HHSEARCH alignment of GI: 254780160 and SCOP domain: d1uwya1

Alignment
>d1uwya1 b.3.2.1 (A:297-403) Carboxypeptidase M C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
Probab=96.77  E-value=0.0023  Score=36.84  Aligned_cols=67  Identities=19%  Similarity=0.342  Sum_probs=41.5

Q ss_pred             EEEECCCCCCCCCCEEEEEEECCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEE-CCCCCEEEEEEECCCC
Q ss_conf             99986887753467599999538887620588982468566302267218999961-5777527899806861
Q gi|254780160|r   42 EARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF-GHVGVVKKITVSSKEK  113 (298)
Q Consensus        42 ~a~~~~~~~~~~~G~~~~vy~~~~~~~g~~~~tt~~~G~~~~~~L~pG~Y~v~~s~-g~~~~~~~vtV~~~~~  113 (298)
                      +.+..+..+.+++||..+|...    ......+++.+| ..+..|++|+|.|.+++ ||...++.+.+..+..
T Consensus         3 ~G~V~D~~g~pi~~A~V~i~~~----~~~~~~~td~~G-~f~~~~~~g~Y~l~vs~~Gy~~~~~~v~v~~~~~   70 (107)
T d1uwya1           3 KGQVFDQNGNPLPNVIVEVQDR----KHICPYRTNKYG-EYYLLLLPGSYIINVTVPGHDPHITKVIIPEKSQ   70 (107)
T ss_dssp             EEEEECTTSCBCCSCEEEETTC----CCSSCCBCCTTC-EEEECCCSEEEEEEEECSSSCCEEEEEEECSSCS
T ss_pred             EEEEECCCCCCCCCEEEEEECC----CCCCEEECCHHH-EEEEECCCCCEEEEEEEEEEEEEEEEEEECCCCC
T ss_conf             8999889999968579999722----046246340140-1463048865799999998510899999978982


SCOP domain information

class: All beta proteins
fold: Prealbumin-like
superfamily: Carboxypeptidase regulatory domain-like
family: Carboxypeptidase regulatory domain
domain: Carboxypeptidase M C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]