HHsearch results for GI: 254780160 and protein with PDBid: 1d2p_A

>1d2p_A Collagen adhesin, CNA; IGG, IGSF, mscramm, structural protein; 2.50A {Staphylococcus aureus} SCOP: b.3.5.1 b.3.5.1 b.3.5.1 b.3.5.1
Probab=98.70  E-value=8.4e-06  Score=54.15  Aligned_cols=213  Identities=10%  Similarity=0.069  Sum_probs=108.4

Q ss_pred             CCCCCEEEEEEECCCCCCCEEEEEEECCCC--EEEECCCCC------EEEEEEEECCCCCEEEEEEECCCCEEEEEEE-C
Q ss_conf             534675999995388876205889824685--663022672------1899996157775278998068613678751-3
Q gi|254780160|r   51 SIDSGVSWHIFDSISNKKNTLSTTKKIIGG--KVSFDLFPG------DYLISASFGHVGVVKKITVSSKEKNQKQVFI-L  121 (298)
Q Consensus        51 ~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~--~~~~~L~pG------~Y~v~~s~g~~~~~~~vtV~~~~~~~~~~~~-~  121 (298)
                      ...+++.+.||... ...+. ..+.+..|.  ..+.+||.+      .|.+.+...+.++.................. .
T Consensus       110 ~~~~~~~v~l~~~g-~~~~~-t~~~~~~g~w~~t~~~L~~~~~~~~~~ytv~e~~~~~g~~~~~~~~~~~~~~~~~~~~~  187 (373)
T 1d2p_A          110 KRPTEIKVELYQDG-KATGK-TAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNNDMGNLITTNKYTP  187 (373)
T ss_dssp             CCCSEEEEEEEETT-EEEEE-EEEEEGGGTTEEEEEEEESBSSSSBCCEEEEECSCCTTCEEEEECSCTTSEEEEEECCC
T ss_pred             CCCCEEEEEEEECC-EEEEE-EEEEECCCCEEEECCCCCCCCCCCEEEEEEEEECCCCCCEEEECCCCCCCCEEEECCCC
T ss_conf             36760799999899-89247-99985589557560677756789759999986035667243203445444034100132


Q ss_pred             CCCEEEEEEEEC---CCCCCCCCEEEEEEECCCCCEEEE--EEECCCCCEEEEECCC------CEEEEEEECCCCCEEEE
Q ss_conf             664379998615---788777551899998389743566--7505675135210676------17999961577854454
Q gi|254780160|r  122 NAGGIRLYSIYK---PGSPIVDDELTFSIYSNPNHKALL--ITDKVRSGTLVRLGTN------NYQITSHYGKYNAIVST  190 (298)
Q Consensus       122 ~ag~~~~~~~~~---~~~~~~~~~~~f~i~~~~~~~~~~--~t~~~~~~~~~~L~~G------~Y~v~et~a~~~~~~~~  190 (298)
                      ....+...+...   ...+..+++++|.||.++......  ..++...+.+..|+++      .|.+.+...+ ++....
T Consensus       188 ~~~~i~~~~~~~~~~~~~g~~~~~~tv~l~~~g~~~~~~t~~~~~~w~~~f~~l~~~~~g~~~~ytv~e~~~~-g~~~~~  266 (373)
T 1d2p_A          188 ETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHVK-DYTTDI  266 (373)
T ss_dssp             CEEEEEEEEEEESTTTTTSCCCSCEEEEEEETTEEEEEEEECGGGTSEEEEEEEESEETTEECCEEEEECCCT-TEEEEE
T ss_pred             CEECCCCEEEECCCCCCCCCCCCCEEEEEEECCEEEEEEEEECCCCCEEECCCCCCCCCCCEEEEEEEEECCC-CCEEEC
T ss_conf             1020344179837888677347757999997996966799741788569626687666783689999754167-725522


Q ss_pred             EEEECCCCEEEEEEEECCCEEEEEEE--ECC--CCCCCCCEEEEEECCCCCEE-----EECCC--CEEECCCC------C
Q ss_conf             48842886378999934523899998--347--88632760899983899797-----42125--21212448------7
Q gi|254780160|r  191 VVKVEPGKIIDVTIQNRAAKITFKLV--SEM--GGEAVADTAWSILTASGDTV-----GESAN--ASPSMVLS------E  253 (298)
Q Consensus       191 ~i~V~~g~~~~~tv~~~~~~~~~~~v--~~~--~G~~l~ga~~~i~~~~g~~v-----t~~~G--~~~~~~L~------~  253 (298)
                      .     +.....+...........+.  +..  .+.+..++.+.|+.. |..+     .++.|  .+.+.+||      +
T Consensus       267 ~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~v~l~~~-g~~~~~~~t~~~~g~wt~t~~~L~~~~~G~~  340 (373)
T 1d2p_A          267 N-----GTTITNKYTPGETSATVTKNWDDNNNQDGKRPTEIKVELYQD-GKATGKTAILNESNNWTHTWTGLDEKAKGQQ  340 (373)
T ss_dssp             E-----TTEEEEEECTTEEEEEEEEEEESGGGTTSCCCSEEEEEEEET-TEEEEEEEEEETTTTTEEEEEEEESEETTEE
T ss_pred             C-----CEEEEEECCCCCCCCCCEEEECCCCCCCCCCCCCEEEEEEEC-CEEEEEEEEECCCCCEEEEECCCCCCCCCCE
T ss_conf             5-----514321014445555302465038875466886289999989-9385458997389964999767654679988


Q ss_pred             EEEEEEEECCCCEEEEEEE
Q ss_conf             0289999538824677799
Q gi|254780160|r  254 GDYTVIARNKERNYSREFS  272 (298)
Q Consensus       254 G~Y~v~a~~~~~~y~~~ft  272 (298)
                      +.|+|.+...+.+|+..++
T Consensus       341 ~~Y~v~E~~~p~gY~~s~~  359 (373)
T 1d2p_A          341 VKYTVEELTKVKGYTTHVD  359 (373)
T ss_dssp             CCEEEEECSCCTTEEEEEE
T ss_pred             EEEEEEEECCCCCCEEEEE
T ss_conf             9999998158998489997