HHsearch results for GI: 254780160 and protein with PDBid: 2nsm_A

>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, hormone processing, peptide modification; HET: NAG; 2.10A {Homo sapiens}
Probab=98.18  E-value=3.7e-06  Score=56.43  Aligned_cols=78  Identities=17%  Similarity=0.143  Sum_probs=62.1

Q ss_pred             CEEEEEEEECCCCCCCCCEEEEEECCCCCEEEECCCCEEECCCCCEEEEEEEECCCC-EEEEEEEEEECCCCEEEEEEEC
Q ss_conf             238999983478863276089998389979742125212124487028999953882-4677799972885048999741
Q gi|254780160|r  209 AKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKER-NYSREFSVLTGKSTIVEVLMRQ  287 (298)
Q Consensus       209 ~~~~~~~v~~~~G~~l~ga~~~i~~~~g~~vt~~~G~~~~~~L~~G~Y~v~a~~~~~-~y~~~ftV~~g~~~~veV~~~~  287 (298)
                      ..+.+++. +..|+||++|.+.|...+..+.|+.+|.|.. .|+||.|++.++.-++ ..++.++|..++...+++.|+.
T Consensus       321 ~gi~G~V~-d~~g~pl~~A~V~v~g~~~~~~Td~~G~f~~-~l~~G~y~l~vs~~Gy~~~~~~v~v~~~~~~~~~~~L~~  398 (439)
T 2nsm_A          321 QGIKGMVL-DQNYNNLANAVISVSGINHDVTSGDHGDYFR-LLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKR  398 (439)
T ss_dssp             CSEEEEEE-CTTSCBCTTCEEEETTEEEEEECCTTSEEEE-CCCSEEEEEEEECTTEECEEEEEEECSSSCEECCEECEE
T ss_pred             CEEEEEEE-CCCCCCCCCEEEEEECCCCCEEECCCCCEEE-EECCCCEEEEEEEECCCCEEEEEEECCCCEEEEEEEECC
T ss_conf             33589998-7789737854999977616638889973999-837962799999957335799999858982999999822


Q ss_pred             H
Q ss_conf             0
Q gi|254780160|r  288 K  288 (298)
Q Consensus       288 ~  288 (298)
                      .
T Consensus       399 ~  399 (439)
T 2nsm_A          399 S  399 (439)
T ss_dssp             C
T ss_pred             C
T ss_conf             6