYQITSHYGKYNAIVS-TVVK  193 (298)
Q Consensus       126 ~~~~~~~~~~~---~~~~~~~~f~i~~~~~~~~~~~--t~~~~~~~~~~L~~G------~Y~v~et~a~~~~~~~-~~i~  193 (298)
                      +.+.++-.++.   ...+..+.|.|+.++.......  .++.-...+.+||..      .|+|.|..-+ ||... ..++
T Consensus         5 i~V~K~W~d~~~~~~~rP~sI~v~L~~~g~~~~~~~l~~~~~W~~~f~~Lp~~~~G~~~~Y~V~E~~v~-gY~~~~~~~t   83 (90)
T 1d2p_A            5 SIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVK-DYTTDINGTT   83 (90)
T ss_dssp             EEEEEEEESTTTTTCCCCSEEEEEEEETTEEEEEEEEEGGGTTEEEEEEEESEETTEECCEEEEECCCT-TEEEEEETTE
T ss_pred             EEEEEEECCCCCCCCCCCCCEEEEEEECCEEEEEEEECCCCCEEEEECCCCCCCCCCEEEEEEEEECCC-CCEEECCCEE
T ss_conf             778989799986577678846999998999987999789997599967788666894689999876479-8403102303


Q ss_pred             E
Q ss_conf             4
Q gi|254780160|r  194 V  194 (298)
Q Consensus       194 V  194 (298)
                      |
T Consensus        84 I   84 (90)
T 1d2p_A           84 I   84 (90)
T ss_dssp             E
T ss_pred             E
T ss_conf             5


No 68 
>>1d2p_A Collagen adhesin, CNA; IGG, IGSF, mscramm, structural protein; 2.50A {Staphylococcus aureus} (A:187-277)
Probab=57.67  E-value=9.5  Score=15.96  Aligned_cols=68  Identities=9%  Similarity=0.057  Sum_probs=40.3

Q ss_pred             EEEEEEECCCC---CCCCCEEEEEEECCCCCEEEEEEECCC--CCEEEEECC---C---CEEEEEEECCCCCEEE-EEEE
Q ss_conf             79998615788---777551899998389743566750567--513521067---6---1799996157785445-4488
Q gi|254780160|r  126 IRLYSIYKPGS---PIVDDELTFSIYSNPNHKALLITDKVR--SGTLVRLGT---N---NYQITSHYGKYNAIVS-TVVK  193 (298)
Q Consensus       126 ~~~~~~~~~~~---~~~~~~~~f~i~~~~~~~~~~~t~~~~--~~~~~~L~~---G---~Y~v~et~a~~~~~~~-~~i~  193 (298)
                      +.+.++-.++.   ...+..+.|.|+.++...........+  ...+.+||.   |   .|.|.|..-+ ||... ..++
T Consensus         6 i~V~K~W~d~~~~~~~RP~sI~v~L~~~g~~~~~~~l~~~n~W~~tf~~Lp~~~~G~~~~Y~V~E~~v~-gY~~~v~~~t   84 (91)
T 1d2p_A            6 SIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVK-DYTTDINGTT   84 (91)
T ss_dssp             EEEEEEEESTTTTTSCCCSCEEEEEEETTEEEEEEEECGGGTSEEEEEEEESEETTEECCEEEEECCCT-TEEEEEETTE
T ss_pred             CCCEEEECCCCCCCCCCCCCEEEEEEECCEEEEEEEEECCCCEEEEECCCCCCCCCCEEEEEEEECCCC-CCEEEECCCE
T ss_conf             344168768876577558857999998995877899752897189956777667884799999510477-7177602410


Q ss_pred             E
Q ss_conf             4
Q gi|254780160|r  194 V  194 (298)
Q Consensus       194 V  194 (298)
                      |
T Consensus        85 I   85 (91)
T 1d2p_A           85 I   85 (91)
T ss_dssp             E
T ss_pred             E
T ss_conf             0


No 69 
>>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} (A:350-514)
Probab=55.75  E-value=10  Score=15.76  Aligned_cols=27  Identities=26%  Similarity=0.412  Sum_probs=12.2

Q ss_pred             CCCCCEEEEEEEECCCCEEEEEEEEEE
Q ss_conf             244870289999538824677799972
Q gi|254780160|r  249 MVLSEGDYTVIARNKERNYSREFSVLT  275 (298)
Q Consensus       249 ~~L~~G~Y~v~a~~~~~~y~~~ftV~~  275 (298)
                      ..|+||+|.|+..--...-+..|.+..
T Consensus       127 ~~l~pG~Y~iVPsT~~~~~~g~F~LrV  153 (165)
T 1qxp_A          127 IRLPPGEYIVVPSTFEPNKEGDFLLRF  153 (165)
T ss_dssp             EECCSEEEEEEEEESSSSCCEEEEEEE
T ss_pred             EEECCCCEEEEEEECCCCCCCCEEEEE
T ss_conf             997899889998767899845779997


No 70 
>>1d2p_A Collagen adhesin, CNA; IGG, IGSF, mscramm, structural protein; 2.50A {Staphylococcus aureus} (A:278-373)
Probab=55.15  E-value=10  Score=15.69  Aligned_cols=64  Identities=8%  Similarity=0.063  Sum_probs=39.7

Q ss_pred             EEEEEEECCCC---CCCCCEEEEEEECCCCCEEEEE-E--ECCCCCEEEEECC---C---CEEEEEEECCCCCEEE
Q ss_conf             79998615788---7775518999983897435667-5--0567513521067---6---1799996157785445
Q gi|254780160|r  126 IRLYSIYKPGS---PIVDDELTFSIYSNPNHKALLI-T--DKVRSGTLVRLGT---N---NYQITSHYGKYNAIVS  189 (298)
Q Consensus       126 ~~~~~~~~~~~---~~~~~~~~f~i~~~~~~~~~~~-t--~~~~~~~~~~L~~---G---~Y~v~et~a~~~~~~~  189 (298)
                      +.+.++-.++.   ...+..++|.|+.++......+ .  ++.=...+.+||.   |   .|.|.|...|.+|..+
T Consensus         5 i~V~K~W~d~~~~~~~rP~~I~v~L~~~g~~~~~~v~L~~~n~W~~~f~~Lp~~~~G~~~~YsV~E~~v~~gY~~~   80 (96)
T 1d2p_A            5 ATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTH   80 (96)
T ss_dssp             EEEEEEEESGGGTTSCCCSEEEEEEEETTEEEEEEEEEETTTTTEEEEEEEESEETTEECCEEEEECSCCTTEEEE
T ss_pred             CCCEEEECCCCCCCCCCCCCEEEEEEECCEEEEEEEEECCCCCEEEEECCCCCCCCCCEEEEEEEECCCCCCCEEE
T ss_conf             3203464268877664786289999989948556999838998899978876457997799999981678984889


No 71 
>>1d2p_A Collagen adhesin, CNA; IGG, IGSF, mscramm, structural protein; 2.50A {Staphylococcus aureus} (A:91-186)
Probab=55.15  E-value=10  Score=15.69  Aligned_cols=64  Identities=8%  Similarity=0.059  Sum_probs=40.1

Q ss_pred             EEEEEEECCCC---CCCCCEEEEEEECCCCCEEEE---EEECCCCCEEEEECC---C---CEEEEEEECCCCCEEE
Q ss_conf             79998615788---777551899998389743566---750567513521067---6---1799996157785445
Q gi|254780160|r  126 IRLYSIYKPGS---PIVDDELTFSIYSNPNHKALL---ITDKVRSGTLVRLGT---N---NYQITSHYGKYNAIVS  189 (298)
Q Consensus       126 ~~~~~~~~~~~---~~~~~~~~f~i~~~~~~~~~~---~t~~~~~~~~~~L~~---G---~Y~v~et~a~~~~~~~  189 (298)
                      +.+.++-.++.   ...+..++|.|+.++......   ..++.=...+.+||.   |   .|.|.|...|.+|..+
T Consensus         5 i~V~K~W~d~~~~~~~rP~~I~v~L~~~g~~~~~~v~L~~~n~W~~~f~~Lp~~~~G~~~~YsV~E~~v~~gY~~~   80 (96)
T 1d2p_A            5 ATVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTH   80 (96)
T ss_dssp             EEEEEEEESTTTTTSCCCSEEEEEEEETTEEEEEEEEEEGGGTTEEEEEEEESBSSSSBCCEEEEECSCCTTCEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEEEEEECCEEEEEEEEECCCCCEEEEECCCCCCCCCCEEEEEEEECCCCCCCEEE
T ss_conf             2221231268876675774389999979977667899837884799867765556785489999613666661468


No 72 
>>3bow_A Calpain-2 catalytic subunit; cysteine protease, calcium, inhibitor, cell membrane, cytoplasm, hydrolase, membrane, protease, thiol protease; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L (A:350-510)
Probab=45.56  E-value=15  Score=14.73  Aligned_cols=12  Identities=17%  Similarity=0.440  Sum_probs=6.9

Q ss_pred             EECCCCEEEEEE
Q ss_conf             106761799996
Q gi|254780160|r  169 RLGTNNYQITSH  180 (298)
Q Consensus       169 ~L~~G~Y~v~et  180 (298)
                      .|+||.|.|+-.
T Consensus       127 ~L~pG~Y~IVPs  138 (161)
T 3bow_A          127 KLPPGEYVLVPS  138 (161)
T ss_dssp             EECSEEEEEEEE
T ss_pred             EECCCCEEEEEE
T ss_conf             978988899998


No 73 
>>2hsi_A Putative peptidase M23; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.90A {Pseudomonas aeruginosa PAO1} (A:1-115,A:268-282)
Probab=43.43  E-value=16  Score=14.52  Aligned_cols=24  Identities=25%  Similarity=0.239  Sum_probs=7.9

Q ss_pred             CEEEEEEEECCCCEEEEEEEEEEC
Q ss_conf             702899995388246777999728
Q gi|254780160|r  253 EGDYTVIARNKERNYSREFSVLTG  276 (298)
Q Consensus       253 ~G~Y~v~a~~~~~~y~~~ftV~~g  276 (298)
                      ||+|.+..+.+...-...|+|...
T Consensus        82 PG~~~l~V~~~~~~r~~~v~V~~k  105 (130)
T 2hsi_A           82 PGPQKLEVRAATGNHEERFSVGSK  105 (130)
T ss_dssp             SEEEEEEEECTTCCEEEEEEECCC
T ss_pred             CCCEEEEEECCCCEEEEEEEECCC
T ss_conf             864589998489728888987336


No 74 
>>1nqj_A Class 1 collagenase; beta sandwich, metalloprotease, collagen-binding domain, lithium, chlorine, hydrolase; 1.00A {Clostridium histolyticum} (A:)
Probab=41.54  E-value=17  Score=14.34  Aligned_cols=15  Identities=20%  Similarity=0.237  Sum_probs=8.0

Q ss_pred             EEEECCCCEEEEEEE
Q ss_conf             521067617999961
Q gi|254780160|r  167 LVRLGTNNYQITSHY  181 (298)
Q Consensus       167 ~~~L~~G~Y~v~et~  181 (298)
                      ...|++|+|+|++..
T Consensus        92 ~~~~~~GtYyi~V~~  106 (119)
T 1nqj_A           92 KVKLRPGKYYLLVYK  106 (119)
T ss_dssp             EEEECSEEEEEEEEE
T ss_pred             EEECCCCEEEEEEEE
T ss_conf             886699589999999


No 75 
>>2h6u_A 5-hydroxyisourate hydrolase (formerly known AS Trp, transthyretin related protein)...; URIC acid degradation, allantoin; 1.70A {Danio rerio} PDB: 2h1x_A (A:24-98)
Probab=41.27  E-value=17  Score=14.31  Aligned_cols=23  Identities=13%  Similarity=0.146  Sum_probs=11.9

Q ss_pred             EEEECCCCEEEE----CCCCCEEEEEE
Q ss_conf             898246856630----22672189999
Q gi|254780160|r   73 TTKKIIGGKVSF----DLFPGDYLISA   95 (298)
Q Consensus        73 ~tt~~~G~~~~~----~L~pG~Y~v~~   95 (298)
                      .+|+++|....+    +|++|.|.|.-
T Consensus        22 ~~Td~DGR~~~l~~~~~~~~G~Y~l~F   48 (75)
T 2h6u_A           22 GITNDDGRCPGLITKENFIAGVYKMRF   48 (75)
T ss_dssp             EECCTTSBCCCSCCTTTCCSEEEEEEE
T ss_pred             EEECCCCCCCCCCCCCCCCCEEEEEEE
T ss_conf             886899952766775556761499999


No 76 
>>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* (A:415-450)
Probab=40.15  E-value=11  Score=15.53  Aligned_cols=14  Identities=21%  Similarity=0.278  Sum_probs=6.7

Q ss_pred             EEEECCCCEEEEEE
Q ss_conf             52106761799996
Q gi|254780160|r  167 LVRLGTNNYQITSH  180 (298)
Q Consensus       167 ~~~L~~G~Y~v~et  180 (298)
                      +..|.||+|++..-
T Consensus        12 ~~~L~PGTyYL~~V   25 (36)
T 2f82_A           12 LDLLAPGTYYLKEV   25 (36)
T ss_dssp             GGGSCTTCEEEEEE
T ss_pred             CCCCCCCCEEEEEE
T ss_conf             13356654785033


No 77 
>>3gld_A Pilin; all-beta, cell adhesion, structural protein, isopeptide, cell WALL, fimbrium, isopeptide bond, membrane; 2.03A {Streptococcus pyogenes serotype M1} PDB: 3b2m_A 3gle_A (A:160-295)
Probab=38.88  E-value=19  Score=14.08  Aligned_cols=25  Identities=12%  Similarity=0.065  Sum_probs=11.3

Q ss_pred             CEEEEECCC-CEEEEEEEC-CCCCEEE
Q ss_conf             135210676-179999615-7785445
Q gi|254780160|r  165 GTLVRLGTN-NYQITSHYG-KYNAIVS  189 (298)
Q Consensus       165 ~~~~~L~~G-~Y~v~et~a-~~~~~~~  189 (298)
                      ..+.+||.| .|.|.|..+ +.+|...
T Consensus        71 i~i~~LP~g~~Y~VtE~~~~~~gY~t~   97 (136)
T 3gld_A           71 IKVTNLPVGVDYVVTEDDYKSEKYTTN   97 (136)
T ss_dssp             EEEEEEETTCEEEEEECCCGGGTCEEE
T ss_pred             EEEECCCCEEEEEEEEECCCCCCEEEE
T ss_conf             999368860799999923788876998


No 78 
>>1ut9_A Cellulose 1,4-beta-cellobiosidase; hydrolase, glycoside hydrolase, family 9, cellobiohydrolase; 2.1A {Clostridium thermocellum} (A:1-100)
Probab=38.74  E-value=19  Score=14.06  Aligned_cols=23  Identities=26%  Similarity=0.299  Sum_probs=10.2

Q ss_pred             CCEEEEEEEEC---CCCEEEEEEEEE
Q ss_conf             87028999953---882467779997
Q gi|254780160|r  252 SEGDYTVIARN---KERNYSREFSVL  274 (298)
Q Consensus       252 ~~G~Y~v~a~~---~~~~y~~~ftV~  274 (298)
                      .||+|.+....   .+...+.+|+|.
T Consensus        72 ~pG~Y~i~~~~~l~~g~~~S~~F~I~   97 (100)
T 1ut9_A           72 TEGIGYYFELPTVNSPTNYSHPFDIR   97 (100)
T ss_dssp             CCEEEEEEECTTCCSTTCBBCCEEEC
T ss_pred             CCCCEEEEEECCCCCCCCCCCCEEEC
T ss_conf             88641798633435687501357976


No 79 
>>1ej6_A Lambda2; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} (A:1220-1289)
Probab=35.10  E-value=21  Score=13.69  Aligned_cols=15  Identities=33%  Similarity=0.795  Sum_probs=7.7

Q ss_pred             CEEECCCCCEEEEEE
Q ss_conf             212124487028999
Q gi|254780160|r  245 ASPSMVLSEGDYTVI  259 (298)
Q Consensus       245 ~~~~~~L~~G~Y~v~  259 (298)
                      ..+..-.|||+|++.
T Consensus        54 siptyivppgdytlt   68 (70)
T 1ej6_A           54 SIPTYIVPPGDYTLT   68 (70)
T ss_dssp             TSCCEEECSSCEEEE
T ss_pred             CCCCEEECCCCCCCC
T ss_conf             874157288753357


No 80 
>>1w8o_A Bacterial sialidase; 3D-structure, glycosidase, hydrolase, beta- propeller; HET: LBT CIT; 1.70A {Micromonospora viridifaciens} (A:356-459)
Probab=33.58  E-value=23  Score=13.54  Aligned_cols=74  Identities=26%  Similarity=0.309  Sum_probs=34.5

Q ss_pred             EEEECCCCEEEEEEEECCCEEEEEEEECCCCCCCCCEEEEEECCCCCEEEECCCCE----------E---ECCCCCEEEE
Q ss_conf             48842886378999934523899998347886327608999838997974212521----------2---1244870289
Q gi|254780160|r  191 VVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANAS----------P---SMVLSEGDYT  257 (298)
Q Consensus       191 ~i~V~~g~~~~~tv~~~~~~~~~~~v~~~~G~~l~ga~~~i~~~~g~~vt~~~G~~----------~---~~~L~~G~Y~  257 (298)
                      +..+.+|+...+++..          ...+..++.+..+.+.-+.|-.+....|..          .   ..+.++|+|.
T Consensus        11 ~~~v~~G~~~~i~v~v----------~N~g~~~~~~v~v~~~~p~g~~~~~~~~~l~~Ges~~~~~~v~~~~~a~~g~y~   80 (104)
T 1w8o_A           11 DVALEPGQQVTVPVAV----------TNQSGIAVPKPSLQLDASPDWQVQGSVEPLMPGRQAKGQVTITVPAGTTPGRYR   80 (104)
T ss_dssp             CEEECTTCEEEEEEEE----------ECCSSSCBSSCEEEEECCTTSEEEEEECCBCTTCEEEEEEEEECCTTCCCEEEE
T ss_pred             CEEECCCCCCCCCEEE----------ECCCCCCCCCCEEEECCCCCEEECCCCCCCCCCCCCCCEEEEECCCCCCCCCEE
T ss_conf             2032488753440587----------457762134522667178740561455434443200203578556777553101


Q ss_pred             EEE--ECCCCEEEEEEEEE
Q ss_conf             999--53882467779997
Q gi|254780160|r  258 VIA--RNKERNYSREFSVL  274 (298)
Q Consensus       258 v~a--~~~~~~y~~~ftV~  274 (298)
                      +.+  +.+.......+++.
T Consensus        81 i~v~~~~~~~~~~~~~~v~   99 (104)
T 1w8o_A           81 VGATLRTSAGNASTTFTVT   99 (104)
T ss_dssp             EEEEEEETTEEEEEEEEEE
T ss_pred             EEEEEECCCEECCCCCCCC
T ss_conf             1024402320001111121


No 81 
>>2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} (A:775-819,A:1108-1168)
Probab=33.53  E-value=23  Score=13.53  Aligned_cols=35  Identities=26%  Similarity=0.293  Sum_probs=19.0

Q ss_pred             CCCCCCCEEEECCCCCCCCCHHEEECCEEEEEEEECCCCC
Q ss_conf             6665320465303314677000230232799999868877
Q gi|254780160|r   11 AENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENST   50 (298)
Q Consensus        11 ~~~~~~~~~~~~~~~~~g~~~~~v~~~~i~l~a~~~~~~~   50 (298)
                      -+++|+++-.++.+|-|.-     +.+++.++-++.+++.
T Consensus        13 ~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~S~   47 (106)
T 2pn5_A           13 FDDHKNQTFPINLDINKKA-----DSGSTKIEFRLNPNSR   47 (106)
T ss_dssp             EEEEEEEEEEEECCCCCSS-----CCSCCEEEEEEESSSC
T ss_pred             CCCCCCEEEEECCCCCCCC-----CCCEEEEEEEECCCCC
T ss_conf             2776430243403577676-----6530589999946188


No 82 
>>3e7j_A Heparinase II protein; alpha and beta lyase, alpha6/alpha6 incomplete toroid, sugar binding protein, lyase; HET: NAG GCU GCD; 2.10A {Pedobacter heparinum} PDB: 3e80_A* 2fut_A* 2fuq_A* (A:657-749)
Probab=33.25  E-value=23  Score=13.50  Aligned_cols=22  Identities=14%  Similarity=0.107  Sum_probs=10.2

Q ss_pred             CEEECCCCCEEEEEEEECCCCEEE
Q ss_conf             212124487028999953882467
Q gi|254780160|r  245 ASPSMVLSEGDYTVIARNKERNYS  268 (298)
Q Consensus       245 ~~~~~~L~~G~Y~v~a~~~~~~y~  268 (298)
                      +|.+.+|.||+|++.  ++++.|-
T Consensus        47 kfviTDL~pG~wqVk--kDGkv~i   68 (93)
T 3e7j_A           47 KFVMTDLLPGTWQVL--KDGKILY   68 (93)
T ss_dssp             EEEECSBCSEEEEEE--ETTEEEE
T ss_pred             EEEEECCCCCCEEEE--ECCCCCC
T ss_conf             489940357846885--2687654


No 83 
>>2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural genomics, structural genomics consortium; HET: COA; 2.00A {Homo sapiens} (A:444-478)
Probab=32.22  E-value=18  Score=14.17  Aligned_cols=14  Identities=7%  Similarity=0.057  Sum_probs=6.5

Q ss_pred             EEEECCCCEEEEEE
Q ss_conf             52106761799996
Q gi|254780160|r  167 LVRLGTNNYQITSH  180 (298)
Q Consensus       167 ~~~L~~G~Y~v~et  180 (298)
                      +..|.||+|++..-
T Consensus        10 ~~~L~PGTyYL~~V   23 (35)
T 2p8u_A           10 IDSLFEGTWYLVRV   23 (35)
T ss_dssp             STTSCTTCEEEEEE
T ss_pred             CCCCCCCCEEEEEE
T ss_conf             13257776796576


No 84 
>>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* (A:616-828)
Probab=32.11  E-value=24  Score=13.38  Aligned_cols=10  Identities=30%  Similarity=0.577  Sum_probs=5.3

Q ss_pred             CCCEEEEEEE
Q ss_conf             4870289999
Q gi|254780160|r  251 LSEGDYTVIA  260 (298)
Q Consensus       251 L~~G~Y~v~a  260 (298)
                      ||+|.|++.+
T Consensus       178 ~pdG~Y~~~i  187 (213)
T 1xf1_A          178 VANGTYTYRV  187 (213)
T ss_dssp             CCSEEEEEEE
T ss_pred             CCCCCEEEEE
T ss_conf             8872069999


No 85 
>>1kmo_A FECA, iron(III) dicitrate transport protein FECA; membrane protein, iron transporter, TONB-dependent receptor, siderophore; HET: LDA HTO; 2.00A {Escherichia coli K12} (A:)
Probab=28.94  E-value=14  Score=14.96  Aligned_cols=22  Identities=9%  Similarity=-0.221  Sum_probs=12.9

Q ss_pred             EEEECCCCEEEECCCCCEEEEE
Q ss_conf             8982468566302267218999
Q gi|254780160|r   73 TTKKIIGGKVSFDLFPGDYLIS   94 (298)
Q Consensus        73 ~tt~~~G~~~~~~L~pG~Y~v~   94 (298)
                      .+|+.+|.+.....+++.+.+.
T Consensus        69 t~Td~~G~f~l~~~~~~~l~~s   90 (774)
T 1kmo_A           69 QSNGLHGDYDVESGLQQLLDGS   90 (774)
T ss_dssp             ----------------------
T ss_pred             CCCCCCCCCCHHHHHHHHHCCC
T ss_conf             3787667308999999997479


No 86 
>>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial precursor; middle-chain acyl-COA synthetase, xenobiotic/medium-chain fatty acid-COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* (A:58-75,A:230-382,A:438-455)
Probab=28.72  E-value=27  Score=13.02  Aligned_cols=25  Identities=16%  Similarity=-0.054  Sum_probs=20.1

Q ss_pred             CCCCCCCCEEEEEECCCCCEEEECC
Q ss_conf             7886327608999838997974212
Q gi|254780160|r  219 MGGEAVADTAWSILTASGDTVGESA  243 (298)
Q Consensus       219 ~~G~~l~ga~~~i~~~~g~~vt~~~  243 (298)
                      .-|.+++|.++.|+|++|+.+....
T Consensus       164 svG~p~~g~~~~I~d~dg~~~~~Ge  188 (189)
T 3c5e_A          164 YMGTAASCGDRGIKDEDGYFQFMGR  188 (189)
T ss_dssp             CCCEECTTEEEEEECTTSCEEEEEE
T ss_pred             CCCCCCCCCCEEEECCCCCEEECCC
T ss_conf             3336788833588858998675674


No 87 
>>2o14_A Hypothetical protein YXIM; NESG, X-RAY, SR595, structural genomics, PSI-2, protein structure initiative; 2.10A {Bacillus subtilis} (A:1-159)
Probab=28.54  E-value=27  Score=13.00  Aligned_cols=58  Identities=14%  Similarity=0.111  Sum_probs=29.1

Q ss_pred             CEEEEECCCCEEEEEEECCCCCEE-E-EEEEE-----CCCCEEEEEEEECCCEEEEEEEECCCCC
Q ss_conf             135210676179999615778544-5-44884-----2886378999934523899998347886
Q gi|254780160|r  165 GTLVRLGTNNYQITSHYGKYNAIV-S-TVVKV-----EPGKIIDVTIQNRAAKITFKLVSEMGGE  222 (298)
Q Consensus       165 ~~~~~L~~G~Y~v~et~a~~~~~~-~-~~i~V-----~~g~~~~~tv~~~~~~~~~~~v~~~~G~  222 (298)
                      ...+.||.|+|.|+...+...+.- . ....+     ......++.+...-+.+.+......+|.
T Consensus        79 ~y~~~vpnG~Y~V~l~f~e~~~~~V~~eG~~~l~~~~g~~~~~~f~V~V~Dg~L~i~f~~~~gg~  143 (159)
T 2o14_A           79 TFNVDLPNGLYEVKVTLGNTARASVAAEGVFQVINXTGDGAEDTFQIPVTDGQLNLLVTEGKAGT  143 (159)
T ss_dssp             CEEEECCSEEEEEEEEESSCSEEEEEETTEEEEEEEESTTCEEEEEEEECSSEEEEEEEESSTTS
T ss_pred             EEEEECCCCCEEEEEEECCCCCCCCCCCCCEECCCCCCCEEEEEEEEECCCCCCCCEECCCCCCC
T ss_conf             06896699856999995774012101355021124799646677898645785453001676665


No 88 
>>1w0n_A Endo-1,4-beta-xylanase D; hydrolase, carbohydrate-binding module, carbohydrate binding, CBM36; 0.8A {Paenibacillus polymyxa} (A:)
Probab=27.99  E-value=28  Score=12.94  Aligned_cols=26  Identities=15%  Similarity=-0.065  Sum_probs=12.8

Q ss_pred             EECCCCCEEEEEEEECC-CCCEEEEEE
Q ss_conf             30226721899996157-775278998
Q gi|254780160|r   83 SFDLFPGDYLISASFGH-VGVVKKITV  108 (298)
Q Consensus        83 ~~~L~pG~Y~v~~s~g~-~~~~~~vtV  108 (298)
                      .++.++|.|.|...|.. .+..+++.|
T Consensus        49 ~v~v~aG~Y~l~irya~~~~~~~~~~l   75 (131)
T 1w0n_A           49 SQYFANSTHNISVRGASSNAGTAKVDL   75 (131)
T ss_dssp             EEEESSSEEEEEEEEEESSSSEEEEEE
T ss_pred             EEEEECCCEEEEEECCCCCCCCEEEEE
T ss_conf             665403640499870458898068999


No 89 
>>3dmk_A DOWN syndrome cell adhesion molecule (dscam) isoform 1.30.30, N-terminal eight IG...; IG domains, immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} (A:244-426)
Probab=25.96  E-value=30  Score=12.70  Aligned_cols=106  Identities=14%  Similarity=0.173  Sum_probs=49.1

Q ss_pred             CEEEEEC---CCCEEEEEEECCCCCEEEEEEEECCCCEEE---EEEEECCCEEEEEEEECCCCCCCCCEEEEEECCCCCE
Q ss_conf             1352106---761799996157785445448842886378---9999345238999983478863276089998389979
Q gi|254780160|r  165 GTLVRLG---TNNYQITSHYGKYNAIVSTVVKVEPGKIID---VTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT  238 (298)
Q Consensus       165 ~~~~~L~---~G~Y~v~et~a~~~~~~~~~i~V~~g~~~~---~tv~~~~~~~~~~~v~~~~G~~l~ga~~~i~~~~g~~  238 (298)
                      ..+.++.   .|.|+....-.-........+.|.......   .......+... .+.-...+.+.+...|..   ++..
T Consensus        65 L~I~~~~~~D~G~Y~C~a~n~~g~~~~~~~l~v~~~p~~~~~~~~~~~~~~~~~-~l~~~~~~~p~~~~~w~~---~~~~  140 (183)
T 3dmk_A           65 LIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPA-VFTCQYTGNPIKTVSWMK---DGKA  140 (183)
T ss_dssp             EEECSCCGGGCEEEEEEEECSSCEEEEEEEEEECEEEEEEEESSEEECCTTSCE-EEEEEEEEECCCEEEEEE---TTEE
T ss_pred             EEEEEEEECCCCCCEEEEECCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCE-EEEEEECCCCCCCEEEEE---CCCC
T ss_conf             999646403334420454045430000232200001001112343121113430-222010012432102330---1000


Q ss_pred             EEECCCCEEECCC---CCEEEEEEEECCCCEEEEEEEEE
Q ss_conf             7421252121244---87028999953882467779997
Q gi|254780160|r  239 VGESANASPSMVL---SEGDYTVIARNKERNYSREFSVL  274 (298)
Q Consensus       239 vt~~~G~~~~~~L---~~G~Y~v~a~~~~~~y~~~ftV~  274 (298)
                      +......+....+   ..|.|+..|+|..-.-+..+.+.
T Consensus       141 ~~~~~~~l~~~~~~~~d~G~Y~c~a~N~~g~~~~~~~l~  179 (183)
T 3dmk_A          141 IGHSESVLRIESVKKEDKGMYQCFVRNDRESAEASAELK  179 (183)
T ss_dssp             CSCCSSEEEESSCCGGGCEEEEEEEECSSCEEEECCEEE
T ss_pred             CCCCCCCEEEEEEECCCCCCEEEEEECCCCCCEEEEEEE
T ss_conf             101022104533300336411468752688513576553


No 90 
>>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} (A:110-212)
Probab=25.34  E-value=31  Score=12.63  Aligned_cols=11  Identities=9%  Similarity=0.329  Sum_probs=4.8

Q ss_pred             CCEEEEEEEEC
Q ss_conf             72189999615
Q gi|254780160|r   88 PGDYLISASFG   98 (298)
Q Consensus        88 pG~Y~v~~s~g   98 (298)
                      +|.|.|.+.++
T Consensus        60 ~G~~~i~V~~~   70 (103)
T 1qfh_A           60 NGRFSTGVKLN   70 (103)
T ss_dssp             SEEEEEEEEET
T ss_pred             CEEEEEEEEEC
T ss_conf             88799999999


No 91 
>>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} (A:209-311)
Probab=25.34  E-value=31  Score=12.63  Aligned_cols=11  Identities=9%  Similarity=0.329  Sum_probs=5.4

Q ss_pred             CCEEEEEEEEC
Q ss_conf             72189999615
Q gi|254780160|r   88 PGDYLISASFG   98 (298)
Q Consensus        88 pG~Y~v~~s~g   98 (298)
                      +|.|.|.+.++
T Consensus        60 ~G~~~i~V~~~   70 (103)
T 1wlh_A           60 NGRFSTGVKLN   70 (103)
T ss_dssp             SEEEEEEEEET
T ss_pred             CEEEEEEEEEC
T ss_conf             88999999999


No 92 
>>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} (A:460-544)
Probab=24.89  E-value=32  Score=12.58  Aligned_cols=47  Identities=15%  Similarity=0.183  Sum_probs=25.8

Q ss_pred             ECCCCCEEEEEEEECCCCCEEEEEEECCCCEEEEEEECCCCEEEEEE
Q ss_conf             02267218999961577752789980686136787513664379998
Q gi|254780160|r   84 FDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYS  130 (298)
Q Consensus        84 ~~L~pG~Y~v~~s~g~~~~~~~vtV~~~~~~~~~~~~~~ag~~~~~~  130 (298)
                      ..|.+|+|.||..+|-.-+..-..+..++.......+.-+.+..+..
T Consensus        19 ~~l~~GD~VVh~~hGig~~~gi~~~~~~g~~~ey~~l~y~~~~~l~V   65 (85)
T 2eyq_A           19 AELHIGQPVVHLEHGVGRYAGMTTLEAGGITGEYLMLTYANDAKLYV   65 (85)
T ss_dssp             TTCCTTCEEEETTTEEEEEEEEEEEESSSCEEEEEEEECGGGCEEEE
T ss_pred             HHCCCCCEEEEECCCHHHHCCEEEEECCCCCCCCEEEEECCCCEEEE
T ss_conf             32467746866012301010305530267767630356427964983


No 93 
>>1xf1_A C5A peptidase, SCP; hydrolase; HET: CIT; 1.90A {Streptococcus pyogenes} PDB: 3eif_A* (A:479-615)
Probab=24.28  E-value=33  Score=12.50  Aligned_cols=19  Identities=11%  Similarity=0.078  Sum_probs=11.7

Q ss_pred             EEEEEECCCCEEEEEEEEC
Q ss_conf             5448842886378999934
Q gi|254780160|r  189 STVVKVEPGKIIDVTIQNR  207 (298)
Q Consensus       189 ~~~i~V~~g~~~~~tv~~~  207 (298)
                      ...|+|.+|+..++++...
T Consensus        67 ~~~vtV~ag~s~~v~vti~   85 (137)
T 1xf1_A           67 WQKITIPANSSKQVTVPID   85 (137)
T ss_dssp             CEEEEECTTEEEEEEEEEE
T ss_pred             CCEEEECCCCEEEEEEEEC
T ss_conf             8879989998079999962


No 94 
>>3bwu_D FIMD, outer membrane usher protein FIMD, N-terminal domain; usher, N-terminal domain, ternary complex with chaperone and pilus subunit, chaperone, structural protein, mebrane protein; 1.76A {Escherichia coli K12} (D:28-125)
Probab=24.01  E-value=33  Score=12.47  Aligned_cols=12  Identities=33%  Similarity=0.636  Sum_probs=5.5

Q ss_pred             CCCCEEEEEEEE
Q ss_conf             267218999961
Q gi|254780160|r   86 LFPGDYLISASF   97 (298)
Q Consensus        86 L~pG~Y~v~~s~   97 (298)
                      |+||.|.+...-
T Consensus         1 i~pG~Y~v~i~v   12 (98)
T 3bwu_D            1 LPPGTYRVDIYL   12 (98)
T ss_dssp             SCSEEEEEEEEE
T ss_pred             CCCEEEEEEEEE
T ss_conf             698388999999


No 95 
>>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} (A:1-104)
Probab=23.68  E-value=33  Score=12.43  Aligned_cols=10  Identities=40%  Similarity=0.946  Sum_probs=3.9

Q ss_pred             CCEEEEEEEE
Q ss_conf             7218999961
Q gi|254780160|r   88 PGDYLISASF   97 (298)
Q Consensus        88 pG~Y~v~~s~   97 (298)
                      +|.|.|++.+
T Consensus        76 ~G~y~i~V~~   85 (104)
T 1wlh_A           76 AGDYVINLTL   85 (104)
T ss_dssp             CSEEEEEEEE
T ss_pred             CCEEEEEEEE
T ss_conf             3026789997


No 96 
>>3cwf_A Alkaline phosphatase synthesis sensor protein PHOR; PAS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 2.20A {Bacillus subtilis subsp} (A:)
Probab=22.76  E-value=35  Score=12.31  Aligned_cols=68  Identities=16%  Similarity=0.182  Sum_probs=41.4

Q ss_pred             CCEEEEEECCCCCEEEECCCCEEEC----CCCCEEEEEEEECCCCEE-EEEEEEEECCCCEEEEEEECHHCCC
Q ss_conf             7608999838997974212521212----448702899995388246-7779997288504899974101035
Q gi|254780160|r  225 ADTAWSILTASGDTVGESANASPSM----VLSEGDYTVIARNKERNY-SREFSVLTGKSTIVEVLMRQKRMDK  292 (298)
Q Consensus       225 ~ga~~~i~~~~g~~vt~~~G~~~~~----~L~~G~Y~v~a~~~~~~y-~~~ftV~~g~~~~veV~~~~~~~~~  292 (298)
                      -++++++.|.+|.++.++.+.....    .-+.|.+..........| ..++.........|=+.+..+.+++
T Consensus        47 ~~~rItiid~~G~Vi~DS~~~~~~~~n~~~~le~~~~s~t~~~~~lyva~pi~~~~~~~G~irls~~l~~i~~  119 (122)
T 3cwf_A           47 LDVSASVIDTDGKVLYGSNGRSADSQKVQALVSGHEGILSTTDNKLYYGLSLRSEGEKTGYVLLSASEKSDGL  119 (122)
T ss_dssp             HTCEEEEEETTSCEEEETTSSCCCHHHHHHHHTTCCEECCC-CSCCEEEEEEEETTEEEEEEEEECC------
T ss_pred             CCCEEEEECCCCCEEEECCCCCCCHHHHHHHHCCCCCEECCCCCCEEEEEEECCCCCEEEEEEEECCCCCCCC
T ss_conf             4640689717886887149964007889998725353327876626986762368824138999615445665


No 97 
>>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} (A:)
Probab=21.99  E-value=36  Score=12.22  Aligned_cols=22  Identities=14%  Similarity=0.058  Sum_probs=11.4

Q ss_pred             CCEEEEEEEECCCCEEEEEEEE
Q ss_conf             8702899995388246777999
Q gi|254780160|r  252 SEGDYTVIARNKERNYSREFSV  273 (298)
Q Consensus       252 ~~G~Y~v~a~~~~~~y~~~ftV  273 (298)
                      ..|.|+..|.|..-..+..+.+
T Consensus        76 D~G~Y~C~a~n~~g~a~l~V~~   97 (104)
T 2eny_A           76 DAGEVVFSVRGLTSKASLIVRE   97 (104)
T ss_dssp             TCSCEEEEETTEEEEECEEEEC
T ss_pred             CCEEEEEEECCEEEEEEEEEEC
T ss_conf             4289999988669999999977


No 98 
>>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} (A:)
Probab=21.11  E-value=38  Score=12.10  Aligned_cols=24  Identities=13%  Similarity=0.239  Sum_probs=10.1

Q ss_pred             CEEEEEEEECCCCEEE-EEEEEEEC
Q ss_conf             7028999953882467-77999728
Q gi|254780160|r  253 EGDYTVIARNKERNYS-REFSVLTG  276 (298)
Q Consensus       253 ~G~Y~v~a~~~~~~y~-~~ftV~~g  276 (298)
                      +|.|.+.++.++.... .+|++...
T Consensus        76 ~G~y~i~V~~~g~~i~gSPf~i~V~  100 (112)
T 2d7p_A           76 NGVHSIDVKFNGAHIPGSPFKIRVG  100 (112)
T ss_dssp             CEEEEEEEEESSCBCTTCSEEEEEC
T ss_pred             CCCEEEEEEECCEECCCCCEEEEEC
T ss_conf             8747999999999999989899982


No 99 
>>3gld_A Pilin; all-beta, cell adhesion, structural protein, isopeptide, cell WALL, fimbrium, isopeptide bond, membrane; 2.03A {Streptococcus pyogenes serotype M1} PDB: 3b2m_A 3gle_A (A:1-159)
Probab=20.57  E-value=39  Score=12.03  Aligned_cols=10  Identities=10%  Similarity=0.012  Sum_probs=4.4

Q ss_pred             CCCEEEEEEE
Q ss_conf             7617999961
Q gi|254780160|r  172 TNNYQITSHY  181 (298)
Q Consensus       172 ~G~Y~v~et~  181 (298)
                      ||.|+...+.
T Consensus        95 ~GtY~YtV~E  104 (159)
T 3gld_A           95 PGVYYYKVTA  104 (159)
T ss_dssp             SEEEEEEEEE
T ss_pred             CEEEEEEEEE
T ss_conf             6679999998


No 100
>>2blf_A SORA, sulfite\:cytochrome C oxidoreductase subunit A; sulfite oxidase, molybdopterin, C-type cytochrome, heme, electron transport; HET: MSS HEC; 1.8A {Starkeya novella} PDB: 2bpb_A* 2c9x_A* 2ca3_A* 2ca4_A* (A:261-373)
Probab=20.52  E-value=39  Score=12.02  Aligned_cols=62  Identities=11%  Similarity=0.104  Sum_probs=29.4

Q ss_pred             CCCCEEEEEEEECCCCCCCCCEEEEEEECCCCCEEEEEEECCCCCE------EEEECCCCEEEEEEECC
Q ss_conf             3664379998615788777551899998389743566750567513------52106761799996157
Q gi|254780160|r  121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGT------LVRLGTNNYQITSHYGK  183 (298)
Q Consensus       121 ~~ag~~~~~~~~~~~~~~~~~~~~f~i~~~~~~~~~~~t~~~~~~~------~~~L~~G~Y~v~et~a~  183 (298)
                      +.++.+.+....-++. -+...++|++..+.......+....+...      ...|++|.|.|.++.-+
T Consensus        16 v~~g~v~i~G~A~~G~-~~I~rVEvS~DgG~tW~~a~l~~~~~~~~W~~w~~~~~~~~G~~~i~vRA~D   83 (113)
T 2blf_A           16 VKAGEVPLRGIAFDGG-YGITQVSVSADAGKSWTNATLDPGLGKYSFRGWKAVLPLTKGDHVLMCRATN   83 (113)
T ss_dssp             ECSEEEEEEEEEECSS-SCEEEEEEESSTTSSCEECEECCCSCTTSCEEEEEEEEECSEEEEEEEEEEE
T ss_pred             ECCCCEEEEEEECCCC-CCEEEEEEECCCCCCCEEEECCCCCCCCEEEEEEEEEECCCCCEEEEEEEEC
T ss_conf             3277378886762899-8277999976899867683658988998687359987858992999998996


No 101
>>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protein tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} (A:464-731)
Probab=20.44  E-value=25  Score=13.28  Aligned_cols=96  Identities=8%  Similarity=-0.099  Sum_probs=39.1

Q ss_pred             ECCCCCEEEEECCC-CEEEEEEECC-CCC-EEEEEEEECC--CCEEEEEEE---ECCCEEEEEEEE-CCCCCCCCCEEEE
Q ss_conf             05675135210676-1799996157-785-4454488428--863789999---345238999983-4788632760899
Q gi|254780160|r  160 DKVRSGTLVRLGTN-NYQITSHYGK-YNA-IVSTVVKVEP--GKIIDVTIQ---NRAAKITFKLVS-EMGGEAVADTAWS  230 (298)
Q Consensus       160 ~~~~~~~~~~L~~G-~Y~v~et~a~-~~~-~~~~~i~V~~--g~~~~~tv~---~~~~~~~~~~v~-~~~G~~l~ga~~~  230 (298)
                      .......+.+|.|| .|.|....-. .+. ..+..+.+..  .........   .....+.+.-.. ...+..+.+-.+.
T Consensus       158 ~~~~~~~i~~L~p~t~Y~~~V~a~~~~g~~~~s~~~~~~t~~~~p~~~~~~~~~~~~~~i~~~w~~~~~~~~~i~~y~v~  237 (268)
T 2v5y_A          158 KCYPVPIHFQNASLLNSQYYFAAEFPADSLQAAQPFTIGDNKTYNGYWNTPLLPYKSYRIYFQAASRANGETKIDCVQVA  237 (268)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCCCCCCCHHHHHCCCCCCEEEEEECCCCCCCCCCEEECCCCEECCEECCCCCCCCEEEEEEEEEECCCCCCCCCEEEEC
T ss_conf             45345301212211488722999977655786511798889869987866989989699999999865895244359964


Q ss_pred             EECCCCCE---EEECCCCEEECCCCCEE
Q ss_conf             98389979---74212521212448702
Q gi|254780160|r  231 ILTASGDT---VGESANASPSMVLSEGD  255 (298)
Q Consensus       231 i~~~~g~~---vt~~~G~~~~~~L~~G~  255 (298)
                      ....+...   +....-.+.+.+|.||.
T Consensus       238 ~~~~~~~~~~~~~~~~~~~~i~~L~p~t  265 (268)
T 2v5y_A          238 TKGAATPKPVPEPEKQTDHTVKGTKHHH  265 (268)
T ss_dssp             ----------------------------
T ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEECCC
T ss_conf             7664567899987544445113442023


Done!