HHsearch results for GI: 254780160 and protein with PDBid: 3hr6_A

>3hr6_A SPAA, putative surface-anchored fimbrial subunit; multiple IG-like domains, cell WALL, peptidoglycan-anchor, structural protein; 1.60A {Corynebacterium diphtheriae} PDB: 3htl_X*
Probab=97.62  E-value=0.00012  Score=46.60  Aligned_cols=57  Identities=19%  Similarity=0.211  Sum_probs=42.3

Q ss_pred             CCCCCCCCCEEEEEEECCC---------------------------CCCCEEEEEEECCCCEEEECCCCCEEEEEEEECC
Q ss_conf             8877534675999995388---------------------------8762058898246856630226721899996157
Q gi|254780160|r   47 ENSTSIDSGVSWHIFDSIS---------------------------NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH   99 (298)
Q Consensus        47 ~~~~~~~~G~~~~vy~~~~---------------------------~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~g~   99 (298)
                      ..+..+++|+.|+||.-..                           +.......+|+++|...+.+|++|.|.|+|+.++
T Consensus        28 ~~~~~~l~G~~F~~~kv~~id~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~tT~~~G~~~f~~L~~G~Y~v~Et~ap  107 (436)
T 3hr6_A           28 SIGLPKVDGMSFTLYRVNEIDLTTQAGWDAASKIKLEELYTNGHPTDKVTKVATKKTEGGVAKFDNLTPALYLVVQELNG  107 (436)
T ss_dssp             --CCCBCSSCEEEEEEETTCCTTSHHHHHHHTTCCHHHHEETTEECTTEEEEEEEECBTTBEEEEEECSEEEEEEECSCS
T ss_pred             CCCCCCCCCCEEEEEEECCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEEECCCCEEEECCCCCEEEEEEEEECC
T ss_conf             77898679968999991353344865644431145000014553467503345667799849989868787999998458


Q ss_pred             CCCE
Q ss_conf             7752
Q gi|254780160|r  100 VGVV  103 (298)
Q Consensus       100 ~~~~  103 (298)
                      .++.
T Consensus       108 ~gy~  111 (436)
T 3hr6_A          108 AEAV  111 (436)
T ss_dssp             SSCE
T ss_pred             CCCE
T ss_conf             8847