BLAST/PSIBLAST alignment of GI: 254780160 and GI: 190891874 at iteration 1
>gi|190891874|ref|YP_001978416.1| hypothetical protein RHECIAT_CH0002283 [Rhizobium etli CIAT 652] Length = 365
>gi|190697153|gb|ACE91238.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 365
 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 125/273 (45%), Positives = 180/273 (65%), Gaps = 5/273 (1%)

Query: 21  LNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGG 80
           LN  I+ G        + +  EA+LT + T ++ G+SW++F  I+     L       GG
Sbjct: 45  LNAFIAPGTAPEAAKLRDVAMEAKLTADGTPVEDGLSWYVFSPIAGTDGKLPLIASAKGG 104

Query: 81  KVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVD 140
             +F L PGDY ++ SFG  GV KK+TV +  +  KQV +L+AGG+ L ++    + I  
Sbjct: 105 PAAFQLAPGDYFVNVSFGRAGVTKKLTVPADGEVDKQVMVLDAGGLLLNAVSGTDARIRP 164

Query: 141 DELTFSIYS----NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
           DEL+FSIYS    +   + L++ D V   T+VRL    Y I S YG  NA++   ++VE 
Sbjct: 165 DELSFSIYSSEVRDDGERGLVVAD-VSPNTVVRLNAGTYHIVSEYGNVNAVIRADIQVEA 223

Query: 197 GKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDY 256
           GK+ + TIQ+RAA+ITFKLVSE GGEA+ADTAWSILTA+GD+VGES +A P+MVL+EG+Y
Sbjct: 224 GKLTEATIQHRAAQITFKLVSEAGGEAIADTAWSILTAAGDSVGESVSAFPTMVLAEGEY 283

Query: 257 TVIARNKERNYSREFSVLTGKSTIVEVLMRQKR 289
           + +ARNK++ Y R+F+V+ GK+T VEVLM+ ++
Sbjct: 284 SAVARNKDKIYQRDFTVVAGKNTDVEVLMKDQQ 316