HHsearch results for GI: 254780160 and protein with PDBid: 1d2p_A

>1d2p_A Collagen adhesin, CNA; IGG, IGSF, mscramm, structural protein; 2.50A {Staphylococcus aureus} SCOP: b.3.5.1 b.3.5.1 b.3.5.1 b.3.5.1
Probab=98.50  E-value=6.4e-05  Score=48.45  Aligned_cols=203  Identities=12%  Similarity=0.059  Sum_probs=109.9

Q ss_pred             CCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCC------EEEEEEEECCCCCEEEEEEECCCCEEEEEEECCCCEE
Q ss_conf             4675999995388876205889824685663022672------1899996157775278998068613678751366437
Q gi|254780160|r   53 DSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPG------DYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGI  126 (298)
Q Consensus        53 ~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG------~Y~v~~s~g~~~~~~~vtV~~~~~~~~~~~~~~ag~~  126 (298)
                      ++.+.++||.. ....+...+..+.++.+.+.+||.+      .|.+.+... .++...  ....  .............
T Consensus        22 p~~vtV~l~~~-g~~~~t~t~~~~g~w~~t~~~lp~~~~g~~~~ytV~e~~~-~g~~~~--~~~~--~~~~~~~~~~~~~   95 (373)
T 1d2p_A           22 PEKVSVNLLAN-GEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYTVTEDHV-KDYTTD--INGT--TITNKYTPGETSA   95 (373)
T ss_dssp             CSEEEEEEEET-TEEEEEEEEEGGGTTEEEEEEEESEETTEECCEEEEECCC-TTEEEE--EETT--EEEEEECTTEEEE
T ss_pred             CCEEEEEEEEC-CEEEEEEEECCCCCEEEEECCCCCCCCCCEEEEEEEEECC-CCCEEE--ECCE--EEEECCCCCCCCC
T ss_conf             87179999959-9498899988899879995888766799438999998568-984663--0220--5751235322223


Q ss_pred             EEEEEECC---CCCCCCCEEEEEEECCCCCEEEEE-EECCC--CCEEEEECCC------CEEEEEEECCCCCEEEEEEEE
Q ss_conf             99986157---887775518999983897435667-50567--5135210676------179999615778544544884
Q gi|254780160|r  127 RLYSIYKP---GSPIVDDELTFSIYSNPNHKALLI-TDKVR--SGTLVRLGTN------NYQITSHYGKYNAIVSTVVKV  194 (298)
Q Consensus       127 ~~~~~~~~---~~~~~~~~~~f~i~~~~~~~~~~~-t~~~~--~~~~~~L~~G------~Y~v~et~a~~~~~~~~~i~V  194 (298)
                      ...+....   .....+..+.|.|+.+........ ....+  .+.+.+|+.+      .|++.+...+.+|........
T Consensus        96 ~~~~~~~d~~~~~~~~~~~~~v~l~~~g~~~~~t~~~~~~g~w~~t~~~L~~~~~~~~~~ytv~e~~~~~g~~~~~~~~~  175 (373)
T 1d2p_A           96 TVTKNWDDNNNQDGKRPTEIKVELYQDGKATGKTAILNESNNWTHTWTGLDEKAKGQQVKYTVEELTKVKGYTTHVDNND  175 (373)
T ss_dssp             EEEEEEESTTTTTSCCCSEEEEEEEETTEEEEEEEEEEGGGTTEEEEEEEESBSSSSBCCEEEEECSCCTTCEEEEECSC
T ss_pred             CCEEEEECCCCCCCCCCCEEEEEEEECCEEEEEEEEEECCCCEEEECCCCCCCCCCCEEEEEEEEECCCCCCEEEECCCC
T ss_conf             22014606887565367607999998998924799985589557560677756789759999986035667243203445


Q ss_pred             CCCCEEEEEEEEC--CCEEEEEEEE----CCCCCCCCCEEEEEECCCCCEE-----EECCCCEEECCCCCEE------EE
Q ss_conf             2886378999934--5238999983----4788632760899983899797-----4212521212448702------89
Q gi|254780160|r  195 EPGKIIDVTIQNR--AAKITFKLVS----EMGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGD------YT  257 (298)
Q Consensus       195 ~~g~~~~~tv~~~--~~~~~~~~v~----~~~G~~l~ga~~~i~~~~g~~v-----t~~~G~~~~~~L~~G~------Y~  257 (298)
                      ...  ..++....  ...+...++.    ...|.+.+++.|+|+..+...-     .+.++.+.+.+||.++      |+
T Consensus       176 ~~~--~~~~~~~~~~~~~i~~~~~~~~~~~~~g~~~~~~tv~l~~~g~~~~~~t~~~~~~w~~~f~~l~~~~~g~~~~yt  253 (373)
T 1d2p_A          176 MGN--LITTNKYTPETTSSIGEKVWDDKDNQDGKRPEKVSVNLLANGEKVKTLDVTSETNWKYEFKDLPKYDEGKKIEYT  253 (373)
T ss_dssp             TTS--EEEEEECCCCEEEEEEEEEEESTTTTTSCCCSCEEEEEEETTEEEEEEEECGGGTSEEEEEEEESEETTEECCEE
T ss_pred             CCC--CEEEECCCCCEECCCCEEEECCCCCCCCCCCCCEEEEEEECCEEEEEEEEECCCCCEEECCCCCCCCCCCEEEEE
T ss_conf             444--034100132102034417983788867734775799999799696679974178856962668766678368999


Q ss_pred             EEEECC
Q ss_conf             999538
Q gi|254780160|r  258 VIARNK  263 (298)
Q Consensus       258 v~a~~~  263 (298)
                      +.+...
T Consensus       254 v~e~~~  259 (373)
T 1d2p_A          254 VTEDHV  259 (373)
T ss_dssp             EEECCC
T ss_pred             EEEECC
T ss_conf             975416