HHsearch results for GI: 254780160 and protein with PDBid: 3mn8_A

>3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster}
Probab=97.13  E-value=0.0015  Score=39.64  Aligned_cols=77  Identities=14%  Similarity=0.092  Sum_probs=54.8

Q ss_pred             EEEEEEECCCCCCCCCEEEEEECCCCC-EEEECCCCEEECCCCCEEEEEEEECCCCEE--EEEEEEE--ECCCCEEEEEE
Q ss_conf             899998347886327608999838997-974212521212448702899995388246--7779997--28850489997
Q gi|254780160|r  211 ITFKLVSEMGGEAVADTAWSILTASGD-TVGESANASPSMVLSEGDYTVIARNKERNY--SREFSVL--TGKSTIVEVLM  285 (298)
Q Consensus       211 ~~~~~v~~~~G~~l~ga~~~i~~~~g~-~vt~~~G~~~~~~L~~G~Y~v~a~~~~~~y--~~~ftV~--~g~~~~veV~~  285 (298)
                      ++-..|.+..|.||++|.+.|.+.+.. +.+..+|.|-. -|+||.|.|.++..++..  .+.+.|.  .+..+.+++++
T Consensus       338 Gi~G~V~d~~g~pi~~a~i~v~g~~~~~~~t~~~G~y~r-~l~pG~Y~v~~~a~GY~~~~~~~v~v~~~~~~~~~~~f~L  416 (435)
T 3mn8_A          338 GIKGLVTDASGFPIADANVYVAGLEEKPMRTSKRGEYWR-LLTPGLYSVHASAFGYQTSAPQQVRVTNDNQEALRLDFKL  416 (435)
T ss_dssp             SEEEEEECSSSCBCTTCEEEETTCTTSCEECCTTCEEEE-CCCSEEEEEEEEBTTBCCCCCEEEEECCCSSSCEECCEEC
T ss_pred             CCEEEEECCCCCCCCCEEEEEECCCCCCEECCCCCCEEE-ECCCEEEEEEEEEECCCCCCCEEEEEECCCCCEEEEEEEE
T ss_conf             407999667899788749999655177116688972899-7178047999998175577715899965899618998897


Q ss_pred             ECH
Q ss_conf             410
Q gi|254780160|r  286 RQK  288 (298)
Q Consensus       286 ~~~  288 (298)
                      ...
T Consensus       417 ~p~  419 (435)
T 3mn8_A          417 APV  419 (435)
T ss_dssp             CBC
T ss_pred             ECC
T ss_conf             148