BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780160|ref|YP_003064573.1| hypothetical protein
CLIBASIA_00215 [Candidatus Liberibacter asiaticus str. psy62]
         (298 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|254780160|ref|YP_003064573.1| hypothetical protein CLIBASIA_00215 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039837|gb|ACT56633.1| hypothetical protein CLIBASIA_00215 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 298

 Score =  235 bits (598), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 298/298 (100%), Positives = 298/298 (100%)

Query: 1   MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHI 60
           MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHI
Sbjct: 1   MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHI 60

Query: 61  FDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFI 120
           FDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFI
Sbjct: 61  FDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFI 120

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSH 180
           LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSH
Sbjct: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSH 180

Query: 181 YGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVG 240
           YGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVG
Sbjct: 181 YGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVG 240

Query: 241 ESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHNT 298
           ESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHNT
Sbjct: 241 ESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHNT 298


>gi|239831911|ref|ZP_04680240.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824178|gb|EEQ95746.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 393

 Score =  232 bits (592), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 110/282 (39%), Positives = 159/282 (56%), Gaps = 5/282 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             LNN  S    +   +   + +  +ARL+E+   I +G+ W +F         L     
Sbjct: 114 PTLNNYASPSSPENNPLAQTRELDLKARLSEDGGDIPAGLVWRVFSPDVGADGQLPLIAS 173

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG   F+L  G YL+  ++G  G  K+ITV      + +V +L+AGG++L +I   G 
Sbjct: 174 AQGGGAVFNLPEGSYLVHVAYGRAGATKRITV--GNATRHEVMMLDAGGMKLSAILPDGG 231

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I +D L FSIY    N    LI   V+  T++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 232 KINNDLLRFSIYADEDNSDRSLIVPDVKPNTIIRLNSGTYHVVSNYGSANAIIRADIRVE 291

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV E GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 292 AGKLTEATVQHRAAEVTLKLVRERGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 351

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHN 297
           Y  +A+NK+R Y R+F V +GK+  VEV+   +        +
Sbjct: 352 YVAVAKNKDRIYQRDFKVSSGKNEEVEVVANGESEPAQDSMD 393



 Score = 47.6 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/188 (11%), Positives = 57/188 (30%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +    +      ++DA  +   A L +     +  + + I+    N     S    
Sbjct: 199 ATKRITVGNATRHEVMMLDAGGMKLSAILPDGGKINNDLLRFSIYADEDNSD--RSLIVP 256

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 257 DVKPNTIIRLNSGTYHVVSNYGSANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRERG 316

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KV  
Sbjct: 317 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVSS 371

Query: 197 GKIIDVTI 204
           GK  +V +
Sbjct: 372 GKNEEVEV 379


>gi|86357811|ref|YP_469703.1| hypothetical protein RHE_CH02195 [Rhizobium etli CFN 42]
 gi|86281913|gb|ABC90976.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 367

 Score =  226 bits (575), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 125/294 (42%), Positives = 187/294 (63%), Gaps = 5/294 (1%)

Query: 7   SYAKAENMHTTSTL--LNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSI 64
           ++   + + +TS +  LN  I+ G        + I  EA+LT + T ++ G+SW++F  I
Sbjct: 29  AFKGFKQLDSTSKMPKLNAFIAPGAAPEGAKLRDIEMEAKLTADGTPVEDGLSWYVFSPI 88

Query: 65  SNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAG 124
           +     L       GG  +F L PGDY ++ SFG  GV KK+TV +  +  KQV +L+AG
Sbjct: 89  AGTDGKLPLIASAKGGPAAFQLAPGDYFVNVSFGRAGVTKKLTVPADGEVDKQVMVLDAG 148

Query: 125 GIRLYSIYKPGSPIVDDELTFSIYSN---PNHKALLITDKVRSGTLVRLGTNNYQITSHY 181
           G+ L ++    + I  D+L+FSIYS+    + +  L+   V   T+VRL    Y I S Y
Sbjct: 149 GLLLNAVSGTDARIRPDQLSFSIYSSEVRDDGERGLVVADVSPNTVVRLNAGTYHIVSEY 208

Query: 182 GKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGE 241
           G  NAI+   ++VE GK+ + TIQ+RAA++TFKLVSE GGEA+ADTAWSILTA+GD+VGE
Sbjct: 209 GSVNAIIRADIQVEAGKLTEATIQHRAAQMTFKLVSEAGGEAIADTAWSILTAAGDSVGE 268

Query: 242 SANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
           S +A P+MVL+EG+Y+ +ARNK++ Y R+F+V+ G++T VEVLM+ +   +   
Sbjct: 269 SVSAFPTMVLAEGEYSAVARNKDKIYQRDFTVVAGRNTDVEVLMKDQEPQQPES 322


>gi|241204764|ref|YP_002975860.1| hypothetical protein Rleg_2043 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858654|gb|ACS56321.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 366

 Score =  224 bits (569), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 122/294 (41%), Positives = 185/294 (62%), Gaps = 4/294 (1%)

Query: 3   ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
            +F  + + E+       L+  I+ G     V  + +  EA+LT + T ++ G+SW++F 
Sbjct: 28  DAFKEFKQLESTPKM-PKLDAFIAPGTVPDGVKLRDVPMEAKLTADGTPVEEGLSWYVFS 86

Query: 63  SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILN 122
            I+     L       GG  +F L PGDY ++ SFG  GV KK+TV +  +  KQV +L+
Sbjct: 87  PIAGADGKLPLIASAKGGPAAFQLAPGDYFVNVSFGRAGVTKKLTVPADGEIDKQVMVLD 146

Query: 123 AGGIRLYSIYKPGSPIVDDELTFSIYSN---PNHKALLITDKVRSGTLVRLGTNNYQITS 179
           AGG+ L ++    + I  D+L+FSIYS+    + +  L+   +   T+VRL    Y I S
Sbjct: 147 AGGLLLNAVSGADARIRPDQLSFSIYSSEVRDDGERGLVMADISPNTVVRLNAGTYHIVS 206

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
            YG  NA++   ++VE GK+ + TIQ+RAA+ITFKLVS+ GGEA+ADTAWSILTA+GD+V
Sbjct: 207 EYGSVNAVIRADIQVEAGKLTEATIQHRAAQITFKLVSDAGGEAIADTAWSILTAAGDSV 266

Query: 240 GESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKN 293
           GES +A P+MVL+EG Y+ +ARNK++ Y R+F+V+ G++T VEVLM+ ++    
Sbjct: 267 GESVSAFPTMVLAEGGYSAVARNKDKIYQRDFTVVAGRNTDVEVLMKDQQPQPP 320


>gi|153009483|ref|YP_001370698.1| hypothetical protein Oant_2153 [Ochrobactrum anthropi ATCC 49188]
 gi|151561371|gb|ABS14869.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 345

 Score =  222 bits (566), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 108/282 (38%), Positives = 157/282 (55%), Gaps = 5/282 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             LN   +    +   +V  + +  +ARL+E    I +G+ W +F         L     
Sbjct: 66  PTLNTYAAPSSPENNPLVQTRELDLKARLSEGGGDIPAGLVWRVFSPDVGADGQLPLIAS 125

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG   F+L  G YL+  ++G  G  K+ITV      + +V +L+AGG++L +I   G 
Sbjct: 126 AKGGSAVFNLPEGSYLVHVAYGRAGATKRITV--GNATRHEVMMLDAGGMKLSAILPDGG 183

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N+   LI   V+   ++RL +  Y + S+YG  NA +   ++VE
Sbjct: 184 KINDDLLRFSIYADEDNNDRSLIVPDVKPNAIIRLNSGTYHVVSNYGTANATIRADIRVE 243

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV E GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 244 AGKLTEATVQHRAAEVTLKLVRERGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 303

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHN 297
           Y  +A+NK+R Y R+F V +GK+  VEV+   +        +
Sbjct: 304 YVAVAKNKDRIYQRDFKVSSGKNEEVEVVANGESESVQDSMD 345



 Score = 46.1 bits (107), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/198 (11%), Positives = 58/198 (29%), Gaps = 7/198 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +    +      ++DA  +   A L +     D  + + I+    N     S    
Sbjct: 151 ATKRITVGNATRHEVMMLDAGGMKLSAILPDGGKINDDLLRFSIYADEDNND--RSLIVP 208

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G      +  +  +     +  + +        + +   
Sbjct: 209 DVKPNAIIRLNSGTYHVVSNYGTANATIRADIRVEAGKLTEATVQHRAAEVTLKLVRERG 268

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KV  
Sbjct: 269 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVSS 323

Query: 197 GKIIDVTIQNRAAKITFK 214
           GK  +V +       + +
Sbjct: 324 GKNEEVEVVANGESESVQ 341


>gi|190891874|ref|YP_001978416.1| hypothetical protein RHECIAT_CH0002283 [Rhizobium etli CIAT 652]
 gi|190697153|gb|ACE91238.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 365

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 126/296 (42%), Positives = 186/296 (62%), Gaps = 4/296 (1%)

Query: 3   ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
            +F  + + E+       LN  I+ G        + +  EA+LT + T ++ G+SW++F 
Sbjct: 28  DAFKDFKQIESTPKM-PKLNAFIAPGTAPEAAKLRDVAMEAKLTADGTPVEDGLSWYVFS 86

Query: 63  SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILN 122
            I+     L       GG  +F L PGDY ++ SFG  GV KK+TV +  +  KQV +L+
Sbjct: 87  PIAGTDGKLPLIASAKGGPAAFQLAPGDYFVNVSFGRAGVTKKLTVPADGEVDKQVMVLD 146

Query: 123 AGGIRLYSIYKPGSPIVDDELTFSIYSN---PNHKALLITDKVRSGTLVRLGTNNYQITS 179
           AGG+ L ++    + I  DEL+FSIYS+    + +  L+   V   T+VRL    Y I S
Sbjct: 147 AGGLLLNAVSGTDARIRPDELSFSIYSSEVRDDGERGLVVADVSPNTVVRLNAGTYHIVS 206

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
            YG  NA++   ++VE GK+ + TIQ+RAA+ITFKLVSE GGEA+ADTAWSILTA+GD+V
Sbjct: 207 EYGNVNAVIRADIQVEAGKLTEATIQHRAAQITFKLVSEAGGEAIADTAWSILTAAGDSV 266

Query: 240 GESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
           GES +A P+MVL+EG+Y+ +ARNK++ Y R+F+V+ GK+T VEVLM+ ++  +   
Sbjct: 267 GESVSAFPTMVLAEGEYSAVARNKDKIYQRDFTVVAGKNTDVEVLMKDQQPQQPAS 322


>gi|327188319|gb|EGE55537.1| hypothetical protein RHECNPAF_910012 [Rhizobium etli CNPAF512]
          Length = 365

 Score =  222 bits (566), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 126/296 (42%), Positives = 186/296 (62%), Gaps = 4/296 (1%)

Query: 3   ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
            +F  + + E+       LN  I+ G        + +  EA+LT + T ++ G+SW++F 
Sbjct: 28  DAFKDFKQIESTPKM-PKLNAFIAPGTAPDAAKLRDVAMEAKLTADGTPVEDGLSWYVFS 86

Query: 63  SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILN 122
            I+     L       GG  +F L PGDY ++ SFG  GV KK+TV +  +  KQV +L+
Sbjct: 87  PIAGTDGKLPLIASAKGGPAAFQLAPGDYFVNVSFGRAGVTKKLTVPADGEVNKQVMVLD 146

Query: 123 AGGIRLYSIYKPGSPIVDDELTFSIYSN---PNHKALLITDKVRSGTLVRLGTNNYQITS 179
           AGG+ L ++    + I  DEL+FSIYS+    + +  L+   V   T+VRL    Y I S
Sbjct: 147 AGGLLLNAVSGTDARIRPDELSFSIYSSEVRDDGERGLVVADVSPNTVVRLNAGTYHIVS 206

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
            YG  NA++   ++VE GK+ + TIQ+RAA+ITFKLVSE GGEA+ADTAWSILTA+GD+V
Sbjct: 207 EYGNVNAVIRADIQVEAGKLTEATIQHRAAQITFKLVSEAGGEAIADTAWSILTAAGDSV 266

Query: 240 GESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
           GES +A P+MVL+EG+Y+ +ARNK++ Y R+F+V+ GK+T VEVLM+ ++  +   
Sbjct: 267 GESVSAFPTMVLAEGEYSAVARNKDKIYQRDFTVVAGKNTDVEVLMKDQQPQQPAS 322


>gi|49474353|ref|YP_032395.1| hypothetical protein BQ07670 [Bartonella quintana str. Toulouse]
 gi|49239857|emb|CAF26251.1| hypothetical protein BQ07670 [Bartonella quintana str. Toulouse]
          Length = 336

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 103/294 (35%), Positives = 166/294 (56%), Gaps = 9/294 (3%)

Query: 4   SFSSYAKAENMHTTSTLLNNNISKG---KGKRVVDAQRITCEARLTENSTSIDSGVSWHI 60
           +FS   + + +    +   N ISK    + + +V   ++   ARLT +S ++  G+ W +
Sbjct: 41  AFSEEVREQELQKEQS--TNFISKSQDREKENLVSQSQLILHARLTNSSENVVKGLIWRV 98

Query: 61  FDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFI 120
           +  I    N L       GG   F+L PG YL+  SFGH   V  I++ + +   K  F 
Sbjct: 99  YAPILGIDNKLPLIASYEGGSAHFNLEPGSYLVHVSFGHASAVHHISLQNGQSLVKN-FN 157

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSN--PNHKALLITDKVRSGTLVRLGTNNYQIT 178
           L+AGG+ L +    G+ I + EL F+IY +   N    +I   V+  ++VRL    Y + 
Sbjct: 158 LDAGGVLLNATLLNGT-INEKELRFTIYEDEKENDDTGVILSNVKPLSIVRLKAGRYHVA 216

Query: 179 SHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT 238
           SHYG  N IV + ++V+ GKI +VT++++AA+I FKLV + GGEA+ADT+WSI   SGD 
Sbjct: 217 SHYGSINVIVHSDIQVDAGKITEVTLEHQAAQIVFKLVRQEGGEALADTSWSITNDSGDI 276

Query: 239 VGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDK 292
           + E+  A  S+VL+EG Y  IA+NK++ Y + FSV++G    + ++ + + M +
Sbjct: 277 IYETVGAYVSLVLAEGKYIAIAKNKDQIYQKAFSVVSGHDEDISLVAKVQNMQQ 330


>gi|294852344|ref|ZP_06793017.1| hypothetical protein BAZG_01266 [Brucella sp. NVSL 07-0026]
 gi|294820933|gb|EFG37932.1| hypothetical protein BAZG_01266 [Brucella sp. NVSL 07-0026]
          Length = 352

 Score =  220 bits (561), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 73  PTINPYASPASPENNPLVRIYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 132

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 133 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 190

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 191 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 250

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 251 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 310

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 311 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 343



 Score = 51.1 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 158 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 215

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 216 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 275

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 276 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 330

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 331 GKNEDVEV 338


>gi|222148639|ref|YP_002549596.1| hypothetical protein Avi_2219 [Agrobacterium vitis S4]
 gi|221735625|gb|ACM36588.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 328

 Score =  220 bits (560), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 115/301 (38%), Positives = 171/301 (56%), Gaps = 6/301 (1%)

Query: 3   ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
            +F S+ + ++       LN   +         ++ I  EA+L      +  G+ W ++ 
Sbjct: 28  DAFKSFKQLDSTAKM-PKLNAFSTPIAPAPQSHSKLIRFEAKLDNEGQPLQQGLEWRVYS 86

Query: 63  SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILN 122
            I+     L       GG     L PGDY ++ SFG  GV +K+ V +  + QKQV +L+
Sbjct: 87  PIAGSDGKLPMVASSQGGSAELQLAPGDYFVNVSFGRAGVTRKLDVPTDGEVQKQVMVLD 146

Query: 123 AGGIRLYSIYKPGSPIVDDELTFSIYSNPN---HKALLITDKVRSGTLVRLGTNNYQITS 179
           AGG+ L ++  P + I   +L F IY+      +   LI D +   TLV L +  Y + S
Sbjct: 147 AGGMVLNAVSGPDTRIKPSKLKFKIYAGDGPEDNDRGLIMDNIEPNTLVSLNSGTYHVVS 206

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
            YG+ NA+V   +KVE GKI + T+Q+RAA++ FKLVSE GGEA+ADTAWSILT+SGD V
Sbjct: 207 QYGEVNALVRADIKVEAGKITEATLQHRAAQMNFKLVSEPGGEAIADTAWSILTSSGDAV 266

Query: 240 GESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQ--KRMDKNGQHN 297
            ES +A P +VLSEG+YT IARNK+R Y +EF V  G +  VE+L++   + + +   ++
Sbjct: 267 AESVSAYPVLVLSEGNYTAIARNKDRIYQKEFQVKAGVNADVELLLKDSQQNVQQQAGYD 326

Query: 298 T 298
           T
Sbjct: 327 T 327


>gi|148559273|ref|YP_001259001.1| hypothetical protein BOV_1034 [Brucella ovis ATCC 25840]
 gi|225627543|ref|ZP_03785580.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237815490|ref|ZP_04594488.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|148370530|gb|ABQ60509.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|225617548|gb|EEH14593.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237790327|gb|EEP64537.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
          Length = 352

 Score =  219 bits (558), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 73  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 132

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 133 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 190

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 191 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 250

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 251 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 310

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 311 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 343



 Score = 50.7 bits (119), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 158 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 215

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 216 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 275

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 276 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 330

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 331 GKNEDVEV 338


>gi|49475740|ref|YP_033781.1| hypothetical protein BH09950 [Bartonella henselae str. Houston-1]
 gi|49238547|emb|CAF27787.1| hypothetical protein BH09950 [Bartonella henselae str. Houston-1]
          Length = 339

 Score =  218 bits (555), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 96/292 (32%), Positives = 163/292 (55%), Gaps = 5/292 (1%)

Query: 4   SFSSYAKA-ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
           +FS      E     S    +     + + ++   ++   ARLT ++ +I  G+ W ++ 
Sbjct: 44  AFSQEEGEQERKQEQSRSFISKSQNNEKENLISQTQLILHARLTNSNENIVKGLVWRVYA 103

Query: 63  SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILN 122
            I    N L       GG   FDL PG YL+  SFGH   V+ I++ +  K+  Q F L+
Sbjct: 104 PILGVDNKLPLITTYEGGSARFDLEPGSYLVHVSFGHASAVRHISLENG-KSLVQNFNLD 162

Query: 123 AGGIRLYSIYKPGSPIVDDELTFSIYSN--PNHKALLITDKVRSGTLVRLGTNNYQITSH 180
           AG + L +    G  + + EL F++Y +   N    ++   ++  ++VRL    Y + SH
Sbjct: 163 AGAVTLNATLLNG-IVNEKELRFTLYEDEKENDDTGVVLSNIKPHSIVRLKAGRYHVASH 221

Query: 181 YGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVG 240
           YG  NA+V + ++V+ GKI +V+++++AA+I  KLV + GGEA+ADT+WSI   SGD + 
Sbjct: 222 YGSINAVVHSDIQVDAGKITEVSLEHQAAQIVLKLVRQEGGEALADTSWSITNNSGDIMY 281

Query: 241 ESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDK 292
           E+  A  S+VL+EG+Y  IA+NK++ Y + FSV++G+   + V+ + + M +
Sbjct: 282 ETVGAYVSLVLAEGEYIAIAKNKDQIYQKVFSVVSGRDEDINVVAKAQNMQQ 333


>gi|116252273|ref|YP_768111.1| hypothetical protein RL2527 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115256921|emb|CAK08015.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 366

 Score =  218 bits (555), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 123/296 (41%), Positives = 186/296 (62%), Gaps = 4/296 (1%)

Query: 3   ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
            +F  + + E+       L+  I+ G     V  + +  EA+LT + T ++ G+SW++F 
Sbjct: 28  DAFKEFKQLESTPKM-PKLDAFIAPGTVPAGVKLRDVPMEAKLTADGTPVEEGLSWYVFS 86

Query: 63  SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILN 122
            I+     L       GG  +F L PGDY ++ SFG  GV KK+TV ++ +  KQV +L+
Sbjct: 87  PIAGTDGKLPLIASAKGGPAAFQLAPGDYFVNVSFGRAGVTKKLTVPAEGEVDKQVMVLD 146

Query: 123 AGGIRLYSIYKPGSPIVDDELTFSIYSN---PNHKALLITDKVRSGTLVRLGTNNYQITS 179
           AGG+ L ++    + I  D+L+FSIYS+    + +  L+   V   T+VRL    Y I S
Sbjct: 147 AGGLLLNAVSGADARIRPDQLSFSIYSSEVRDDGERGLVVADVSPNTVVRLNAGTYHIVS 206

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
            YG  NA++   ++VE GK+ + TIQ+RAA+ITFKLVS+ GGEA+ADTAWSILTA+GD+V
Sbjct: 207 EYGSVNAVIRADIQVEAGKLTEATIQHRAAQITFKLVSDTGGEAIADTAWSILTAAGDSV 266

Query: 240 GESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
           GES +A P+MVL+EG Y+ +ARNK++ Y R+F+V+ G++T VEVLM+ ++      
Sbjct: 267 GESVSAFPTMVLAEGGYSAVARNKDKIYQRDFTVVAGRNTDVEVLMKDQQPQPPVG 322


>gi|306841797|ref|ZP_07474482.1| Hypothetical protein BIBO2_1579 [Brucella sp. BO2]
 gi|306288127|gb|EFM59517.1| Hypothetical protein BIBO2_1579 [Brucella sp. BO2]
          Length = 352

 Score =  218 bits (554), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 106/273 (38%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 73  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 132

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 133 SKGGSTSFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 190

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NA++   ++VE
Sbjct: 191 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAVIRADIRVE 250

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 251 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 310

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 311 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 343



 Score = 50.7 bits (119), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 158 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 215

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    V +  +  +     +  + +        + +   
Sbjct: 216 DVKPNKIIRLNSGTYHVVSNYGTANAVIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 275

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 276 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 330

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 331 GKNEDVEV 338


>gi|256061155|ref|ZP_05451309.1| hypothetical protein Bneo5_12447 [Brucella neotomae 5K33]
          Length = 336

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 157/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 57  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 116

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 117 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 174

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 175 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 234

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 235 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 294

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F+V +GK+  VEVL    
Sbjct: 295 YVAVAKNKDRIYQRDFTVESGKNEDVEVLANSD 327



 Score = 51.1 bits (120), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 25/188 (13%), Positives = 58/188 (30%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 142 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 199

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 200 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 259

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I      VE 
Sbjct: 260 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFTVES 314

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 315 GKNEDVEV 322


>gi|209549438|ref|YP_002281355.1| hypothetical protein Rleg2_1844 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535194|gb|ACI55129.1| conserved hypothetical protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 366

 Score =  218 bits (554), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 122/292 (41%), Positives = 187/292 (64%), Gaps = 5/292 (1%)

Query: 7   SYAKAENMHTTSTL--LNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSI 64
           ++ + + + +TS +  L+  I+ G     V  + +  EA+LT + T ++ G+SW++F  I
Sbjct: 29  AFKEFKQLESTSKMPKLDAFIAPGTAPEGVKLRDVPMEAKLTADGTPVEEGLSWYVFSPI 88

Query: 65  SNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAG 124
           +     L       GG  +F L PGDY ++ SFG  GV KK+TV +     KQV +L+AG
Sbjct: 89  AGTDGKLPLIASAKGGPAAFQLAPGDYFVNVSFGRAGVTKKLTVPADGAVDKQVMVLDAG 148

Query: 125 GIRLYSIYKPGSPIVDDELTFSIYSNP---NHKALLITDKVRSGTLVRLGTNNYQITSHY 181
           G+ L ++    + I  D+L+FSIYS+    + +  L+   V   T+VRL    Y I S Y
Sbjct: 149 GLLLNAVSGTDARIRPDQLSFSIYSSEVREDGERGLVVADVSPNTVVRLNAGTYHIVSEY 208

Query: 182 GKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGE 241
           G  NA++   ++VE GK+ + TIQ+RAA++TFKLVS+ GGEA+ADTAWSILTA+GD+VGE
Sbjct: 209 GSVNAVIRADIQVEAGKLTEATIQHRAAQVTFKLVSDAGGEAIADTAWSILTAAGDSVGE 268

Query: 242 SANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKN 293
           S +A P+MVL+EG Y+ +ARNK++ Y R+F+V+ G++T VEVLM+ ++    
Sbjct: 269 SVSAFPTMVLAEGGYSAVARNKDKIYQRDFTVVAGRNTDVEVLMKDQQPQPP 320


>gi|161619020|ref|YP_001592907.1| hypothetical protein BCAN_A1085 [Brucella canis ATCC 23365]
 gi|260566394|ref|ZP_05836864.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|161335831|gb|ABX62136.1| Hypothetical protein BCAN_A1085 [Brucella canis ATCC 23365]
 gi|260155912|gb|EEW90992.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 336

 Score =  217 bits (553), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 57  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 116

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 117 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 174

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 175 KIKDDLLRFSIYADEKNSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 234

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 235 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 294

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 295 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 327



 Score = 50.7 bits (119), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 142 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEKNSD--RSLIVP 199

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 200 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 259

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 260 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 314

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 315 GKNEDVEV 322


>gi|189024228|ref|YP_001934996.1| hypothetical protein BAbS19_I10130 [Brucella abortus S19]
 gi|225852572|ref|YP_002732805.1| hypothetical protein BMEA_A1111 [Brucella melitensis ATCC 23457]
 gi|254689294|ref|ZP_05152548.1| hypothetical protein Babob68_03806 [Brucella abortus bv. 6 str.
           870]
 gi|254693778|ref|ZP_05155606.1| hypothetical protein Babob3T_03799 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697430|ref|ZP_05159258.1| hypothetical protein Babob28_06935 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701817|ref|ZP_05163645.1| hypothetical protein Bsuib55_13298 [Brucella suis bv. 5 str. 513]
 gi|254706743|ref|ZP_05168571.1| hypothetical protein BpinM_07071 [Brucella pinnipedialis
           M163/99/10]
 gi|254710150|ref|ZP_05171961.1| hypothetical protein BpinB_07741 [Brucella pinnipedialis B2/94]
 gi|254714149|ref|ZP_05175960.1| hypothetical protein BcetM6_12510 [Brucella ceti M644/93/1]
 gi|254716793|ref|ZP_05178604.1| hypothetical protein BcetM_10275 [Brucella ceti M13/05/1]
 gi|256031645|ref|ZP_05445259.1| hypothetical protein BpinM2_13518 [Brucella pinnipedialis
           M292/94/1]
 gi|256044730|ref|ZP_05447634.1| hypothetical protein Bmelb1R_09558 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256159789|ref|ZP_05457532.1| hypothetical protein BcetM4_12493 [Brucella ceti M490/95/1]
 gi|256255047|ref|ZP_05460583.1| hypothetical protein BcetB_12290 [Brucella ceti B1/94]
 gi|256257544|ref|ZP_05463080.1| hypothetical protein Babob9C_09393 [Brucella abortus bv. 9 str.
           C68]
 gi|256263937|ref|ZP_05466469.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260168775|ref|ZP_05755586.1| hypothetical protein BruF5_10483 [Brucella sp. F5/99]
 gi|260545264|ref|ZP_05821005.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260564072|ref|ZP_05834558.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|261758256|ref|ZP_06001965.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|297248386|ref|ZP_06932104.1| hypothetical protein BAYG_01339 [Brucella abortus bv. 5 str. B3196]
 gi|189019800|gb|ACD72522.1| hypothetical protein BAbS19_I10130 [Brucella abortus S19]
 gi|225640937|gb|ACO00851.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|260096671|gb|EEW80546.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260154088|gb|EEW89180.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|261738240|gb|EEY26236.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|263094081|gb|EEZ18003.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|297175555|gb|EFH34902.1| hypothetical protein BAYG_01339 [Brucella abortus bv. 5 str. B3196]
          Length = 336

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 57  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 116

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 117 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 174

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 175 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 234

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 235 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 294

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 295 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 327



 Score = 49.9 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 142 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 199

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 200 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 259

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 260 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 314

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 315 GKNEDVEV 322


>gi|150396276|ref|YP_001326743.1| hypothetical protein Smed_1055 [Sinorhizobium medicae WSM419]
 gi|150027791|gb|ABR59908.1| conserved hypothetical protein [Sinorhizobium medicae WSM419]
          Length = 349

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 119/294 (40%), Positives = 172/294 (58%), Gaps = 15/294 (5%)

Query: 2   TISFSSYAKAENMHTT------STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSG 55
           T +F S+      H        S L+ + I  G+ K V        EA LT+    + SG
Sbjct: 49  TDAFKSFPSVSGTHKMPKLTGFSPLITDPIQGGELKDVK------LEALLTDQGEPVQSG 102

Query: 56  VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQ 115
           ++W +F  I      L       GG  +F+L PG+Y ++ +FG  G  +KI V       
Sbjct: 103 LTWRVFSPIPGSDGKLPLLATSEGGSTAFNLVPGEYFVNVAFGRAGATRKIRVPEDGPAD 162

Query: 116 KQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNP---NHKALLITDKVRSGTLVRLGT 172
           KQV +L+AGG+ L ++      I  +EL+FSI+S+    + +  L+   V+ GTLVRL  
Sbjct: 163 KQVLVLDAGGVMLNAVSGSDVRIPPNELSFSIFSSDVKEDGERGLVVADVKPGTLVRLNA 222

Query: 173 NNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSIL 232
             Y + S+YG  NA++   +++E GK+ + TIQ+RAAK+T KLVSE GGEA+ADTAWSIL
Sbjct: 223 GTYHVVSNYGAVNAVIRADIQIEAGKLTEATIQHRAAKLTLKLVSEAGGEAIADTAWSIL 282

Query: 233 TASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMR 286
           T+SGD V ES  A P++VL+EG YT +ARNK++ Y R+F+V  G +T VEVL+ 
Sbjct: 283 TSSGDVVSESVGAFPTLVLAEGGYTAVARNKDKIYQRDFAVQAGVNTDVEVLLD 336


>gi|254704360|ref|ZP_05166188.1| hypothetical protein Bsuib36_10616 [Brucella suis bv. 3 str. 686]
          Length = 336

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 57  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 116

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 117 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 174

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 175 KIKDDLLRFSIYADEKNSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 234

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 235 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 294

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 295 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 327



 Score = 50.7 bits (119), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 142 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEKNSD--RSLIVP 199

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 200 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 259

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 260 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 314

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 315 GKNEDVEV 322


>gi|254719142|ref|ZP_05180953.1| hypothetical protein Bru83_06315 [Brucella sp. 83/13]
 gi|306838427|ref|ZP_07471272.1| Hypothetical protein BROD_1242 [Brucella sp. NF 2653]
 gi|306406567|gb|EFM62801.1| Hypothetical protein BROD_1242 [Brucella sp. NF 2653]
          Length = 336

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 57  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 116

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + +V IL+AGG++L ++     
Sbjct: 117 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEVMILDAGGMKLSAVLPGNG 174

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NA++   ++VE
Sbjct: 175 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAVIRADIRVE 234

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 235 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 294

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 295 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 327



 Score = 49.9 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 142 ATKRITLSNSARHEVMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 199

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    V +  +  +     +  + +        + +   
Sbjct: 200 DVKPNKIIRLNSGTYHVVSNYGTANAVIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 259

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 260 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 314

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 315 GKNEDVEV 322


>gi|306843942|ref|ZP_07476537.1| Hypothetical protein BIBO1_0605 [Brucella sp. BO1]
 gi|306275697|gb|EFM57421.1| Hypothetical protein BIBO1_0605 [Brucella sp. BO1]
          Length = 336

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 57  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 116

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + +V IL+AGG++L ++     
Sbjct: 117 SKGGSTSFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEVMILDAGGMKLSAVLPGNG 174

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NA++   ++VE
Sbjct: 175 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAVIRADIRVE 234

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 235 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 294

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 295 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 327



 Score = 49.9 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 142 ATKRITLSNSARHEVMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 199

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    V +  +  +     +  + +        + +   
Sbjct: 200 DVKPNKIIRLNSGTYHVVSNYGTANAVIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 259

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 260 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 314

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 315 GKNEDVEV 322


>gi|326409091|gb|ADZ66156.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538796|gb|ADZ87011.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 342

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 63  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 122

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 123 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 180

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 181 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 240

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 241 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 300

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 301 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 333



 Score = 49.9 bits (117), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 148 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 205

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 206 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 265

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 266 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 320

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 321 GKNEDVEV 328


>gi|163868517|ref|YP_001609726.1| hypothetical protein Btr_1369 [Bartonella tribocorum CIP 105476]
 gi|161018173|emb|CAK01731.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 327

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 96/283 (33%), Positives = 154/283 (54%), Gaps = 4/283 (1%)

Query: 12  ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
           +     S        + + + +    ++   ARLT +   I+ G+ W ++  I    N L
Sbjct: 41  DQQQGQSRSFIIKSKEQEKENLASQAQLILNARLTNSRQDIEKGLVWRVYAPILGIDNKL 100

Query: 72  STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSI 131
                  GG   FDL PG YL+  SFGH+  V+ + + + +   K  F   AGG+ L + 
Sbjct: 101 PLVATYKGGSARFDLEPGSYLVHVSFGHMSAVRHVRLENGQSLVK-TFHFEAGGLILNAT 159

Query: 132 YKPGSPIVDDELTFSIYSN--PNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVS 189
              GS I + EL F+IY +   N    +I   V+  ++VRL    Y + SHYG  NA   
Sbjct: 160 LSNGS-INEKELRFTIYEDEKENDDTGVILSNVKPQSVVRLKAGRYHVASHYGSINATAR 218

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSM 249
           + ++VE GK+ +VT++++AA+I  KLV + GGEA+ADT+WS+   SGD V E+  A  S+
Sbjct: 219 SDIQVEAGKMTEVTLEHQAAQIVLKLVRQEGGEALADTSWSLANDSGDIVYETVGAYVSL 278

Query: 250 VLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDK 292
           VL+EG+Y  IA+NK++ Y + FSV++G    + V+  ++ M +
Sbjct: 279 VLAEGEYIAIAKNKDKIYQKVFSVVSGHDEDISVVANEQNMQR 321


>gi|163843336|ref|YP_001627740.1| hypothetical protein BSUIS_A1114 [Brucella suis ATCC 23445]
 gi|163674059|gb|ABY38170.1| Hypothetical protein BSUIS_A1114 [Brucella suis ATCC 23445]
          Length = 336

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 106/273 (38%), Positives = 155/273 (56%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 57  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 116

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 117 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 174

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I D  L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 175 KINDYLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 234

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 235 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 294

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 295 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 327



 Score = 47.2 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 142 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKINDYLLRFSIYADEENSD--RSLIVP 199

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 200 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 259

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 260 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 314

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 315 GKNEDVEV 322


>gi|62289986|ref|YP_221779.1| hypothetical protein BruAb1_1075 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699914|ref|YP_414488.1| hypothetical protein BAB1_1092 [Brucella melitensis biovar Abortus
           2308]
 gi|256113620|ref|ZP_05454440.1| hypothetical protein Bmelb3E_12727 [Brucella melitensis bv. 3 str.
           Ether]
 gi|62196118|gb|AAX74418.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616015|emb|CAJ11048.1| conserved hypothetical protein [Brucella melitensis biovar Abortus
           2308]
          Length = 330

 Score =  216 bits (550), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 51  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 110

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 111 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 168

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 169 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 228

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 229 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 288

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 289 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 321



 Score = 49.9 bits (117), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 136 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 193

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 194 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 253

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 254 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 308

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 309 GKNEDVEV 316


>gi|23501948|ref|NP_698075.1| hypothetical protein BR1070 [Brucella suis 1330]
 gi|23347894|gb|AAN29990.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 330

 Score =  216 bits (549), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 51  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 110

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 111 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 168

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 169 KIKDDLLRFSIYADEKNSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 228

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 229 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 288

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 289 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 321



 Score = 50.3 bits (118), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 136 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEKNSD--RSLIVP 193

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 194 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 253

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 254 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 308

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 309 GKNEDVEV 316


>gi|256369495|ref|YP_003107003.1| hypothetical protein BMI_I1075 [Brucella microti CCM 4915]
 gi|255999655|gb|ACU48054.1| hypothetical protein BMI_I1075 [Brucella microti CCM 4915]
          Length = 330

 Score =  216 bits (549), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 108/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    K   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 51  PTINPYASPASPKNNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 110

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 111 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 168

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 169 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 228

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 229 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 288

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 289 YVAVAKNKDRIYQRDFKVKSGKNEDVEVLANSD 321



 Score = 49.2 bits (115), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/186 (11%), Positives = 56/186 (30%), Gaps = 5/186 (2%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 136 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 193

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 194 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 253

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +            VK   
Sbjct: 254 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKDRIYQRDFKVKSGK 310

Query: 197 GKIIDV 202
            + ++V
Sbjct: 311 NEDVEV 316


>gi|254730328|ref|ZP_05188906.1| hypothetical protein Babob42_03844 [Brucella abortus bv. 4 str.
           292]
          Length = 336

 Score =  215 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 106/273 (38%), Positives = 155/273 (56%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F               
Sbjct: 57  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQSPLIAS 116

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 117 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 174

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 175 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 234

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 235 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 294

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 295 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 327



 Score = 49.9 bits (117), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 142 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 199

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 200 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 259

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 260 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 314

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 315 GKNEDVEV 322


>gi|261325161|ref|ZP_05964358.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301141|gb|EEY04638.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 321

 Score =  215 bits (547), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 157/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 42  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 101

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 102 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 159

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 160 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 219

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 220 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 279

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F+V +GK+  VEVL    
Sbjct: 280 YVAVAKNKDRIYQRDFTVESGKNEDVEVLANSD 312



 Score = 50.3 bits (118), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/186 (10%), Positives = 56/186 (30%), Gaps = 5/186 (2%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 127 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 184

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 185 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 244

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +            V+   
Sbjct: 245 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKDRIYQRDFTVESGK 301

Query: 197 GKIIDV 202
            + ++V
Sbjct: 302 NEDVEV 307


>gi|222086048|ref|YP_002544580.1| hypothetical protein Arad_2470 [Agrobacterium radiobacter K84]
 gi|221723496|gb|ACM26652.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 376

 Score =  215 bits (546), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 122/289 (42%), Positives = 175/289 (60%), Gaps = 5/289 (1%)

Query: 3   ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDA-QRITCEARLTENSTSIDSGVSWHIF 61
            +F  + + +        LN  ++ G     V   + ++ EA+L  +S     G+SW++F
Sbjct: 28  DAFQEFKQLDGSMKM-PKLNAFVAPGGENSPVRTLRDVSLEAKLAPDSGPQQQGLSWYVF 86

Query: 62  DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFIL 121
              +     L       GG  SF L PGDY ++ SFG  GV KK+TV     +QKQ  +L
Sbjct: 87  SPFAGADGKLPLVASSKGGSASFHLLPGDYFVNVSFGRAGVTKKLTVPESGMSQKQTMVL 146

Query: 122 NAGGIRLYSIYKPGSPIVDDELTFSIYSNP---NHKALLITDKVRSGTLVRLGTNNYQIT 178
           +AGG+ L ++      I   EL+FSIY+     + +  L+   V+  TLV L T  Y I 
Sbjct: 147 DAGGMVLNAVSGSDVRIPPAELSFSIYAGDAKEDGERGLVMSDVKPNTLVGLSTGTYHIV 206

Query: 179 SHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT 238
           S YG  NA++   ++VE GK+ + TIQ+RAAKITFKLVS+ GGEA+ADTAWSILT++GD 
Sbjct: 207 SEYGAVNAVIRADIQVEAGKVTEATIQHRAAKITFKLVSDAGGEAIADTAWSILTSAGDI 266

Query: 239 VGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQ 287
           VGES +A P MVL+EG YT +ARNK++ Y R+F+V+ G++T VEVLM++
Sbjct: 267 VGESLSAFPVMVLAEGQYTAVARNKDKIYQRDFTVVAGRNTDVEVLMKE 315


>gi|17987199|ref|NP_539833.1| hypothetical protein BMEI0916 [Brucella melitensis bv. 1 str. 16M]
 gi|260754806|ref|ZP_05867154.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260761851|ref|ZP_05874194.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883824|ref|ZP_05895438.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214057|ref|ZP_05928338.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261218591|ref|ZP_05932872.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261222238|ref|ZP_05936519.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261314207|ref|ZP_05953404.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261317704|ref|ZP_05956901.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321912|ref|ZP_05961109.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261752374|ref|ZP_05996083.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|265988737|ref|ZP_06101294.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991151|ref|ZP_06103708.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994987|ref|ZP_06107544.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998202|ref|ZP_06110759.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|17982869|gb|AAL52097.1| hypothetical protein BMEI0916 [Brucella melitensis bv. 1 str. 16M]
 gi|260672283|gb|EEX59104.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674914|gb|EEX61735.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873352|gb|EEX80421.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260915664|gb|EEX82525.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260920822|gb|EEX87475.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260923680|gb|EEX90248.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294602|gb|EEX98098.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261296927|gb|EEY00424.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261303233|gb|EEY06730.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261742127|gb|EEY30053.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|262552670|gb|EEZ08660.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262766100|gb|EEZ11889.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001935|gb|EEZ14510.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|264660934|gb|EEZ31195.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 321

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 42  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 101

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 102 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 159

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 160 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 219

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 220 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 279

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 280 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 312



 Score = 49.2 bits (115), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 127 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 184

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 185 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 244

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 245 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 299

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 300 GKNEDVEV 307


>gi|261755032|ref|ZP_05998741.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261744785|gb|EEY32711.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 321

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 42  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 101

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 102 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 159

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 160 KIKDDLLRFSIYADEKNSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 219

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 220 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 279

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 280 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 312



 Score = 49.9 bits (117), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 127 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEKNSD--RSLIVP 184

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 185 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 244

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 245 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 299

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 300 GKNEDVEV 307


>gi|265984136|ref|ZP_06096871.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264662728|gb|EEZ32989.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 321

 Score =  214 bits (544), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 107/273 (39%), Positives = 156/273 (57%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F         L     
Sbjct: 42  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQLPLIAS 101

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + +V IL+AGG++L ++     
Sbjct: 102 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEVMILDAGGMKLSAVLPGNG 159

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NA++   ++VE
Sbjct: 160 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAVIRADIRVE 219

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 220 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 279

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 280 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 312



 Score = 49.2 bits (115), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 27/188 (14%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 127 ATKRITLSNSARHEVMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 184

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    V +  +  +     +  + +        + +   
Sbjct: 185 DVKPNKIIRLNSGTYHVVSNYGTANAVIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 244

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 245 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 299

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 300 GKNEDVEV 307


>gi|260758028|ref|ZP_05870376.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260668346|gb|EEX55286.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
          Length = 321

 Score =  212 bits (540), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 106/273 (38%), Positives = 155/273 (56%), Gaps = 5/273 (1%)

Query: 19  TLLNNNISKGKGKR--VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
             +N   S    +   +V    +  +A+LT+    I +G+ W +F               
Sbjct: 42  PTINPYASPASPENNPLVRTYELDLKAKLTQEGGDIPAGLVWRVFSPDVGPDGQSPLIAS 101

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
             GG  SF+L  G YL+  ++G  G  K+IT+S+    + ++ IL+AGG++L ++     
Sbjct: 102 SKGGSASFNLPEGSYLVHVAYGRAGATKRITLSNSA--RHEIMILDAGGMKLSAVLPGNG 159

Query: 137 PIVDDELTFSIY-SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
            I DD L FSIY    N    LI   V+   ++RL +  Y + S+YG  NAI+   ++VE
Sbjct: 160 KIKDDLLRFSIYADEENSDRSLIVPDVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVE 219

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+Q+RAA++T KLV + GGEA+ADT+WSIL ASGD V ESA A  SMVL EGD
Sbjct: 220 AGKLTEATVQHRAAEVTLKLVRDHGGEALADTSWSILNASGDVVRESAGAYSSMVLIEGD 279

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMRQK 288
           Y  +A+NK+R Y R+F V +GK+  VEVL    
Sbjct: 280 YVAVAKNKDRIYQRDFKVESGKNEDVEVLANSD 312



 Score = 49.2 bits (115), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 26/188 (13%), Positives = 59/188 (31%), Gaps = 7/188 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +  + S      ++DA  +   A L  N    D  + + I+    N     S    
Sbjct: 127 ATKRITLSNSARHEIMILDAGGMKLSAVLPGNGKIKDDLLRFSIYADEENSD--RSLIVP 184

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G    + +  +  +     +  + +        + +   
Sbjct: 185 DVKPNKIIRLNSGTYHVVSNYGTANAIIRADIRVEAGKLTEATVQHRAAEVTLKLVRDHG 244

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++SI +              + + + L   +Y   +       I     KVE 
Sbjct: 245 GEALADTSWSILNASGDVVRE---SAGAYSSMVLIEGDYVAVAKNKD--RIYQRDFKVES 299

Query: 197 GKIIDVTI 204
           GK  DV +
Sbjct: 300 GKNEDVEV 307


>gi|15965179|ref|NP_385532.1| hypothetical protein SMc01011 [Sinorhizobium meliloti 1021]
 gi|307309193|ref|ZP_07588864.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
 gi|307321523|ref|ZP_07600918.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|15074359|emb|CAC46005.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306892830|gb|EFN23621.1| conserved hypothetical protein [Sinorhizobium meliloti AK83]
 gi|306900339|gb|EFN30955.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
          Length = 331

 Score =  212 bits (540), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 112/288 (38%), Positives = 169/288 (58%), Gaps = 3/288 (1%)

Query: 2   TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
           T +F S+      H    L   +       +    + +  EA LT+    + SG++W +F
Sbjct: 31  TDAFKSFPSISGTHKMPKLTGFSPLITDPTQGGQLKDVELEALLTDKGKPVQSGLTWRVF 90

Query: 62  DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFIL 121
             I      L       GG  +F+L PG+Y ++ +FG  G  +KI V       KQV +L
Sbjct: 91  SPIPGSDGKLPLLATSEGGSTAFNLVPGEYFVNVAFGRAGATRKIRVPEDGPLDKQVLVL 150

Query: 122 NAGGIRLYSIYKPGSPIVDDELTFSIYSNP---NHKALLITDKVRSGTLVRLGTNNYQIT 178
           +AGG+ L ++      I  +EL+FSI+S+    + +  L+   V+ GT+V+L  + Y + 
Sbjct: 151 DAGGVMLNAVSGSDVRIPPNELSFSIFSSDVKEDGERGLVVADVKPGTVVQLNADTYHVV 210

Query: 179 SHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT 238
           S+YG  NA++   +++E GK+ + TIQ+RAAK+T KLVSE GGEA+ADTAWSILT+SGD 
Sbjct: 211 SNYGSVNAVIRADIQIEAGKLTEATIQHRAAKLTLKLVSEAGGEAIADTAWSILTSSGDV 270

Query: 239 VGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMR 286
           V ES  A P++VL+EG YT +ARNK++ Y R+F+V  G +T VEVL+ 
Sbjct: 271 VSESVGAFPTLVLAEGSYTAVARNKDKIYQRDFAVKAGVNTDVEVLLN 318


>gi|240850749|ref|YP_002972149.1| hypothetical protein Bgr_12180 [Bartonella grahamii as4aup]
 gi|240267872|gb|ACS51460.1| hypothetical protein Bgr_12180 [Bartonella grahamii as4aup]
          Length = 329

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 98/292 (33%), Positives = 157/292 (53%), Gaps = 5/292 (1%)

Query: 4   SFSSY-AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
           +FS      +     S        + + + V    ++   ARLT +   I+ G+ W ++ 
Sbjct: 34  AFSEEGEGKDQQQGQSRSFIVKSQEQEKENVASQTQLILNARLTNSHPDIEKGLVWRVYA 93

Query: 63  SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILN 122
            I    N L       GG   FDL PG YL+  SFGH+  V+ I + + +   K  F L 
Sbjct: 94  PILGIDNKLPLVATYKGGSARFDLEPGSYLVHVSFGHMSAVRHIRLKNGQSLVKN-FNLE 152

Query: 123 AGGIRLYSIYKPGSPIVDDELTFSIYSN--PNHKALLITDKVRSGTLVRLGTNNYQITSH 180
           AGG+ L +    G  + + EL F+IY +   N    +I   V+  ++VRL    Y + SH
Sbjct: 153 AGGVILNATLLNGV-MNEKELRFTIYEDEKENDDTGVILSNVKPQSVVRLKAGRYHVASH 211

Query: 181 YGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVG 240
           YG  NA   + ++V+ GK+ +VT++++AA+I  KLV + GGEA+ADT+WS+   SGD V 
Sbjct: 212 YGSINATARSDIQVDAGKMTEVTLEHQAAQIVLKLVRQEGGEALADTSWSLANDSGDIVY 271

Query: 241 ESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDK 292
           E+  A  S+VL+EG+Y  IA+NK++ Y + FSV++G    + V+  ++ M +
Sbjct: 272 ETVGAYVSLVLAEGEYIAIAKNKDKIYQKVFSVVSGHDEDISVVANEQNMQR 323


>gi|13471044|ref|NP_102613.1| hypothetical protein mlr0912 [Mesorhizobium loti MAFF303099]
 gi|14021788|dbj|BAB48399.1| mlr0912 [Mesorhizobium loti MAFF303099]
          Length = 320

 Score =  210 bits (534), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 102/255 (40%), Positives = 151/255 (59%), Gaps = 6/255 (2%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              IT  A+LT+  T I  G+ W +F  +      L       GG   F L PG YL+ A
Sbjct: 58  GGAITLSAQLTDKGTDITRGLVWRVFKPVP-VNGKLPMVASAHGGSAVFQLEPGSYLVHA 116

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNP---N 152
           S+G  G  K+ITV  + K  ++  +L+AGG++L ++   G  I   +L FSIY      N
Sbjct: 117 SYGRAGATKRITVGKEAK--RESLVLDAGGLKLDAVLSGGVRIPPKKLRFSIYEGTAEAN 174

Query: 153 HKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKIT 212
               LI   V   ++VRL    Y + S YG  NA++ + ++VE GK+ + T+++ AA+IT
Sbjct: 175 GDRALIIPDVEPNSVVRLNAGIYHVVSTYGAVNAVIRSDIRVEAGKLTEATVEHHAAEIT 234

Query: 213 FKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFS 272
            KLV E GGEA+ADT+WS+L  SGD + ES  A  SMVL+EGDYT+IA+N++R Y ++F+
Sbjct: 235 MKLVREAGGEAIADTSWSLLNESGDPIKESVGAFASMVLAEGDYTIIAKNRDRIYQKDFA 294

Query: 273 VLTGKSTIVEVLMRQ 287
           V+ G++  +EVL  +
Sbjct: 295 VVAGQNQEIEVLATE 309



 Score = 54.9 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/186 (10%), Positives = 57/186 (30%), Gaps = 3/186 (1%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +       +   V+DA  +  +A L+         + + I++  +      +    
Sbjct: 123 ATKRITVGKEAKRESLVLDAGGLKLDAVLSGGVRIPPKKLRFSIYEGTAEANGDRALIIP 182

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G V  V +  +  +     +  + +        + +   
Sbjct: 183 DVEPNSVVRLNAGIYHVVSTYGAVNAVIRSDIRVEAGKLTEATVEHHAAEITMKLVREAG 242

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++S+ +            V +   + L   +Y I +            V    
Sbjct: 243 GEAIADTSWSLLNESGDPIKE---SVGAFASMVLAEGDYTIIAKNRDRIYQKDFAVVAGQ 299

Query: 197 GKIIDV 202
            + I+V
Sbjct: 300 NQEIEV 305


>gi|227821827|ref|YP_002825797.1| hypothetical protein NGR_c12630 [Sinorhizobium fredii NGR234]
 gi|227340826|gb|ACP25044.1| hypothetical protein NGR_c12630 [Sinorhizobium fredii NGR234]
          Length = 333

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 113/288 (39%), Positives = 168/288 (58%), Gaps = 3/288 (1%)

Query: 2   TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
           T +F S+           L + N       +  + + +  EA LT +   ++SG++W +F
Sbjct: 31  TDAFKSFPSISGSRKMPKLTSFNPLVSDPTQNGELKDVKLEALLTADGQPVESGLTWRVF 90

Query: 62  DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFIL 121
             I      L       GG  +F+L PG+Y ++ +FG     +KI V  +    KQ+ +L
Sbjct: 91  SPIPGGDGKLPLLATSEGGSTAFNLVPGEYFVNVAFGRAAATRKIRVPEQGALDKQILVL 150

Query: 122 NAGGIRLYSIYKPGSPIVDDELTFSIYSNP---NHKALLITDKVRSGTLVRLGTNNYQIT 178
           +AGG+ L ++      I   EL+FSI+S+    + +  LI   V+  T+VRLG   Y + 
Sbjct: 151 DAGGVMLNAVSGSDVRIPPTELSFSIFSSDEKEDGERALIVADVKPSTVVRLGAGTYHVV 210

Query: 179 SHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT 238
           S YG  NA++   ++VE GK+ + TIQ+RAAK+T KLVSE GGEA+ADTAWSILT+SGD 
Sbjct: 211 SDYGSVNAVIRADIQVEAGKLTEATIQHRAAKLTLKLVSEAGGEAIADTAWSILTSSGDV 270

Query: 239 VGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMR 286
           V ES  A P++VL+EG YT +ARNK++ Y R+F+V  G +T VEVL+ 
Sbjct: 271 VSESVGAFPTLVLAEGSYTAVARNKDKIYQRDFAVKAGVNTDVEVLLN 318


>gi|15889048|ref|NP_354729.1| hypothetical protein Atu1745 [Agrobacterium tumefaciens str. C58]
 gi|15156845|gb|AAK87514.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 326

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 111/296 (37%), Positives = 162/296 (54%), Gaps = 3/296 (1%)

Query: 3   ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
            +F  + +         L               A+ I  EA+LT    ++  G+SW +F 
Sbjct: 28  DAFKDFKQLGGTPKMPKLNAFTAPSAPNAPTSTARDIAMEAKLTSEGEAVKEGLSWRVFS 87

Query: 63  SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILN 122
            I      L       GG   F L PG+Y ++ +FG  GV KK+ V +    QKQV IL+
Sbjct: 88  PIPGTDGKLPMLASSEGGSAQFHLVPGEYFVNVAFGRAGVTKKLNVPASGNVQKQVLILD 147

Query: 123 AGGIRLYSIYKPGSPIVDDELTFSIYSNP---NHKALLITDKVRSGTLVRLGTNNYQITS 179
           AGG  L +I      I  ++L FS+YS+    + +  L+   ++  T+VRL    Y + S
Sbjct: 148 AGGFVLNAIAGSDKQISGNQLKFSVYSSDARPDGERGLVMADIKPNTIVRLNAGTYHVVS 207

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
            YG  NA+V   ++VE GK+ + T+Q++AA+IT KLVSE GGEA+ADTAWS+L   GD V
Sbjct: 208 EYGNVNAVVRADIQVEAGKLTEATLQHQAAQITLKLVSEQGGEAIADTAWSVLNGGGDVV 267

Query: 240 GESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            ES +A  +MVL+EG+YT IARNK++ Y R F V +G+ + VEVLM+ +  +    
Sbjct: 268 NESVSAFSTMVLAEGEYTAIARNKDKVYQRNFKVTSGRDSDVEVLMKDQAPEDMTG 323


>gi|319407168|emb|CBI80807.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 300

 Score =  204 bits (518), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 104/294 (35%), Positives = 167/294 (56%), Gaps = 5/294 (1%)

Query: 1   MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHI 60
           + ++FS   + +       L  + +     ++     ++   A+LT  S +I SG+ W +
Sbjct: 4   INVAFSEEGEFQRNQG-EELATSIMDSHDHEKDNSYSQLVLNAQLTNKSENIMSGLVWRV 62

Query: 61  FDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFI 120
           +  I    N L       GG   FDL PG YL+  SFGH  VV+++++ +++   K  F 
Sbjct: 63  YAPILGSDNKLPLVATYEGGSARFDLKPGSYLVHVSFGHASVVQRVSLENRQHLVKN-FN 121

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSN--PNHKALLITDKVRSGTLVRLGTNNYQIT 178
           L+AGGI L SI      I + EL F+IY +   N    +I   V+  ++VRL   +Y++ 
Sbjct: 122 LDAGGIILNSIL-FNGTINEKELRFTIYEDERENDDTGVILANVKPQSMVRLKAGHYRVV 180

Query: 179 SHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT 238
           SHYG  NAI+ + ++VE GKI +VT++++AA+I  KLV + GGEA+ADT+WSI   SGD 
Sbjct: 181 SHYGSVNAIIRSDIQVEAGKITEVTLEHQAAQIILKLVRQEGGEALADTSWSITNDSGDI 240

Query: 239 VGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDK 292
           + E+  A   +VL EGDY  IA+NK++ Y + FSV++G+   V V+   + + +
Sbjct: 241 IYETVGAYVLLVLVEGDYIAIAKNKDKIYRKVFSVVSGQDKDVNVIANSQNIQQ 294


>gi|325293127|ref|YP_004278991.1| hypothetical protein AGROH133_06703 [Agrobacterium sp. H13-3]
 gi|325060980|gb|ADY64671.1| hypothetical protein AGROH133_06703 [Agrobacterium sp. H13-3]
          Length = 326

 Score =  204 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 111/296 (37%), Positives = 161/296 (54%), Gaps = 3/296 (1%)

Query: 3   ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
            +F  + +         L               A+ I  EA+LT    ++  G+SW +F 
Sbjct: 28  DAFKDFKQLGGTPKMPKLNAFTAPTAPNAPASTARDIDMEAKLTSEGEAVKEGLSWRVFS 87

Query: 63  SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILN 122
            I      L       GG   F L PG+Y ++ +FG  GV KK+ V S    QKQV IL+
Sbjct: 88  PIPGADGKLPMLASSEGGSAQFHLVPGEYFVNVAFGRAGVTKKLNVPSSGNVQKQVLILD 147

Query: 123 AGGIRLYSIYKPGSPIVDDELTFSIYSNP---NHKALLITDKVRSGTLVRLGTNNYQITS 179
           AGG  L +I      I  ++L FS+YS+    + +  L+   ++  T+VRL    Y + S
Sbjct: 148 AGGFVLNAIAGSDKQISANQLKFSVYSSDARPDGERGLVMADIKPNTVVRLNAGTYHVVS 207

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
            YG  NA+V   ++VE GK+ + T+Q++AA+IT KLVSE GGEA+ADTAWS+L   GD V
Sbjct: 208 EYGNVNAVVRADIQVEAGKLTEATLQHQAAQITLKLVSEQGGEAIADTAWSVLNGGGDVV 267

Query: 240 GESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            ES +A  +MVL+EG+YT +ARNK++ Y R F V +G+   VEVLM+ +  +    
Sbjct: 268 NESVSAFSTMVLAEGEYTAMARNKDKVYQRNFKVTSGRDADVEVLMKDQAPEDMTG 323


>gi|319404150|emb|CBI77743.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 300

 Score =  203 bits (516), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 102/293 (34%), Positives = 167/293 (56%), Gaps = 5/293 (1%)

Query: 2   TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
            ++FS   + +       L+ + +     +      ++   A+LT  S +I SG+ W ++
Sbjct: 5   NVTFSEEGEFQRNQG-EELVTSIMDSHDHEEGDSYSQLILHAQLTNKSENIMSGLVWRVY 63

Query: 62  DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFIL 121
             I    N L       GG   FDL PG YL+  SFGH  VV+++++ ++++  K  F L
Sbjct: 64  APILGSDNKLPLVATYEGGSARFDLKPGSYLVHVSFGHASVVQRVSLENRQQLVKN-FNL 122

Query: 122 NAGGIRLYSIYKPGSPIVDDELTFSIYSN--PNHKALLITDKVRSGTLVRLGTNNYQITS 179
           +AGGI L S       I + EL F+IY +   N    +I   V+  ++VRL   +Y++ S
Sbjct: 123 DAGGIILNSTL-FNGIINEKELRFTIYEDERENDDTGVILANVKPQSMVRLKAGHYRVVS 181

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
           HYG  NAI+ + ++VE GKI +VT++++AA+I  KLV + GGEA+ADT+WSI   SGD +
Sbjct: 182 HYGSVNAIIRSDIQVEAGKITEVTLEHQAAQIILKLVRQEGGEALADTSWSITNDSGDII 241

Query: 240 GESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDK 292
            E+  A   +VL EGDY  IA+NK++ Y + FSV++G+   V+++   + + +
Sbjct: 242 YETVGAYVLLVLVEGDYIAIAKNKDKIYRKVFSVVSGQDKDVDIIANSQNVQQ 294


>gi|110633364|ref|YP_673572.1| hypothetical protein Meso_1010 [Mesorhizobium sp. BNC1]
 gi|110284348|gb|ABG62407.1| hypothetical protein Meso_1010 [Chelativorans sp. BNC1]
          Length = 316

 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 96/256 (37%), Positives = 153/256 (59%), Gaps = 6/256 (2%)

Query: 35  DAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLIS 94
            A ++   A+LT+++  I  G++W +F         L       GG  +F L PG YL+ 
Sbjct: 54  KASQVVLAAQLTKDAPEIPGGLTWRVFSPEPGPDGKLPLVATAKGGTSAFSLAPGSYLVH 113

Query: 95  ASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS---NP 151
           A++G  G  K+ITV+ + K++  V   +AGG++L ++      I + +L FSIY    + 
Sbjct: 114 AAYGRAGATKRITVAGEAKHESLVL--DAGGLKLDAVLPGDIRIPEKQLRFSIYEAEPDA 171

Query: 152 NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKI 211
             +  LI   VR   +VRL    Y + S+YG   A++ + ++VE G++ + T+++RAA++
Sbjct: 172 TGERPLIVPDVRPNAIVRLNAGTYHVVSNYGPI-AVIRSDIRVEAGQLTEATVEHRAAEM 230

Query: 212 TFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREF 271
           T KLV E GGEA+ADTAWSILT +G+ V ++  A  S+VL EGDYT++A+N+ER Y R+F
Sbjct: 231 TLKLVRETGGEAIADTAWSILTETGEIVLDTVGAYASIVLPEGDYTIVAKNRERIYQRDF 290

Query: 272 SVLTGKSTIVEVLMRQ 287
           +V  G+   VE+L   
Sbjct: 291 TVTPGQKQDVELLPED 306



 Score = 60.3 bits (144), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/187 (12%), Positives = 63/187 (33%), Gaps = 6/187 (3%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +           V+DA  +  +A L  +    +  + + I+++  +          
Sbjct: 121 ATKRITVAGEAKHESLVLDAGGLKLDAVLPGDIRIPEKQLRFSIYEAEPDATGERPLIVP 180

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVK-KITVSSKEKNQKQVFILNAGGIRLYSIYKPG 135
            +       L  G Y + +++G + V++  I V + +  +  V    A       + +  
Sbjct: 181 DVRPNAIVRLNAGTYHVVSNYGPIAVIRSDIRVEAGQLTEATVEHRAAE--MTLKLVRET 238

Query: 136 SPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
                 +  +SI +       ++ D V +   + L   +Y I +   +        V   
Sbjct: 239 GGEAIADTAWSILTETG---EIVLDTVGAYASIVLPEGDYTIVAKNRERIYQRDFTVTPG 295

Query: 196 PGKIIDV 202
             + +++
Sbjct: 296 QKQDVEL 302


>gi|319783885|ref|YP_004143361.1| hypothetical protein Mesci_4200 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169773|gb|ADV13311.1| hypothetical protein Mesci_4200 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 320

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 165/291 (56%), Gaps = 12/291 (4%)

Query: 6   SSYAKAENMHTTSTLLNNNIS-----KGKGKRVVDAQ-RITCEARLTENSTSIDSGVSWH 59
            S+A A+N+   S L    IS     KG+    +     IT  A+LT+  + I  G+ W 
Sbjct: 22  VSFAMAQNVDGVSDLKLPGISSYATPKGETSLALSGGGAITLSAQLTDKGSDITRGIVWR 81

Query: 60  IFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVF 119
           +F   +     L       GG   F L PG YL+ AS+G  G  K+ITV    K  ++  
Sbjct: 82  VFKPEA-VNGKLPMVASSHGGTAVFQLEPGSYLVHASYGRAGATKRITVGKDAK--RESL 138

Query: 120 ILNAGGIRLYSIYKPGSPIVDDELTFSIYSNP---NHKALLITDKVRSGTLVRLGTNNYQ 176
           +L+AGG++L ++   G  I   +L FSIY      N    LI   V   ++VRL    Y 
Sbjct: 139 VLDAGGLKLDAVLSGGVRIPPKKLRFSIYEGTAEANGDRALIIPDVEPNSVVRLNAGIYH 198

Query: 177 ITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASG 236
           + S YG  NA++ + ++VE GK+ + T+++ AA+IT KLV E GGEA+ADT+WS+L  SG
Sbjct: 199 VVSTYGAVNAVIRSDIRVEAGKLTEATVEHHAAEITMKLVRETGGEAIADTSWSLLNESG 258

Query: 237 DTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQ 287
           D + E+  A  SMVL+EGDYT+IA+N++R Y ++F+V+ G++  +EVL  +
Sbjct: 259 DPIKETVGAFASMVLAEGDYTIIAKNRDRIYQKDFTVVAGQNQEIEVLATE 309


>gi|260463882|ref|ZP_05812078.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259030257|gb|EEW31537.1| conserved hypothetical protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 320

 Score =  203 bits (515), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 100/255 (39%), Positives = 150/255 (58%), Gaps = 6/255 (2%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              IT  A+LT+    I  G+ W +F   +     L       GG   F L PG YL+ A
Sbjct: 58  GGAITLSAQLTDKGADITRGLVWRVFKPEA-VNGKLPMVASAHGGNAVFQLEPGSYLVHA 116

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNP---N 152
           S+G  G  K+ITV  + K  ++  +L+AGG++L ++   G  I   +L FSIY      N
Sbjct: 117 SYGRAGATKRITVGKEAK--RESLVLDAGGLKLDAVLSGGVRIPPKKLRFSIYEGTAEAN 174

Query: 153 HKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKIT 212
               LI   V   ++VRL    Y + S YG  NA++ + ++VE GK+ + T+++ AA+IT
Sbjct: 175 GDRALIIPDVEPNSVVRLNAGIYHVVSTYGAVNAVIRSDIRVEAGKLTEATVEHHAAEIT 234

Query: 213 FKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFS 272
            KLV E GGEA+ADT+WS+L  SGD + E+  A  SMVL+EGDYT+IA+N++R Y ++F+
Sbjct: 235 MKLVRESGGEAIADTSWSLLNESGDPIKETVGAFASMVLAEGDYTIIAKNRDRIYQKDFT 294

Query: 273 VLTGKSTIVEVLMRQ 287
           V+ G++  +EVL  +
Sbjct: 295 VVGGQNQEIEVLATE 309



 Score = 55.3 bits (131), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 20/186 (10%), Positives = 57/186 (30%), Gaps = 3/186 (1%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            +  +       +   V+DA  +  +A L+         + + I++  +      +    
Sbjct: 123 ATKRITVGKEAKRESLVLDAGGLKLDAVLSGGVRIPPKKLRFSIYEGTAEANGDRALIIP 182

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS 136
            +       L  G Y + +++G V  V +  +  +     +  + +        + +   
Sbjct: 183 DVEPNSVVRLNAGIYHVVSTYGAVNAVIRSDIRVEAGKLTEATVEHHAAEITMKLVRESG 242

Query: 137 PIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEP 196
                + ++S+ +            V +   + L   +Y I +            V    
Sbjct: 243 GEAIADTSWSLLNESGDPIKE---TVGAFASMVLAEGDYTIIAKNRDRIYQKDFTVVGGQ 299

Query: 197 GKIIDV 202
            + I+V
Sbjct: 300 NQEIEV 305


>gi|90417789|ref|ZP_01225701.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337461|gb|EAS51112.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 322

 Score =  201 bits (510), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 105/281 (37%), Positives = 151/281 (53%), Gaps = 4/281 (1%)

Query: 9   AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
            KA  +           +      +     +T +ARLTE+   I +G+ W +F +I    
Sbjct: 31  PKAPKIELPGLPAYAPQNMPSQDIIRSRATLTLKARLTEDGEPIPNGLVWRLFSAIPAID 90

Query: 69  NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRL 128
              +        + +F++  G Y++   FG  GVVK+I  +      ++   LNAGG+RL
Sbjct: 91  GRATLIASSESSEANFEVPAGSYILHVGFGRAGVVKRIDFTG--VKTQETITLNAGGLRL 148

Query: 129 YSIYKPGSPIVDDELTFSIYSN--PNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
            ++   G  I    L+F +YS+        LI   V    ++RL    Y I S YG  NA
Sbjct: 149 DAMVGDGQTIEPARLSFDVYSDAETESDRDLIASDVPPNKVLRLNAGTYHIVSSYGSVNA 208

Query: 187 IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANAS 246
            V   ++VEPGK+ D T+Q+RAA +T KLV E+GGEA+ADTAWS+ TASGD V ES  A 
Sbjct: 209 SVRADIRVEPGKVTDATLQHRAALLTMKLVRELGGEAIADTAWSVTTASGDPVRESVGAF 268

Query: 247 PSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQ 287
           PSMVL+ GDY ++ARN ++ Y R F+V  G++T VEVL   
Sbjct: 269 PSMVLASGDYVIVARNNDKVYQRAFAVEPGQNTDVEVLTSD 309


>gi|319408656|emb|CBI82311.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 334

 Score =  199 bits (506), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 110/291 (37%), Positives = 167/291 (57%), Gaps = 5/291 (1%)

Query: 4   SFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDS 63
           +FS   + +N     ++ +   S+   +    A ++T  ARLT NS +I  G+ W ++  
Sbjct: 41  AFSEEKELQNYQQEQSITSITHSENHEQEHSQA-KLTLNARLTRNSENITKGLVWRVYTP 99

Query: 64  ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNA 123
           I    N L       GG   F+L  G YL+  SFGH  +V +I + + ++  K  F LNA
Sbjct: 100 ILGIDNKLPLIATFEGGTAHFNLEEGSYLVHVSFGHASMVDQINLKNGQEFVKN-FNLNA 158

Query: 124 GGIRLYSIYKPGSPIVDDELTFSIYSN--PNHKALLITDKVRSGTLVRLGTNNYQITSHY 181
           GGI   S    G+ + + EL F+IY +   N    +I   V+  ++VRL T +Y + SHY
Sbjct: 159 GGIVFNSTLLNGT-VNEKELYFTIYKDAEENDDTGVILSNVKPQSIVRLKTGHYHVVSHY 217

Query: 182 GKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGE 241
           G  NAI  + ++V+ GKII+VT Q++AA+I  KLV + GGEA+ADT+WSI   SGD V E
Sbjct: 218 GSVNAITRSDIQVDAGKIIEVTFQHQAAQIVLKLVRQEGGEALADTSWSITNESGDIVYE 277

Query: 242 SANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDK 292
           +  A  S+VL+EGDY  IA+NK++ Y + FSV++G+   V V+   + + K
Sbjct: 278 AVGAYVSLVLAEGDYIAIAKNKDQIYQKVFSVVSGRDEDVNVIADTQNIQK 328


>gi|163760289|ref|ZP_02167372.1| hypothetical protein HPDFL43_08504 [Hoeflea phototrophica DFL-43]
 gi|162282688|gb|EDQ32976.1| hypothetical protein HPDFL43_08504 [Hoeflea phototrophica DFL-43]
          Length = 249

 Score =  198 bits (504), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 103/249 (41%), Positives = 151/249 (60%), Gaps = 3/249 (1%)

Query: 41  CEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHV 100
            +A LTE+   +++G++W +F  I      L       GG   F+  PGDY I  +FG  
Sbjct: 1   MQAVLTEDGDPVENGLTWRVFHPIPGADGKLPLLATSEGGSAQFEFEPGDYFIHVAFGRS 60

Query: 101 GVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNP---NHKALL 157
           GV KK++V +      Q  +L AGG+ L ++      I   +L F+IY      +    L
Sbjct: 61  GVTKKLSVPAAGPLDTQRLVLEAGGLVLNAVSGVDMRIPVQQLRFNIYKAEEGLDGDQQL 120

Query: 158 ITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVS 217
           + + V    +VRL    Y I S YG  NA++ + ++VEPGK+ +  IQ+RAA++T KLVS
Sbjct: 121 VVEDVEPNIIVRLNAGTYHIVSEYGGVNAVIRSDIRVEPGKLTEAVIQHRAAQLTLKLVS 180

Query: 218 EMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGK 277
           E GGEA+ADTAWSILT+ GD V ES  A P++VL+EG+YT IARNK + Y REF+V+ G+
Sbjct: 181 EAGGEAIADTAWSILTSGGDVVSESVGAFPTIVLAEGEYTAIARNKSQTYQREFTVVAGR 240

Query: 278 STIVEVLMR 286
           ++ +EVL++
Sbjct: 241 NSDIEVLLK 249



 Score = 51.9 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/172 (11%), Positives = 53/172 (30%), Gaps = 3/172 (1%)

Query: 31  KRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGD 90
           + V++A  +   A    +       + ++I+ +            + +   +   L  G 
Sbjct: 78  RLVLEAGGLVLNAVSGVDMRIPVQQLRFNIYKAEEGLDGDQQLVVEDVEPNIIVRLNAGT 137

Query: 91  YLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN 150
           Y I + +G V  V +  +  +     +  I +        +          +  +SI ++
Sbjct: 138 YHIVSEYGGVNAVIRSDIRVEPGKLTEAVIQHRAAQLTLKLVSEAGGEAIADTAWSILTS 197

Query: 151 PNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDV 202
                 ++++ V +   + L    Y   +            V       I+V
Sbjct: 198 GG---DVVSESVGAFPTIVLAEGEYTAIARNKSQTYQREFTVVAGRNSDIEV 246


>gi|75675517|ref|YP_317938.1| hypothetical protein Nwi_1325 [Nitrobacter winogradskyi Nb-255]
 gi|74420387|gb|ABA04586.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 349

 Score =  197 bits (500), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 88/251 (35%), Positives = 142/251 (56%), Gaps = 6/251 (2%)

Query: 39  ITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFG 98
           ++  AR  ++  +I+SG+ W ++    ++       ++      S  L PGDY++  S G
Sbjct: 102 LSLTARYGKDLPAINSGLIWRVYSDRPDETGAFKLVREDHEATPSIALPPGDYVVHVSLG 161

Query: 99  HVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN---PNHKA 155
            V   + +T+ S     ++ F+L AGG+++       S I  ++++FSIY        + 
Sbjct: 162 LVSAARPVTLRSDA--DRESFVLPAGGLKIEGRVGA-SMIPPNQISFSIYKGSQFEGTER 218

Query: 156 LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKL 215
             +   V  G ++ L    Y I S+YG  N++V + ++V+ GK+ DVTI +RAA IT KL
Sbjct: 219 APLLPNVAGGDVMLLPEGTYYIVSNYGDANSVVRSDIRVQAGKLTDVTISHRAAVITLKL 278

Query: 216 VSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLT 275
           VS+ GGEA+A+TAWS+LT  GD + ES  A P +VL+EG+Y VIA+N+ + + R F V  
Sbjct: 279 VSDKGGEALANTAWSVLTPGGDVIKESIGAFPRVVLAEGEYRVIAKNEGKVFERGFEVSN 338

Query: 276 GKSTIVEVLMR 286
           G    +EVL R
Sbjct: 339 GVDGEIEVLAR 349


>gi|92117200|ref|YP_576929.1| hypothetical protein Nham_1651 [Nitrobacter hamburgensis X14]
 gi|91800094|gb|ABE62469.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 348

 Score =  197 bits (499), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 91/275 (33%), Positives = 149/275 (54%), Gaps = 7/275 (2%)

Query: 16  TTSTLLNNNISKGKGKRVVDAQR-ITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTT 74
           T + +    ++      V  AQ  ++  AR  ++   I+SG+ W ++    ++       
Sbjct: 77  TQAPVAAVPLTTPPPAIVAPAQAVLSLTARFGKDLPVINSGLIWRVYSDRPDETGVFKLM 136

Query: 75  KKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKP 134
           ++  GG  +  L PG Y++  S G V  V+ +T+        + F+L AGG+R+      
Sbjct: 137 REDHGGTPNIVLPPGSYVVYVSLGLVSAVRPVTLKPDA--DHETFVLPAGGLRIEGRVGA 194

Query: 135 GSPIVDDELTFSIYSN---PNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV 191
            S I  ++++FSIY        +   +   V +G ++ L    Y I S YG  N++V + 
Sbjct: 195 -SMIPPNQISFSIYKGSQFEGTERAPLVPNVTAGDVILLPEGTYYIVSTYGDANSVVRSD 253

Query: 192 VKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVL 251
           ++V+  K+ DVTI +RAA IT KLVS+ GGEA+A+TAWS+LT  GD + ES  A P ++L
Sbjct: 254 IRVQAAKLTDVTISHRAAVITLKLVSDKGGEALANTAWSVLTPGGDVIKESIGAFPRVIL 313

Query: 252 SEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMR 286
           +EG+Y VIA+N+ + + R F V+ G    VEV+ R
Sbjct: 314 AEGEYRVIAKNEGKVFERGFEVVNGVDGEVEVVAR 348


>gi|39936474|ref|NP_948750.1| hypothetical protein RPA3411 [Rhodopseudomonas palustris CGA009]
 gi|39650330|emb|CAE28852.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 387

 Score =  195 bits (494), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 89/251 (35%), Positives = 146/251 (58%), Gaps = 6/251 (2%)

Query: 39  ITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFG 98
           +   AR  ++   I+SG+ W ++    ++   +   ++  G   +  L PG+Y++  + G
Sbjct: 140 LALAARYGKDQPVINSGLVWRVYSDKPDESGAIKLVREDHGATPNIPLPPGNYVVHVALG 199

Query: 99  HVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN---PNHKA 155
            V  V+ +TV S  +  ++ F+L AGG+R+       S I  ++++F+IY      N + 
Sbjct: 200 LVSAVRPVTVKSDAE--RENFVLPAGGLRIEGKVGS-SRIPSNQISFTIYKGSQFDNAQR 256

Query: 156 LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKL 215
             +   V +G +  +    Y I S+YG  N++V + ++V+ GK+ DVTI +RAA IT KL
Sbjct: 257 APLLPSVAAGDVALVPEGTYYIVSNYGDANSVVRSDIRVQAGKLTDVTITHRAAVITLKL 316

Query: 216 VSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLT 275
           VSE GGEA+A+T+WS+LT  GD + ES  A P +VLSEG+Y  IA+N+ + + R F+V+ 
Sbjct: 317 VSEKGGEALANTSWSVLTPGGDVIKESIGAFPRVVLSEGEYRAIAKNEGKVFERGFNVVN 376

Query: 276 GKSTIVEVLMR 286
           G    VEVL R
Sbjct: 377 GVDGEVEVLAR 387


>gi|121602335|ref|YP_989049.1| hypothetical protein BARBAKC583_0752 [Bartonella bacilliformis
           KC583]
 gi|120614512|gb|ABM45113.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 320

 Score =  194 bits (492), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 93/292 (31%), Positives = 149/292 (51%), Gaps = 4/292 (1%)

Query: 4   SFSSYAKAENMHT-TSTLLNNNI--SKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHI 60
           S+S+++K E +       L ++I  S+   +  +    +   ARL  NS +I  G+ W I
Sbjct: 24  SYSAFSKEERVKNLQQERLTDSIIHSQNNEEETLSQATLIVHARLMNNSENITKGLVWRI 83

Query: 61  FDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFI 120
           +  +      L       GG   FDL  G YL+  SFGH   V ++++   ++  K   +
Sbjct: 84  YAPVLMGD-KLPLIATFEGGSAHFDLEAGSYLVHVSFGHASAVHRVSLEKGQQLVKNFNL 142

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSH 180
              G I   ++        +   T    +       +I   V+  +LVRL    Y + S+
Sbjct: 143 EAGGVILNSTVLNGIINEKELNFTIYEDAKETDDTGVILSNVKPQSLVRLKAGYYHVVSY 202

Query: 181 YGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVG 240
           YG  NAI+S  ++V+ GKI +V+++++AA+I  KLV + GGEA+ADT+WSI   SGD + 
Sbjct: 203 YGSINAIISADIQVDEGKITEVSLEHQAAQILLKLVRQEGGEALADTSWSITNDSGDIIY 262

Query: 241 ESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDK 292
           E+  A   +VL EGDY  IA+NK++ Y + FSV++G    V V+     M K
Sbjct: 263 ETVGAYVPLVLVEGDYIAIAKNKDQIYQKVFSVISGYDKDVSVIADTDIMQK 314


>gi|85715169|ref|ZP_01046153.1| hypothetical protein NB311A_01255 [Nitrobacter sp. Nb-311A]
 gi|85698084|gb|EAQ35957.1| hypothetical protein NB311A_01255 [Nitrobacter sp. Nb-311A]
          Length = 348

 Score =  193 bits (491), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 86/274 (31%), Positives = 143/274 (52%), Gaps = 6/274 (2%)

Query: 16  TTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTK 75
           T +      ++            ++  AR  ++   I+SG+ W ++    ++       +
Sbjct: 78  TQAPAAAVPLTASPVVAAPPQAVLSLTARYGKDLPVINSGLVWRVYSDRPDQTGAFKLVR 137

Query: 76  KIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPG 135
           +      S  L PG Y++  S G V   + +T+       ++ F+L AGG+++       
Sbjct: 138 ENHDATPSIALPPGGYVVHVSLGLVSAARLVTLKPD--TDRESFVLPAGGLKIEGRVGA- 194

Query: 136 SPIVDDELTFSIYSN---PNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVV 192
           S I  ++++FSIY        +   +   V  G ++ L    Y I S+YG  N++V + +
Sbjct: 195 SMIPPNQISFSIYKGSQFEGTERAPLLPNVSGGDIMLLPEGTYYIVSNYGDANSVVRSDI 254

Query: 193 KVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLS 252
           +V+ GK+ DVTI +RAA IT KLVS+ GGEA+A+TAWS+LT  GD + ES  A P ++L+
Sbjct: 255 RVQAGKLTDVTISHRAAVITLKLVSDKGGEALANTAWSVLTPGGDVIKESIGAFPRVILA 314

Query: 253 EGDYTVIARNKERNYSREFSVLTGKSTIVEVLMR 286
           EG+Y VIA+N+ + + R F V  G    +EVL R
Sbjct: 315 EGEYRVIAKNEGKVFERGFEVFNGVDGEIEVLAR 348


>gi|316933332|ref|YP_004108314.1| hypothetical protein Rpdx1_1971 [Rhodopseudomonas palustris DX-1]
 gi|315601046|gb|ADU43581.1| hypothetical protein Rpdx1_1971 [Rhodopseudomonas palustris DX-1]
          Length = 379

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 90/253 (35%), Positives = 145/253 (57%), Gaps = 6/253 (2%)

Query: 37  QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
             +   AR  ++   I+SG+ W ++    +    +   ++  G   S  L PG+Y++  +
Sbjct: 130 GVLALTARYGKDQPVINSGLIWRVYSDRPDDSGAIKLIREDHGATPSIPLPPGNYVVHVA 189

Query: 97  FGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN---PNH 153
            G V  V+ +TV +    +++ F+L AGG+R+       S I  ++++FSIY      N 
Sbjct: 190 LGLVSAVRPVTVKAD--TERENFVLPAGGLRIEGKVGS-SRIPANQISFSIYKGSQFDNA 246

Query: 154 KALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITF 213
           +   +   V +G +  +    Y I S+YG  N++V + ++V+ GK+ DVTI +RAA IT 
Sbjct: 247 QRAPLLPGVAAGDVALVPEGTYYIVSNYGDANSVVRSDIRVQTGKLTDVTITHRAAVITL 306

Query: 214 KLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSV 273
           KLVSE GGEA+A+T+WS+LT  GD + ES  A P +VLSEG+Y  IA+N+ + + R F+V
Sbjct: 307 KLVSEKGGEALANTSWSVLTPGGDVIKESIGAFPRVVLSEGEYRAIAKNEGKVFERGFNV 366

Query: 274 LTGKSTIVEVLMR 286
           + G    VEVL R
Sbjct: 367 VNGVDGEVEVLAR 379


>gi|254504001|ref|ZP_05116152.1| hypothetical protein SADFL11_4040 [Labrenzia alexandrii DFL-11]
 gi|222440072|gb|EEE46751.1| hypothetical protein SADFL11_4040 [Labrenzia alexandrii DFL-11]
          Length = 358

 Score =  193 bits (489), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 90/264 (34%), Positives = 139/264 (52%), Gaps = 5/264 (1%)

Query: 30  GKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPG 89
               +D   +   A+LT +S  ++  + W I+   +N    L       GG   F L PG
Sbjct: 89  TAEGLDGGALYLMAKLTRDSQPLNDNLIWRIYSETTNADGRLQLIATSKGGDAEFRLDPG 148

Query: 90  DYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS 149
            Y+I  S+G+     +I +   ++   ++  LNAGGI+  +    G+P+    +TF IYS
Sbjct: 149 AYMIHTSYGYAQATNRIVI--GKEVLSKMVTLNAGGIKFDATLPDGAPLESGPVTFDIYS 206

Query: 150 ---NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQN 206
              +   +  LI   V+ G+++RL  + Y I S YG  NA +   ++V PGK+ + TI +
Sbjct: 207 REFDQRGERDLIASSVKPGSIIRLNADTYHIVSRYGDANAEIRADIQVLPGKLTEATIFH 266

Query: 207 RAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERN 266
           +AA IT KLV+E GGEA+A+T WS+L+  GD V E+  A P  VL+ G+Y  +ARN  R 
Sbjct: 267 KAADITLKLVNERGGEAIANTTWSVLSPGGDVVVEATGAFPDFVLAAGEYEAVARNNGRT 326

Query: 267 YSREFSVLTGKSTIVEVLMRQKRM 290
           Y   F+V  G    VEV+     +
Sbjct: 327 YLHTFTVEPGADREVEVVSSISEL 350



 Score = 54.9 bits (130), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/193 (12%), Positives = 55/193 (28%), Gaps = 7/193 (3%)

Query: 13  NMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSG-VSWHIFDSISNKKNTL 71
                +  +            ++A  I  +A L  +   ++SG V++ I+    +++   
Sbjct: 157 GYAQATNRIVIGKEVLSKMVTLNAGGIKFDATL-PDGAPLESGPVTFDIYSREFDQRGER 215

Query: 72  STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSI 131
                 +       L    Y I + +G      +  +        +  I +        +
Sbjct: 216 DLIASSVKPGSIIRLNADTYHIVSRYGDANAEIRADIQVLPGKLTEATIFHKAADITLKL 275

Query: 132 YKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV 191
                       T+S+ S      +  T    +     L    Y+  +       +    
Sbjct: 276 VNERGGEAIANTTWSVLSPGGDVVVEAT---GAFPDFVLAAGEYEAVARNNGRTYLH--T 330

Query: 192 VKVEPGKIIDVTI 204
             VEPG   +V +
Sbjct: 331 FTVEPGADREVEV 343


>gi|209884751|ref|YP_002288608.1| FHA domain containing protein [Oligotropha carboxidovorans OM5]
 gi|209872947|gb|ACI92743.1| FHA domain containing protein [Oligotropha carboxidovorans OM5]
          Length = 353

 Score =  192 bits (487), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 84/273 (30%), Positives = 139/273 (50%), Gaps = 7/273 (2%)

Query: 19  TLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKII 78
            L+   +      +      +   AR  ++   I+ G+ W I+    +    +   ++  
Sbjct: 83  QLVQPPLIPPPSAQAAPQGSLALSARFGKDLPVINGGLVWRIYSDKPSLNGAMQLVREEH 142

Query: 79  GGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPI 138
               +  L PG Y++ AS G V  V  +TV   E   ++ F L AGG+R+       S I
Sbjct: 143 AAGPTIPLPPGGYVVHASLGLVSDVHSLTVKQDET-ARETFELPAGGLRIEGRVGT-SKI 200

Query: 139 VDDELTFSIYSN-----PNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVK 193
              ++ FS+Y              I   + +G ++ L    Y + S+YG  N+IV + ++
Sbjct: 201 PQGQIVFSVYKGSQFEIGTGDRAPIAQNIPAGDVLMLPAGIYYLVSNYGDANSIVRSDIR 260

Query: 194 VEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSE 253
           V+  K+ DV + +RAA IT KLV E GGEA+A+T+WS++T +GD + ES  A P ++L+E
Sbjct: 261 VQAAKLTDVVVTHRAAVITLKLVGEKGGEALANTSWSVITPAGDVIKESTGAFPRVMLAE 320

Query: 254 GDYTVIARNKERNYSREFSVLTGKSTIVEVLMR 286
           G+Y  IA+N+ + + R+F V  G    VEVL+R
Sbjct: 321 GEYRAIAKNEGKVFERDFEVKNGVDGEVEVLIR 353


>gi|315122760|ref|YP_004063249.1| hypothetical protein CKC_05070 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496162|gb|ADR52761.1| hypothetical protein CKC_05070 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 301

 Score =  192 bits (486), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 211/293 (72%), Positives = 249/293 (84%), Gaps = 3/293 (1%)

Query: 4   SFSSYAKAENMHT--TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
           SF SYAK EN     T++  +N++SKGKGK+++ AQ+I C+ARLTENS  I+SGVSWH+F
Sbjct: 6   SFPSYAKTENPSDIHTTSTSSNDMSKGKGKKIIPAQKIICKARLTENSPFINSGVSWHVF 65

Query: 62  DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFIL 121
           D+  NKK+TLST KKIIGG V  +LFPGDYL+SASFGHVGVVK+ITV+  ++ +K  F+ 
Sbjct: 66  DTTLNKKDTLSTIKKIIGGIVYLELFPGDYLVSASFGHVGVVKRITVTPTKQIEKHTFVF 125

Query: 122 NAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNN-YQITSH 180
           NAGGIRLYSIYKP SPIVDDELTFSIYSNPN K L+I DKV SGTL+RL  +  YQITSH
Sbjct: 126 NAGGIRLYSIYKPDSPIVDDELTFSIYSNPNQKPLMIADKVSSGTLIRLLGSTNYQITSH 185

Query: 181 YGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVG 240
           YGKYNA+VST+VKVE GK+IDVTIQNRAAK TFKLVSE GGEA+ADTAWSILTA GDTVG
Sbjct: 186 YGKYNAVVSTIVKVESGKVIDVTIQNRAAKTTFKLVSEAGGEAIADTAWSILTAGGDTVG 245

Query: 241 ESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKN 293
           ES +A PSM+LSEGDY VIARNKER YSREFSV TGK+ ++EV+M+QKR+DK+
Sbjct: 246 ESVHAFPSMILSEGDYVVIARNKERIYSREFSVTTGKNKVIEVIMKQKRVDKS 298


>gi|299135306|ref|ZP_07028497.1| FHA domain containing protein [Afipia sp. 1NLS2]
 gi|298590283|gb|EFI50487.1| FHA domain containing protein [Afipia sp. 1NLS2]
          Length = 349

 Score =  192 bits (486), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 87/255 (34%), Positives = 134/255 (52%), Gaps = 7/255 (2%)

Query: 37  QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
             +T  AR  ++  +I+ G+ W I+         +   ++         L PG Y+I  S
Sbjct: 97  GTLTLSARFGKDMPAINGGLIWRIYSDKLGPNGAMHLIREERAAAPVIPLPPGGYVIHVS 156

Query: 97  FGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN-----P 151
            G V  V+ +T+  +E+  ++ F L AGG+R+       S I   ++ FSIY        
Sbjct: 157 LGLVSDVRPVTI-RQEETTRETFDLAAGGLRIEGRVGT-SKIPQGQIVFSIYKGSQFEIG 214

Query: 152 NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKI 211
                 I   V +G ++ L    Y + S YG  N+IV + ++V+  K+ DV + +RAA I
Sbjct: 215 TGDRSPIAQNVAAGDVLMLPAGIYYLVSTYGDANSIVRSDIRVQAAKLTDVVVTHRAAVI 274

Query: 212 TFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREF 271
           T KLV E GGEA+A+TAWS+LT +GD + ES  A P ++L+EG+Y  IA+N  + + R+F
Sbjct: 275 TLKLVGEKGGEALANTAWSVLTPAGDVIKESIGAFPRVMLAEGEYKAIAKNDGKVFERDF 334

Query: 272 SVLTGKSTIVEVLMR 286
            V  G    VEVL R
Sbjct: 335 EVKNGVDGEVEVLTR 349


>gi|27380660|ref|NP_772189.1| hypothetical protein bll5549 [Bradyrhizobium japonicum USDA 110]
 gi|27353825|dbj|BAC50814.1| bll5549 [Bradyrhizobium japonicum USDA 110]
          Length = 357

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 93/253 (36%), Positives = 148/253 (58%), Gaps = 6/253 (2%)

Query: 37  QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
             ++  A+  ++S  I SG+ W +F    ++  T    ++      +  L PG+Y++  +
Sbjct: 108 GVLSLTAKYGKDSAPITSGLVWRVFADRPDENGTFKLIREDRNATPNIVLPPGNYVVHVA 167

Query: 97  FGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN---PNH 153
           FG V  V+  TVS K +  ++ F+L AGG+R+       S I  ++++F+IY      + 
Sbjct: 168 FGLVSAVR--TVSLKAETDRESFVLPAGGLRIEGRVGT-SRIPQNQISFAIYKGSQFESG 224

Query: 154 KALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITF 213
           +   +   V +G +V L    Y I S+YG  N++V + ++V+ GK+ DVTI +RAA IT 
Sbjct: 225 ERASLVPNVAAGDVVLLPEGTYYIISNYGDANSVVRSDIRVQAGKLTDVTITHRAAVITL 284

Query: 214 KLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSV 273
           KLVS+ GGEA+A+TAWS+LT  GD + ES  A P +VLSEG+Y  IA+N+ + Y R F+V
Sbjct: 285 KLVSDRGGEALANTAWSVLTPGGDVIKESIGAFPRVVLSEGEYRAIAKNEGKVYERGFNV 344

Query: 274 LTGKSTIVEVLMR 286
           + G    VEV+ R
Sbjct: 345 VNGVDGEVEVVAR 357


>gi|118591253|ref|ZP_01548652.1| hypothetical protein SIAM614_16542 [Stappia aggregata IAM 12614]
 gi|118436329|gb|EAV42971.1| hypothetical protein SIAM614_16542 [Stappia aggregata IAM 12614]
          Length = 342

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 96/278 (34%), Positives = 144/278 (51%), Gaps = 6/278 (2%)

Query: 21  LNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGG 80
                S G  K  +    +   A+LT +S  ++ G+ W I+   +N    L       GG
Sbjct: 63  PARATSPG-VKGGLRQGALYLMAKLTPDSPPLNEGLIWRIYSETTNADGRLQLVATSQGG 121

Query: 81  KVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVD 140
              F L PG YLI  ++G+     +I +   ++ Q ++  LNAGGI+  +  K G  +  
Sbjct: 122 DAEFRLDPGTYLIHTAYGYAQATNRIVI--GKEVQSKMVTLNAGGIKFGAALKDGEDLDG 179

Query: 141 DELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPG 197
             + F +Y    N   +  LI   V+ G+++RLG N Y + S YG  NA+V   ++V PG
Sbjct: 180 RAVAFDLYGMEFNQRGERNLIASNVKPGSILRLGANTYHVVSKYGDVNAVVRADIQVLPG 239

Query: 198 KIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYT 257
           K+ + TI ++AA IT KLV+E GGEA+A+T WS+L+  GD V E+  A P  VL+EG+Y 
Sbjct: 240 KLTEATIFHKAAGITLKLVNERGGEAIANTTWSVLSPGGDVVVEATGAFPDFVLAEGEYE 299

Query: 258 VIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            +ARN  R Y   F V  G+   VEV+     +    Q
Sbjct: 300 ALARNNGRTYLHTFQVQPGEDREVEVVTSVSELASQQQ 337


>gi|192292259|ref|YP_001992864.1| hypothetical protein Rpal_3891 [Rhodopseudomonas palustris TIE-1]
 gi|192286008|gb|ACF02389.1| conserved hypothetical protein [Rhodopseudomonas palustris TIE-1]
          Length = 353

 Score =  188 bits (478), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 89/251 (35%), Positives = 146/251 (58%), Gaps = 6/251 (2%)

Query: 39  ITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFG 98
           +   AR  ++   I+SG+ W ++    ++   +   ++  G   +  L PG+Y++  + G
Sbjct: 106 LALAARYGKDQPVINSGLVWRVYSDKPDESGAIKLVREDHGATPNIPLPPGNYVVHVALG 165

Query: 99  HVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN---PNHKA 155
            V  V+ +TV S  +  ++ F+L AGG+R+       S I  ++++F+IY      N + 
Sbjct: 166 LVSAVRPVTVKSDAE--RENFVLPAGGLRIEGKVGS-SRIPSNQISFTIYKGSQFDNAQR 222

Query: 156 LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKL 215
             +   V +G +  +    Y I S+YG  N++V + ++V+ GK+ DVTI +RAA IT KL
Sbjct: 223 APLLPSVAAGDVALVPEGTYYIVSNYGDANSVVRSDIRVQAGKLTDVTITHRAAVITLKL 282

Query: 216 VSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLT 275
           VSE GGEA+A+T+WS+LT  GD + ES  A P +VLSEG+Y  IA+N+ + + R F+V+ 
Sbjct: 283 VSEKGGEALANTSWSVLTPGGDVIKESIGAFPRVVLSEGEYRAIAKNEGKVFERGFNVVN 342

Query: 276 GKSTIVEVLMR 286
           G    VEVL R
Sbjct: 343 GVDGEVEVLAR 353


>gi|86749277|ref|YP_485773.1| FHA domain-containing protein [Rhodopseudomonas palustris HaA2]
 gi|86572305|gb|ABD06862.1| FHA domain containing protein [Rhodopseudomonas palustris HaA2]
          Length = 353

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 86/253 (33%), Positives = 144/253 (56%), Gaps = 6/253 (2%)

Query: 37  QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
             +   AR  ++  +I++G+ W ++    +    +   ++  G   +  L PG+Y++  +
Sbjct: 104 GVLALTARYGKDLPAINAGLVWRVYSDRPDDSGAIKLIREEHGATPNIVLPPGNYVVHVA 163

Query: 97  FGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN---PNH 153
            G V  V+ +T+ +     ++ FIL AGG+R+      G+ I  ++++FSIY      N 
Sbjct: 164 HGLVSAVRPVTLKTD--TDREAFILPAGGLRIEGRVG-GTRIPQNQISFSIYKGSQFENS 220

Query: 154 KALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITF 213
           +   +     +G +  +    Y I S+YG  N++V + ++V  GK+ DVT+ +RAA IT 
Sbjct: 221 QRPPLVPNAAAGDVALVPEGTYYIVSNYGDANSVVRSDIRVTAGKLTDVTVTHRAAVITL 280

Query: 214 KLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSV 273
           KLVS+ GGEA+A+TAWS+LT  GD + ES  A P +VLSEG+Y  IA+N+ + + R F+V
Sbjct: 281 KLVSDRGGEALANTAWSVLTPGGDVIKESIGAFPKVVLSEGEYRAIAKNEGKVFERGFNV 340

Query: 274 LTGKSTIVEVLMR 286
           + G    VEVL R
Sbjct: 341 VNGVDGEVEVLAR 353


>gi|307946208|ref|ZP_07661543.1| FHA domain-containing protein [Roseibium sp. TrichSKD4]
 gi|307769872|gb|EFO29098.1| FHA domain-containing protein [Roseibium sp. TrichSKD4]
          Length = 363

 Score =  188 bits (476), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 95/260 (36%), Positives = 144/260 (55%), Gaps = 6/260 (2%)

Query: 35  DAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLIS 94
           +   +   A+LT ++  + SG++W I+   +N    L    K  GG   F L PG YLI 
Sbjct: 100 NGGVLHLMAKLTRDTAPLTSGLTWRIYSETTNSDGRLELIAKSEGGHAEFQLDPGVYLIH 159

Query: 95  ASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS---NP 151
             +G+   V +I +    K + ++  LNAGG++L +     +P+   ++ F +Y    N 
Sbjct: 160 TGYGYASAVNRIVM--GRKVESKMVTLNAGGVKLNAGLDQDTPLS-TDVQFDVYGMEFNE 216

Query: 152 NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKI 211
             +  LI D +  G +VRL    Y I + YG  N++V   V+V PGK+ + T+ ++AA+I
Sbjct: 217 RGERQLIVDGLSPGDIVRLNAETYHIVNRYGDSNSVVRADVQVLPGKLTEATLFHKAAEI 276

Query: 212 TFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREF 271
           T KLV+E GGEA+A+T+WS+L+  GD V E+  A PS VL+ GDY VIARN  R +  +F
Sbjct: 277 TLKLVNEEGGEAIANTSWSVLSPGGDVVVEATGAFPSFVLAAGDYEVIARNNGRLFQDKF 336

Query: 272 SVLTGKSTIVEVLMRQKRMD 291
            V TG    VEVL   +   
Sbjct: 337 KVQTGGDREVEVLASSRSDR 356


>gi|148256524|ref|YP_001241109.1| hypothetical protein BBta_5211 [Bradyrhizobium sp. BTAi1]
 gi|146408697|gb|ABQ37203.1| hypothetical protein BBta_5211 [Bradyrhizobium sp. BTAi1]
          Length = 284

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 86/255 (33%), Positives = 144/255 (56%), Gaps = 6/255 (2%)

Query: 35  DAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLIS 94
           +   ++  AR  ++  +I+ G+ W +F    ++       ++  G   +  L PG+Y++ 
Sbjct: 33  NQGVLSLSARYGKDLPNINGGLVWRVFADRPDESGAFKMLREDRGATPNIVLPPGNYVVH 92

Query: 95  ASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN---P 151
            + G V  V+ + + +  +  ++ F+L AGG+RL       S I  ++++F+IY      
Sbjct: 93  VALGLVSAVRAVNLKA--ETDRESFVLPAGGLRLEGRVGT-SKIPPNQISFAIYKGSQFD 149

Query: 152 NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKI 211
             +   I   V +G ++ L    Y I S+YG  N++V + ++V+  K+ DVT+ +RAA I
Sbjct: 150 GRERAPIVPNVAAGDVLMLPEGTYYIVSNYGDANSVVRSDIRVQASKLTDVTVTHRAAVI 209

Query: 212 TFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREF 271
           T KLVS+ GGEA+A+TAWS++   GD + ES  A P +VLSEGDY  IA+N+ + + R F
Sbjct: 210 TLKLVSDKGGEALANTAWSVINPGGDVIKESIGAFPKVVLSEGDYRAIAKNEGKVFERSF 269

Query: 272 SVLTGKSTIVEVLMR 286
           SV+ G    VEVL R
Sbjct: 270 SVVNGVDGEVEVLAR 284


>gi|114706615|ref|ZP_01439516.1| hypothetical protein FP2506_12724 [Fulvimarina pelagi HTCC2506]
 gi|114538007|gb|EAU41130.1| hypothetical protein FP2506_12724 [Fulvimarina pelagi HTCC2506]
          Length = 390

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 96/263 (36%), Positives = 146/263 (55%), Gaps = 5/263 (1%)

Query: 28  GKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLF 87
              K       +  EARL+E    +  G+ W +F ++   +   +        K SF++ 
Sbjct: 122 MDKKAFRPNAELVLEARLSEEGEIVPGGIVWRLFSAVPQLQGRSTLIATSKEAKPSFNVP 181

Query: 88  PGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYS-IYKPGSPIVDDELTFS 146
           PG Y++ A+FG  G+VK+I  +    N K+V +L AGG++L + +   G    +  L F 
Sbjct: 182 PGAYIVHATFGRAGIVKRIDFNG--VNVKEVVVLGAGGLKLDATVSSEGQAATESRLKFD 239

Query: 147 IYSNP--NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTI 204
           I+++   + +  LI   V  G +VRL    Y + S YG  NA     ++VE GK+ + T+
Sbjct: 240 IFADAERDSERELIASGVAPGEVVRLNAGLYHVVSTYGSINARTQADIRVEAGKLTEATL 299

Query: 205 QNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKE 264
           Q+RAA+ T KLV E GGEA+A TAW++ + SGD + +SA A  SMVL+EGDY  +ARN+E
Sbjct: 300 QHRAAQQTLKLVREHGGEAIAGTAWTVTSMSGDILRKSAGAFASMVLAEGDYMAVARNRE 359

Query: 265 RNYSREFSVLTGKSTIVEVLMRQ 287
             Y R FSV  G+   VE+L+  
Sbjct: 360 TTYQRSFSVKAGEDADVEILLSD 382


>gi|146339959|ref|YP_001205007.1| hypothetical protein BRADO2963 [Bradyrhizobium sp. ORS278]
 gi|146192765|emb|CAL76770.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 249

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 90/251 (35%), Positives = 145/251 (57%), Gaps = 6/251 (2%)

Query: 39  ITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFG 98
           ++  AR  ++  +I+ G+ W +F    ++  T    ++  G   +  L PG+Y++  + G
Sbjct: 2   LSLSARYGKDLPNINGGLVWRVFADRPDETGTFKMLREDRGPTPNIVLPPGNYVVHVALG 61

Query: 99  HVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN---PNHKA 155
            V  V+  TV+ K +  ++ F+L AGG+RL       + I  ++++F+IY        + 
Sbjct: 62  LVSAVR--TVNLKAETDRESFLLPAGGLRLEGRVGS-TKIPQNQISFAIYKGSQFDGRER 118

Query: 156 LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKL 215
             I   V +G ++ L    Y I S+YG  NA+V + ++V+  K+ DVT+ +RAA IT KL
Sbjct: 119 APIVPNVAAGDILMLPEGTYYIVSNYGDANAVVRSDIRVQASKLTDVTVTHRAAVITLKL 178

Query: 216 VSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLT 275
           VS+ GGEA+A+TAWS++   GD + ES  A P +VLSEGDY  IA+N+ + + R FSV+ 
Sbjct: 179 VSDKGGEALANTAWSVINPGGDVIKESVGAFPKVVLSEGDYRAIAKNEGKVFERSFSVVN 238

Query: 276 GKSTIVEVLMR 286
           G    VEVL R
Sbjct: 239 GVDGEVEVLAR 249


>gi|328543266|ref|YP_004303375.1| hypothetical protein SL003B_1647 [Polymorphum gilvum SL003B-26A1]
 gi|326413012|gb|ADZ70075.1| hypothetical protein SL003B_1647 [Polymorphum gilvum SL003B-26A1]
          Length = 341

 Score =  187 bits (473), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 100/275 (36%), Positives = 145/275 (52%), Gaps = 6/275 (2%)

Query: 16  TTSTLLNNNISKGKGK-RVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTT 74
            T      + +   G+   +D   +   ARL++   ++  GV W I+    N    L   
Sbjct: 64  DTLVPYAPSATSLTGQPGEMDKGALYLVARLSDGGPTLSDGVIWRIYSETPNSNGNLELV 123

Query: 75  KKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKP 134
              +GG   F L PG YLI  ++GH G   ++ V        +  +LNAGG+RL +    
Sbjct: 124 ATSMGGDAEFRLDPGAYLIHTAYGHAGATNRLVVGRG--VYSKTVVLNAGGVRLDAALGD 181

Query: 135 GSPIVDDELTFSIY---SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV 191
              +  +   F I+    N   +  LIT  V   T+VRL    Y + S YG  NA+V   
Sbjct: 182 NRHLGAEVARFDIFGMDYNEQGERQLITTNVGPETIVRLNAGTYHVVSRYGDVNAVVRAD 241

Query: 192 VKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVL 251
           ++VEPGK+   T+ ++AA IT KLV+E GGEA+A+T+WS+LT  GD V E++ A P  VL
Sbjct: 242 IRVEPGKLTGATVYHQAADITLKLVNEPGGEAIANTSWSVLTPGGDIVVEASGAFPDFVL 301

Query: 252 SEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMR 286
           + G+Y VIARN   NYSR F+V++G+   VEVL  
Sbjct: 302 AAGEYEVIARNNGVNYSRSFTVVSGEDREVEVLTS 336



 Score = 39.5 bits (90), Expect = 0.52,   Method: Composition-based stats.
 Identities = 19/110 (17%), Positives = 32/110 (29%), Gaps = 8/110 (7%)

Query: 16  TTSTLLNNNISKGK-GKRVVDAQRITCEARLTEN-STSIDSGVSWHIFDSISNKKNTLST 73
                 +  +  GK     V  Q      +L         +  SW +     +       
Sbjct: 235 NAVVRADIRVEPGKLTGATVYHQAADITLKLVNEPGGEAIANTSWSVLTPGGD------I 288

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNA 123
             +  G    F L  G+Y + A    V   +  TV S E  + +V   + 
Sbjct: 289 VVEASGAFPDFVLAAGEYEVIARNNGVNYSRSFTVVSGEDREVEVLTSSV 338


>gi|154245581|ref|YP_001416539.1| hypothetical protein Xaut_1636 [Xanthobacter autotrophicus Py2]
 gi|154159666|gb|ABS66882.1| conserved hypothetical protein [Xanthobacter autotrophicus Py2]
          Length = 357

 Score =  185 bits (469), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 84/255 (32%), Positives = 120/255 (47%), Gaps = 7/255 (2%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +   AR   +   I  G+ W +F              +       F L PG Y++  
Sbjct: 106 KAALGVFARFGADGAPIPRGLVWRVFADQPESTGAFPLVAESSEATPVFFLNPGGYIVHV 165

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA 155
           S+G   V +++ +       ++     A G    S      PI   +LTF I+     + 
Sbjct: 166 SYGFATVAQRVQM---GPLSRRQAFEVAAGALRLSADVDDKPIPAQKLTFDIFEGSFLQG 222

Query: 156 LLITD----KVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKI 211
              +        +G +V L    Y + S YG  NA+V   V V PGK+ D T+ +RAA+I
Sbjct: 223 RTSSQPYYRGASAGEVVLLPEGTYHVVSTYGDANAVVRADVTVAPGKLTDATVHHRAAQI 282

Query: 212 TFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREF 271
             KLV   GGEA ADT W+++T  GDT+ ES  A P+ VLSEGDYT IAR   +N+SRE 
Sbjct: 283 MLKLVKVAGGEAQADTQWTVITPGGDTIKESIGAFPTFVLSEGDYTAIARKDGKNFSREI 342

Query: 272 SVLTGKSTIVEVLMR 286
            V  GK+  +EVL +
Sbjct: 343 KVEAGKNQEIEVLAK 357


>gi|91977735|ref|YP_570394.1| hypothetical protein RPD_3269 [Rhodopseudomonas palustris BisB5]
 gi|91684191|gb|ABE40493.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB5]
          Length = 351

 Score =  184 bits (466), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 84/267 (31%), Positives = 144/267 (53%), Gaps = 6/267 (2%)

Query: 23  NNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKV 82
              S            +   AR  ++  +I +G+ W ++    +    +   ++  G   
Sbjct: 88  PATSPLPPTAAPPQGVLALTARYGKDLPTISNGLVWRVYADKPDDGGQIKLVREDHGATP 147

Query: 83  SFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDE 142
           +  L PG+Y++  + G V  V+ + + +  +  ++ F+L AGG+R+      G+ I  ++
Sbjct: 148 NIVLPPGNYVVHVAHGLVSAVRPVALRA--ETDREAFVLPAGGLRIEGRVG-GTRIPQNQ 204

Query: 143 LTFSIYSN---PNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKI 199
           ++FSIY      N +   +     +G +V +    Y I S+YG  N++V + ++V  GK+
Sbjct: 205 ISFSIYKGSQFENTQRAPLVPNAAAGDVVLVPEGTYYIVSNYGDANSVVRSDIRVTAGKL 264

Query: 200 IDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVI 259
            DV + +RAA IT KLVS+ GGEA+A+TAWS+LT  GD + ES  A P +VLSEG+Y  I
Sbjct: 265 TDVAVTHRAAVITLKLVSDKGGEALANTAWSVLTPGGDVIKESIGAFPRVVLSEGEYRAI 324

Query: 260 ARNKERNYSREFSVLTGKSTIVEVLMR 286
           A+N+ + + R F+V+ G    VEV+ R
Sbjct: 325 AKNEGKVFERGFNVVNGVDGEVEVMAR 351


>gi|319405603|emb|CBI79226.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 246

 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 96/241 (39%), Positives = 142/241 (58%), Gaps = 4/241 (1%)

Query: 54  SGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEK 113
           SG+ W ++  I    N L       GG   FDL PG YL+  SFGH   V++IT+ + ++
Sbjct: 2   SGLVWRVYVPILGSDNKLPLIAIYKGGTARFDLKPGSYLVHVSFGHASAVQRITLENGQQ 61

Query: 114 NQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN--PNHKALLITDKVRSGTLVRLG 171
             K  F L+AGGI   S       I + EL F+IY +   N    +I   V+  ++VRL 
Sbjct: 62  LVKN-FNLDAGGIIFNSTL-FNGTINEKELRFTIYEDEKENDDTGVILANVKPQSIVRLK 119

Query: 172 TNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
           + +Y++ SHYG  NAIV   ++VE GKI +VT++++AA+I  KLV + GGEA+ADT+WSI
Sbjct: 120 SGHYRVVSHYGSVNAIVRADIQVEAGKITEVTLEHQAAQIILKLVRQEGGEALADTSWSI 179

Query: 232 LTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMD 291
              SGD + E+  A   +VL EGDY  IA+NK++ Y + FSV++G    V V+   + + 
Sbjct: 180 TNDSGDIIYETVGAYVLLVLVEGDYIAIAKNKDKIYQKIFSVVSGHDKDVNVIANSQNIQ 239

Query: 292 K 292
           +
Sbjct: 240 Q 240


>gi|115524342|ref|YP_781253.1| hypothetical protein RPE_2333 [Rhodopseudomonas palustris BisA53]
 gi|115518289|gb|ABJ06273.1| conserved hypothetical protein [Rhodopseudomonas palustris BisA53]
          Length = 357

 Score =  182 bits (462), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 86/251 (34%), Positives = 138/251 (54%), Gaps = 6/251 (2%)

Query: 39  ITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFG 98
           +   AR  ++   I+ G+ W ++    ++       ++      +  L PG Y++  + G
Sbjct: 110 LALSARYGKDLPVINGGLVWRVYSDRPDETGAFKLIREDRNATPNMVLPPGSYVVHVAHG 169

Query: 99  HVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN---PNHKA 155
            V  V+ +T+ S     ++ F+L AGG+R+       S I  ++++FSIY        + 
Sbjct: 170 LVSAVRPVTIKSD--TDREAFVLPAGGLRIEGRVGT-SKIPQNQISFSIYKGSQFETSER 226

Query: 156 LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKL 215
             +   V +G +V L    Y I S+YG  N++V + ++V+ GK+ DV I +RAA IT KL
Sbjct: 227 APLVPSVAAGDVVLLPDGTYYIVSNYGDANSVVRSDIRVQAGKLTDVIITHRAAVITLKL 286

Query: 216 VSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLT 275
           VSE GGEA+A+TAWS++T  GD V ES  A P +VLSEG Y  IA+N+ + + R F V+ 
Sbjct: 287 VSEKGGEALANTAWSVITPGGDVVKESIGAFPRVVLSEGPYRAIAKNEGKVFERSFDVVN 346

Query: 276 GKSTIVEVLMR 286
           G    +EV+ R
Sbjct: 347 GVDGEIEVMSR 357


>gi|90424617|ref|YP_532987.1| hypothetical protein RPC_3126 [Rhodopseudomonas palustris BisB18]
 gi|90106631|gb|ABD88668.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 355

 Score =  182 bits (460), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 83/251 (33%), Positives = 139/251 (55%), Gaps = 6/251 (2%)

Query: 39  ITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFG 98
           +   AR  ++   I + + W ++    ++       ++  G   +  L PG Y++  + G
Sbjct: 108 LALTARYGKDLPVIGNNLIWRVYSDRPDETGAFKLVREDRGATPNIVLPPGSYVVHVAHG 167

Query: 99  HVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLI 158
            V  V+ +T+  K +  ++ F+L AGG+R+       S I  ++++FSIY     +    
Sbjct: 168 LVSAVRPVTL--KSETDRESFVLPAGGLRIEGRVGS-SKIPQNQISFSIYKGSQFEVGER 224

Query: 159 TD---KVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKL 215
                 V +G +V L    Y I S+YG  N++V + ++V+ GK+ DV I +RAA IT KL
Sbjct: 225 APLLPNVAAGDVVLLQEGTYYIISNYGDANSVVRSDIRVQAGKLTDVIITHRAAVITLKL 284

Query: 216 VSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLT 275
           V + GGEA+A+TAWS++T  GD + ES  A P +VLSEG+Y  IA+N+ + + R F+V+ 
Sbjct: 285 VGDKGGEALANTAWSVITPGGDVIKESIGAFPRVVLSEGEYRAIAKNEGKVFERAFNVVN 344

Query: 276 GKSTIVEVLMR 286
           G    +EV+ R
Sbjct: 345 GVDGEIEVIAR 355


>gi|220926948|ref|YP_002502250.1| hypothetical protein Mnod_7208 [Methylobacterium nodulans ORS 2060]
 gi|219951555|gb|ACL61947.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 299

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 84/257 (32%), Positives = 137/257 (53%), Gaps = 6/257 (2%)

Query: 33  VVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYL 92
            V    ++  A LT     I  G++W I++  S+     +   +    + +F L PG YL
Sbjct: 46  AVPEAALSLRAVLTSEGKPIRGGLTWRIYEDRSDA-GRPAILARSEEAQPTFRLPPGSYL 104

Query: 93  ISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--N 150
            + ++G V   K++T++      +     NAG +RL       + I   +L F+I+    
Sbjct: 105 ANVTYGFVSTSKRVTLAPAGLTDQITV--NAGALRLAGAVG-DARIPGSQLAFAIFVPIG 161

Query: 151 PNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAK 210
            N +  L+ D V++G L+RL    Y + S +G  NAI    +KVE G+I D T+ +RAA 
Sbjct: 162 NNPEGRLVRDGVKAGELIRLPEGTYHVVSTWGDSNAIQRADLKVENGRITDATLNHRAAT 221

Query: 211 ITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSRE 270
           +T KLV+  G EA A TA+S+LT  GDT+ E+  A P + L+EG+Y +IAR+  R Y+++
Sbjct: 222 VTLKLVAAPGTEAFAGTAFSVLTPGGDTIREAIGAFPQVTLAEGEYQLIARHDGRVYTQD 281

Query: 271 FSVLTGKSTIVEVLMRQ 287
           F V +G    +E + + 
Sbjct: 282 FKVESGVDRDIEAIAKD 298


>gi|298291400|ref|YP_003693339.1| hypothetical protein Snov_1410 [Starkeya novella DSM 506]
 gi|296927911|gb|ADH88720.1| conserved hypothetical protein [Starkeya novella DSM 506]
          Length = 345

 Score =  179 bits (453), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 82/255 (32%), Positives = 133/255 (52%), Gaps = 7/255 (2%)

Query: 38  RITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF 97
            I   AR  +N   I  G+ W IF              +       F L PG Y++  S+
Sbjct: 80  AIGMSARFGDNDPFIPRGLVWRIFADRPEASGAYPLVAEAADPAPVFFLSPGGYVVHVSY 139

Query: 98  GHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL 157
           G   V ++I V   E+++++  +L+AGG+ L+S      PI   ++T+ I+     +   
Sbjct: 140 GLASVARRIVV--GEESRREQLLLSAGGVTLHS-DVSDKPIPAQKVTYDIFEGSFLQGRA 196

Query: 158 ITDKVRSGTLVR----LGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITF 213
            +     G        L   +Y + S YG+ NA++   V V PGK+ D T+ +RA +I  
Sbjct: 197 ASRPFYRGANSGELIVLPAGSYYVVSTYGEGNAVIQADVAVAPGKVTDATLHHRAGEIAL 256

Query: 214 KLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSV 273
           +LV   GG+ + DT WS+LT  GD+V ES N  P+ VL+EG+YT +AR + + Y++EF+V
Sbjct: 257 RLVKVAGGDPLPDTQWSVLTPGGDSVKESINTLPTFVLAEGEYTAVARYEGKTYTKEFTV 316

Query: 274 LTGKSTIVEVLMRQK 288
            +GK   VEV++ ++
Sbjct: 317 ESGKDGPVEVMLGEQ 331


>gi|319898840|ref|YP_004158933.1| hypothetical protein BARCL_0674 [Bartonella clarridgeiae 73]
 gi|319402804|emb|CBI76355.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 246

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 93/241 (38%), Positives = 141/241 (58%), Gaps = 4/241 (1%)

Query: 54  SGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEK 113
           SG+ W ++  I   +N L       GG   FDL PG YLI  SFGH   V+ +++ + + 
Sbjct: 2   SGLVWRVYAPILGNENKLLLVAIYEGGTARFDLKPGSYLIHVSFGHASSVEHVSLENGQH 61

Query: 114 NQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN--PNHKALLITDKVRSGTLVRLG 171
             K  F L+AGG+   S       I + EL F+IY +   N    +I   V++ ++VRL 
Sbjct: 62  LIKN-FNLDAGGVVFNSTL-FNGTINEKELRFTIYEDEKENDDTGVILANVKAQSVVRLK 119

Query: 172 TNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
             +Y + SHYG  NAI+ + ++VE GKI +VT++++AA+I  KLV + GGEA+ADT+WSI
Sbjct: 120 AGHYHVVSHYGSVNAIIRSDIQVEAGKITEVTLEHQAAQIILKLVRQEGGEALADTSWSI 179

Query: 232 LTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMD 291
              SGD + E+  +   +VL EGDY  IA+NK++ Y + FSV++G    V V+   K + 
Sbjct: 180 TNDSGDIIYETVGSYVLLVLVEGDYIAIAKNKDKIYQKVFSVISGHDKDVNVIANSKNIQ 239

Query: 292 K 292
           +
Sbjct: 240 Q 240


>gi|312114133|ref|YP_004011729.1| hypothetical protein Rvan_1371 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311219262|gb|ADP70630.1| hypothetical protein Rvan_1371 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 331

 Score =  177 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 91/304 (29%), Positives = 157/304 (51%), Gaps = 19/304 (6%)

Query: 1   MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQR---------------ITCEARL 45
           +  + + Y  + N+     +  +  +       ++A++               +T  A L
Sbjct: 29  VADAATKYKGSPNVVDGEEIPTDAEAVIPPDAGMEAEQPHSRPAPPNSGPPAPVTLTAYL 88

Query: 46  TENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK 105
           +E S  + + V W +F   + +  T     KI   + + +L PG YL++ ++G   + +K
Sbjct: 89  SEGSAPMVADVVWRVFQQRNARDGTYKIVTKIHEARPTIELKPGRYLVNVAYGRANLTRK 148

Query: 106 ITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN---PNHKALLITDKV 162
           I V  +  +  + F++NAGG+RL +    G  + +  L   IYS+          +   +
Sbjct: 149 IDVWPQTPS-NEDFVVNAGGLRLMATLAHGPIVAEHLLKLEIYSDAQDQTGNRQRLFGDL 207

Query: 163 RSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGE 222
           R G ++RL +  Y I S YG  N++VST + +EPGKI +  + + A K+T KLV   GGE
Sbjct: 208 RPGIVIRLNSGIYHIVSTYGDANSVVSTDIVIEPGKIAEANVDHDAGKVTLKLVQRRGGE 267

Query: 223 AVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVE 282
           AVA T W+I  A G+ + ESA A P+ VL+ G+Y V A++ ER ++  F++  G +T+VE
Sbjct: 268 AVAGTRWTIYNAGGEVIRESAGAFPTHVLAAGEYRVAAQHGERQFAGAFTIAAGDTTLVE 327

Query: 283 VLMR 286
           VLM+
Sbjct: 328 VLMQ 331


>gi|170744337|ref|YP_001772992.1| hypothetical protein M446_6292 [Methylobacterium sp. 4-46]
 gi|168198611|gb|ACA20558.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 312

 Score =  176 bits (445), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 81/251 (32%), Positives = 135/251 (53%), Gaps = 6/251 (2%)

Query: 39  ITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFG 98
           ++  A LT     I  G++W I++   +     +   +    + +F L PG YL + ++G
Sbjct: 65  LSLRAVLTSEGKPIRGGLTWRIYEDRGDA-GKPALLARSDEPQPTFRLAPGSYLANVTYG 123

Query: 99  HVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKAL 156
            V   K++T++      +     NAG +RL       + I   +L F+I+     N +  
Sbjct: 124 FVSTSKRVTLAPTGLQDQVTV--NAGALRLAGAVG-DARIPPGQLAFAIFVPIGNNPEGR 180

Query: 157 LITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLV 216
           L+ D V++G L+RL    Y + S +G  NAI    +KVE G+I D T+ +RAA +T KLV
Sbjct: 181 LVRDGVKAGELIRLPEGTYHVVSTWGDSNAIQRADLKVENGRITDATLNHRAATVTLKLV 240

Query: 217 SEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLTG 276
           +  G EA A TA+S+LT  GDT+ E+  A P + L+EG+Y +IAR+  + Y+++F V +G
Sbjct: 241 AAPGTEAFAGTAFSVLTPGGDTIREAIGAFPQVTLAEGEYQLIARHDGKVYTQDFKVESG 300

Query: 277 KSTIVEVLMRQ 287
               +E + + 
Sbjct: 301 VDRDIEAIAKD 311


>gi|163851741|ref|YP_001639784.1| hypothetical protein Mext_2318 [Methylobacterium extorquens PA1]
 gi|163663346|gb|ABY30713.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 349

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 79/251 (31%), Positives = 130/251 (51%), Gaps = 6/251 (2%)

Query: 38  RITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF 97
            +T  A     +  I SG++W ++    +     +   +      +F L  G Y+ + ++
Sbjct: 101 DLTLSAVFVGANGPIRSGLTWRVYGENGDGT-RPAIVARSNDPAPTFKLAAGAYVATVTY 159

Query: 98  GHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKA 155
           G+    K+IT++      +      A G    S       I  ++L FS+Y     N + 
Sbjct: 160 GYASASKRITMAGTANTDQLRV---AAGALKLSGAVGDQKIPGNQLGFSVYVPIGTNSEG 216

Query: 156 LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKL 215
            L+   +++G +VRL    Y + S YG  NAI    ++VE GK+ D T+ +RAA +T KL
Sbjct: 217 RLVRSGIKAGEIVRLPEGTYHVVSSYGDSNAIQRADLRVENGKVTDATMNHRAATVTLKL 276

Query: 216 VSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLT 275
           V+  G EA A TA+S+LT  GDT+ E+  A PS+ L+EGDY +IAR+  + ++REF V +
Sbjct: 277 VAAPGSEAFAGTAFSVLTPGGDTIREAIGAFPSVTLAEGDYVLIARHDGQVFTREFKVES 336

Query: 276 GKSTIVEVLMR 286
           G    +EV+ +
Sbjct: 337 GMDRDIEVVAK 347


>gi|158422573|ref|YP_001523865.1| hypothetical protein AZC_0949 [Azorhizobium caulinodans ORS 571]
 gi|158329462|dbj|BAF86947.1| hypothetical protein [Azorhizobium caulinodans ORS 571]
          Length = 382

 Score =  172 bits (434), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 84/253 (33%), Positives = 129/253 (50%), Gaps = 7/253 (2%)

Query: 38  RITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF 97
            +   AR   +  ++   V W +F              +       F L PG Y++  ++
Sbjct: 121 TLGVFARFGADGATVPRAVMWRVFADTPEASGAFPLVAESTEATPVFFLSPGGYIVHLTY 180

Query: 98  GHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL 157
           G+    +++ +     ++++ FIL AGG+RL +       I + +++F IY     +   
Sbjct: 181 GYATQAQRVVL--GATSRREAFILPAGGLRLQADVDN-KAITNSKVSFDIYEGSFLQGRT 237

Query: 158 ITDKVRSGT----LVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITF 213
            +  +  G     +V L    Y + S YG  NA+V   V V+ GK+ D  + +RAA+IT 
Sbjct: 238 SSQPLYRGALPNEVVLLPEGTYHVVSTYGDANAVVRADVTVQAGKLTDAMVHHRAAQITL 297

Query: 214 KLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSV 273
           KLV E GGEA+ADT WS++T  GDT+ ES  A P++VL+EG+Y  IARN  R  SR+F V
Sbjct: 298 KLVKEAGGEALADTQWSVITPGGDTIKESIGAFPTVVLTEGEYVAIARNDGRVVSRDFKV 357

Query: 274 LTGKSTIVEVLMR 286
             GK   VEVL  
Sbjct: 358 ELGKDKDVEVLAS 370


>gi|188581524|ref|YP_001924969.1| hypothetical protein Mpop_2272 [Methylobacterium populi BJ001]
 gi|179345022|gb|ACB80434.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 306

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 77/251 (30%), Positives = 134/251 (53%), Gaps = 6/251 (2%)

Query: 38  RITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF 97
            ++  A    ++  + SG++W ++    +     +   +      +F L  G Y+++ ++
Sbjct: 58  DLSLSAVFAGSNGPVRSGLTWRVYGENGDGT-RPAIVARSNDPAPTFKLAAGAYVVTVTY 116

Query: 98  GHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKA 155
           G+    K+IT++     ++      A G    S       I  ++L+FS+Y     N + 
Sbjct: 117 GYASASKRITMAGTANTEQLRV---AAGALKLSGAVGDQKIPGNQLSFSVYVPIGTNSEG 173

Query: 156 LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKL 215
            L+   +++G +VRL    Y + S YG  NAI    ++VE GK+ D T+ +RAA +T KL
Sbjct: 174 RLVRSGIKAGEIVRLPEGTYHVVSSYGDSNAIQRADLRVENGKVTDATMNHRAATVTLKL 233

Query: 216 VSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLT 275
           V+  G EA A TA+S+LT  GDT+ E+  A PS+ L+EGDY +IAR+  + ++REF V +
Sbjct: 234 VAAPGSEAFAGTAFSVLTPGGDTIREAIGAFPSVTLAEGDYVLIARHDGQVFTREFKVES 293

Query: 276 GKSTIVEVLMR 286
           G    +EV+ +
Sbjct: 294 GMDRDIEVVAK 304


>gi|254470478|ref|ZP_05083882.1| FHA domain containing protein [Pseudovibrio sp. JE062]
 gi|211960789|gb|EEA95985.1| FHA domain containing protein [Pseudovibrio sp. JE062]
          Length = 361

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 83/287 (28%), Positives = 132/287 (45%), Gaps = 6/287 (2%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSI 64
           +   + A  + T+           +   +     +   A+L E + ++  G+ W ++ S 
Sbjct: 75  YQGQSLAPTLGTSFLPYAPPAVSAEQAPIGAQPVLYLVAKLAEGTPNLTRGLKWRVYSSK 134

Query: 65  SNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAG 124
            N   +L+           F L PG YL+  SFG V    +  + S  K      ILNAG
Sbjct: 135 ENADGSLNMVASSQDQDAEFRLDPGTYLVHTSFGKVTATTRYELKSGVKTG--TIILNAG 192

Query: 125 GIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQITSHY 181
           GIRL +       +  +++ F+IY    +      LI   ++ G LV +    Y + S Y
Sbjct: 193 GIRLDAALGNDQKMPREDVRFNIYDMTYDATGDRGLIASGIKPGELVPVSAGTYHVESRY 252

Query: 182 GKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGE 241
           G  NA+V   + V+ GK+ + T+ ++A  IT KLVS     ++A+T+W+IL+  GDTV  
Sbjct: 253 GDINAVVRADIHVQAGKLTEATLYHQAGNITLKLVSAKNKTSLANTSWTILSPGGDTVAS 312

Query: 242 SANASPSMVLSEGDYTVIARNKERNYSREFSVLTGK-STIVEVLMRQ 287
              A   + L+ G YTV+ARN    Y  EF+V     +  VEVL   
Sbjct: 313 GNGAFLDLTLAAGTYTVMARNNGEMYRDEFTVNPSVNNVEVEVLAEN 359


>gi|254561512|ref|YP_003068607.1| hypothetical protein METDI3099 [Methylobacterium extorquens DM4]
 gi|254268790|emb|CAX24751.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 310

 Score =  170 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 79/251 (31%), Positives = 130/251 (51%), Gaps = 6/251 (2%)

Query: 38  RITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF 97
            +T  A     +  I SG++W ++    +     +   +      +F L  G Y+ + ++
Sbjct: 62  DLTLSAVFVGANGPIRSGLTWRVYGENGDGT-RPAIVARSNDPAPTFKLAAGAYVATVTY 120

Query: 98  GHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKA 155
           G+    K+IT++      +      A G    S       I  ++L FS+Y     N + 
Sbjct: 121 GYASASKRITMAGTANTDQLRV---AAGALKLSGAVGDQKIPGNQLGFSVYVPIGTNSEG 177

Query: 156 LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKL 215
            L+   +++G +VRL    Y + S YG  NAI    ++VE GK+ D T+ +RAA +T KL
Sbjct: 178 RLVRSGIKAGEIVRLPEGTYHVVSSYGDSNAIQRADLRVENGKVTDATMNHRAATVTLKL 237

Query: 216 VSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLT 275
           V+  G EA A TA+S+LT  GDT+ E+  A PS+ L+EGDY +IAR+  + ++REF V +
Sbjct: 238 VAAPGSEAFAGTAFSVLTPGGDTIREAIGAFPSVTLAEGDYVLIARHDGQVFTREFKVES 297

Query: 276 GKSTIVEVLMR 286
           G    +EV+ +
Sbjct: 298 GMDRDIEVVAK 308


>gi|218530546|ref|YP_002421362.1| hypothetical protein Mchl_2593 [Methylobacterium chloromethanicum
           CM4]
 gi|218522849|gb|ACK83434.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
          Length = 306

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 79/251 (31%), Positives = 130/251 (51%), Gaps = 6/251 (2%)

Query: 38  RITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF 97
            +T  A     +  I SG++W ++    +     +   +      +F L  G Y+ + ++
Sbjct: 58  DLTLSAVFVGANGPIRSGLTWRVYGENGDGT-RPAIVARSNDPAPTFKLAAGAYVATVTY 116

Query: 98  GHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKA 155
           G+    K+IT++      +      A G    S       I  ++L FS+Y     N + 
Sbjct: 117 GYASASKRITMAGTANTDQLRV---AAGALKLSGAVGDQKIPGNQLGFSVYVPIGTNSEG 173

Query: 156 LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKL 215
            L+   +++G +VRL    Y + S YG  NAI    ++VE GK+ D T+ +RAA +T KL
Sbjct: 174 RLVRSGIKAGEIVRLPEGTYHVVSSYGDSNAIQRADLRVENGKVTDATMNHRAATVTLKL 233

Query: 216 VSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLT 275
           V+  G EA A TA+S+LT  GDT+ E+  A PS+ L+EGDY +IAR+  + ++REF V +
Sbjct: 234 VAAPGSEAFAGTAFSVLTPGGDTIREAIGAFPSVTLAEGDYVLIARHDGQVFTREFKVES 293

Query: 276 GKSTIVEVLMR 286
           G    +EV+ +
Sbjct: 294 GMDRDIEVVAK 304


>gi|240138904|ref|YP_002963379.1| hypothetical protein MexAM1_META1p2319 [Methylobacterium extorquens
           AM1]
 gi|240008876|gb|ACS40102.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 310

 Score =  168 bits (426), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 78/251 (31%), Positives = 130/251 (51%), Gaps = 6/251 (2%)

Query: 38  RITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF 97
            ++  A     +  I SG++W ++    +     +   +      +F L  G Y+ + ++
Sbjct: 62  DLSLSAVFVGANGPIRSGLTWRVYGENGDGT-RPAIVARSNDPAPTFKLAAGAYVATVTY 120

Query: 98  GHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKA 155
           G+    K+IT++      +      A G    S       I  ++L FS+Y     N + 
Sbjct: 121 GYASASKRITMAGTANTDQLRV---AAGALKLSGAVGDQKIPGNQLGFSVYVPIGTNSEG 177

Query: 156 LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKL 215
            L+   +++G +VRL    Y + S YG  NAI    ++VE GK+ D T+ +RAA +T KL
Sbjct: 178 RLVRSGIKAGEIVRLPEGTYHVVSSYGDSNAIQRADLRVENGKVTDATMNHRAATVTLKL 237

Query: 216 VSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSVLT 275
           V+  G EA A TA+S+LT  GDT+ E+  A PS+ L+EGDY +IAR+  + ++REF V +
Sbjct: 238 VAAPGSEAFAGTAFSVLTPGGDTIREAIGAFPSVTLAEGDYVLIARHDGQVFTREFKVES 297

Query: 276 GKSTIVEVLMR 286
           G    +EV+ +
Sbjct: 298 GMDRDIEVVAK 308


>gi|296445038|ref|ZP_06886999.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
 gi|296257459|gb|EFH04525.1| conserved hypothetical protein [Methylosinus trichosporium OB3b]
          Length = 299

 Score =  168 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 77/269 (28%), Positives = 133/269 (49%), Gaps = 17/269 (6%)

Query: 39  ITCEARLTE-NSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASF 97
           +   A LT  ++  +  G+ W IF+             +      + +L  G Y++ A+F
Sbjct: 34  LRLSAVLTPADAAPVRGGIRWRIFEETPGDDGARRLVAETKDAAPAQELPDGVYIVHAAF 93

Query: 98  GHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIY--SNPNHKA 155
           G  G  +++ +     +++ V   NAGG++L       +PI    L  SIY     N +A
Sbjct: 94  GLAGATRRVVIEGGNVSERLVL--NAGGLKLI-DMLGDTPIPAQRLAISIYVPERGNSEA 150

Query: 156 LLITDKVRSGTLVRLGTNNYQITSHYGKY-----------NAIVSTVVKVEPGKIIDVTI 204
            L+    + G ++ L    Y I S                N++++  ++V  GK+I+ T+
Sbjct: 151 KLVLANAQGGEILCLPEGAYHIVSTLLDTTQGSQGDNNATNSVITADLRVAAGKLIEATL 210

Query: 205 QNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKE 264
           ++RAA +T KLV++ GGEA+A+T++S+LT  GD + E   A PS+VL+EG+Y VIAR+  
Sbjct: 211 RHRAATMTLKLVNQRGGEALANTSFSVLTPGGDVIRELIGAFPSLVLAEGEYVVIARHDG 270

Query: 265 RNYSREFSVLTGKSTIVEVLMRQKRMDKN 293
           + Y   F V + +   VE+  R +     
Sbjct: 271 KTYQETFRVQSTQDREVEISARAEASRDP 299


>gi|170746714|ref|YP_001752974.1| hypothetical protein Mrad2831_0265 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653236|gb|ACB22291.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 305

 Score =  167 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 77/271 (28%), Positives = 133/271 (49%), Gaps = 6/271 (2%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKI 77
           S  +                +++  A L+   T++  G++W I++   +     S   + 
Sbjct: 37  SPSITTPNLPPSLPPAEPEAQLSLSALLSGPGTALRQGLAWRIYEDRGDGT-RPSIVARS 95

Query: 78  IGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSP 137
              +  F L PG Y+ + ++G     K+I +  +           A  +           
Sbjct: 96  TEAEPHFTLAPGAYVATVTYGFASASKRIVMGGQPTTDTLRVAAGALKLAGAV---GDQK 152

Query: 138 IVDDELTFSIYS--NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVE 195
           I   ++TFS++     N +  L+   +++G L+RL    Y + S YG+ NAI    ++VE
Sbjct: 153 IPPGQVTFSVFVPVGTNSEGRLVRAGIKTGELLRLPEGTYHVVSTYGESNAIQRADLRVE 212

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ + T+ +RAA +T KLV+  G EA A TA+S+LT  GDT+ E+  A P + L+EGD
Sbjct: 213 NGKVTEATLNHRAATVTLKLVAAPGAEAFAGTAFSVLTPGGDTIREAIGAFPQVTLAEGD 272

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMR 286
           Y +IAR+  + Y+REF V +G    +EV+ +
Sbjct: 273 YVLIARHDGQVYTREFKVESGLDRDIEVVAK 303


>gi|323137839|ref|ZP_08072914.1| hypothetical protein Met49242DRAFT_2302 [Methylocystis sp. ATCC
           49242]
 gi|322396842|gb|EFX99368.1| hypothetical protein Met49242DRAFT_2302 [Methylocystis sp. ATCC
           49242]
          Length = 331

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 80/265 (30%), Positives = 131/265 (49%), Gaps = 17/265 (6%)

Query: 37  QRITCEARLT-ENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
             +   A L   ++  + SGV W IF+  +    +     +      +  L  G Y++ A
Sbjct: 61  STLHLTATLASNDAQPVRSGVVWRIFEERAQPDGSHKLVAQSEEAAPTLPLPDGAYVVHA 120

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIY--SNPNH 153
           S+G  GV ++I V    +N  +   LNAGG+++       + I    L+ SIY     N 
Sbjct: 121 SYGLAGVTRRIVVEG--RNISERVPLNAGGLKI-VDMLGETKIPPQRLSISIYVPERGNS 177

Query: 154 KALLITDKVRSGTLVRLGTNNYQITSHYGKY-----------NAIVSTVVKVEPGKIIDV 202
           +A L+    R   ++ L   +Y I S                N++V+  +KV  GK+I+ 
Sbjct: 178 EAKLVLANARGDEIISLPEGSYHIVSTLLDTTQGAQGGNNATNSVVTADLKVPAGKLIEA 237

Query: 203 TIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARN 262
           T+++ AA +T KLV   GGEA+A+T +S+LT  GD + E   A PS+VL+EG+Y  IAR+
Sbjct: 238 TLKHHAATMTLKLVKAPGGEALANTTFSVLTPGGDVIRELIGAFPSLVLAEGEYVAIARH 297

Query: 263 KERNYSREFSVLTGKSTIVEVLMRQ 287
           + + +   F V + K   VEV+ + 
Sbjct: 298 EGKTFQNTFRVQSTKDADVEVIAKD 322


>gi|182678787|ref|YP_001832933.1| hypothetical protein Bind_1816 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182634670|gb|ACB95444.1| conserved hypothetical protein [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 313

 Score =  162 bits (408), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 83/268 (30%), Positives = 135/268 (50%), Gaps = 14/268 (5%)

Query: 30  GKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPG 89
           G+       ++  A  T        GV+W IF+  +    T     +      +  L  G
Sbjct: 49  GEADTSRSTLSLSAYYTATDMQPVHGVTWRIFEEAAQPNGTHKMLVESANAMPALPLPDG 108

Query: 90  DYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIY- 148
            YLI A++G  G  K++ +S    +++ V   NAG +R+  +    +PI   +L  SIY 
Sbjct: 109 PYLIHAAYGLAGATKRVVLSGAPLSERIVL--NAGALRIVGMLGE-TPISPAKLRISIYV 165

Query: 149 -SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKY---------NAIVSTVVKVEPGK 198
               N +A L+    ++G ++ L   NY + S              N++V+  +KV+ GK
Sbjct: 166 PERGNSEAKLVLADGKAGDVIGLPEGNYHVVSTILDTVSGGAVNTTNSVVNADLKVQAGK 225

Query: 199 IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTV 258
           I D T+++ AA++T KLV+  GGEA+A+TA++ILT  GD + E   A PS+VL+ G+Y  
Sbjct: 226 ITDATLRHSAAQMTLKLVNNPGGEALANTAFTILTPGGDVIREMIGAFPSLVLAAGEYVA 285

Query: 259 IARNKERNYSREFSVLTGKSTIVEVLMR 286
           IAR+  + Y   F V++     VEVL +
Sbjct: 286 IARHDNKTYQTTFKVVSTLDRDVEVLAK 313


>gi|217976637|ref|YP_002360784.1| hypothetical protein Msil_0448 [Methylocella silvestris BL2]
 gi|217502013|gb|ACK49422.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 330

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 70/271 (25%), Positives = 122/271 (45%), Gaps = 12/271 (4%)

Query: 26  SKGKGKRVVDAQRITCEARLTE-NSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSF 84
                   V    +   A L+  ++  +  GV W +F+       +     +      + 
Sbjct: 62  QAPAKAEAVSGNILHLTAYLSATDAQPLRGGVHWRVFNERVELDGSHVLVAESTDSTPAL 121

Query: 85  DLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELT 144
            L  G +++ A+FG  G  K++T+  K     +   LNAG +R+  +             
Sbjct: 122 TLPDGAFIVHAAFGLAGATKRVTIEGKG--VSERVALNAGALRIMGLLGDAPLPATKSQI 179

Query: 145 FSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSH---------YGKYNAIVSTVVKVE 195
                  N+    +   ++SG  + L   NY + S              N++++  ++V+
Sbjct: 180 SVYVPERNNSEAKLVANIKSGETIGLPEGNYHVVSTLLDPQTTGAVNPTNSVINADLRVQ 239

Query: 196 PGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
            GK+ D ++++RAA +T KLVS   GEA+A+T+++ILT  GD + E   A PS+VL+EG+
Sbjct: 240 AGKLTDASLRHRAATMTLKLVSGPSGEALANTSFTILTPGGDVIREMIGAFPSLVLAEGE 299

Query: 256 YTVIARNKERNYSREFSVLTGKSTIVEVLMR 286
           Y  IAR+    Y   F V +     VEVL +
Sbjct: 300 YVAIARHDNNVYQTNFKVESTLDRDVEVLAK 330


>gi|304391868|ref|ZP_07373810.1| FHA domain-containing protein [Ahrensia sp. R2A130]
 gi|303296097|gb|EFL90455.1| FHA domain-containing protein [Ahrensia sp. R2A130]
          Length = 313

 Score =  159 bits (401), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 80/253 (31%), Positives = 133/253 (52%), Gaps = 7/253 (2%)

Query: 38  RITCEARLTENSTSIDSGVSWHIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISAS 96
           R+    +L  +   +  G+ W ++          L       GG  +FDL  G Y I A+
Sbjct: 64  RLVLSGKLVTDGPVLKDGMVWRVYRDRRGGDGEALPLIATATGGTGTFDLNAGTYFIHAA 123

Query: 97  FGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS---NPNH 153
           FG  G  K++ +S +   ++ V  L AGG++L +    G PI  ++L FSIY    + + 
Sbjct: 124 FGRAGAGKRVVLSGESSTEELV--LEAGGLQL-AASAAGKPIPSEKLRFSIYEREADESG 180

Query: 154 KALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITF 213
           +  LI   V    ++RL    Y + S YG  NA V   ++V+ G++    +Q+R + I+ 
Sbjct: 181 ERQLIALNVAGDKIIRLKAGTYHVLSRYGTINATVRADLQVKAGELTKAELQHRGSPISL 240

Query: 214 KLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSV 273
           + VSE GG AVA+TAW++ TA G+ V  S++ +PS+VL+EG+Y    R     + + F+V
Sbjct: 241 RAVSEAGGVAVANTAWTVFTADGEQVFASSSIAPSLVLAEGEYEAAVRYGAEEFRQPFTV 300

Query: 274 LTGKSTIVEVLMR 286
            TG+   +E+L+ 
Sbjct: 301 GTGEEKRIEILLN 313


>gi|300022609|ref|YP_003755220.1| hypothetical protein Hden_1085 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299524430|gb|ADJ22899.1| conserved hypothetical protein [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 353

 Score =  158 bits (400), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 84/265 (31%), Positives = 125/265 (47%), Gaps = 6/265 (2%)

Query: 37  QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
             +   A LT +   ID G+ W IF S            +         L PGDY ++A+
Sbjct: 69  PSLRLVALLTGDGQQIDEGLVWRIFQST-GPTGKAKLVLESHEATPLVKLQPGDYTVNAA 127

Query: 97  FGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHK-- 154
           FG   + +KI V +      + F+LNAGG+RL +             T+SIY++ + +  
Sbjct: 128 FGRANLTRKIAVKTGGPP-YEAFVLNAGGLRLGATVAGAPAAPGAV-TYSIYADDHDQFD 185

Query: 155 -ALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITF 213
              ++    +   ++RL +  Y+I S YG  NA +   V VE GK+ + ++ +   K TF
Sbjct: 186 SRSVVISGAKPNLIIRLNSGIYRIVSQYGDANAKIEADVTVEAGKLTEASVTHTGGKATF 245

Query: 214 KLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEGDYTVIARNKERNYSREFSV 273
           KLV+  GGEAV DT W+I T  G+ V ES  A P+ VL+ G Y V A +    Y   F +
Sbjct: 246 KLVTRSGGEAVPDTRWTIQTDDGEMVKESVGALPTHVLAPGKYIVTASSGGHLYKNRFEI 305

Query: 274 LTGKSTIVEVLMRQKRMDKNGQHNT 298
             G+   VEVLM    +       T
Sbjct: 306 ADGEVKNVEVLMAASALGARSAGAT 330


>gi|218677880|ref|ZP_03525777.1| hypothetical protein RetlC8_03042 [Rhizobium etli CIAT 894]
          Length = 254

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 85/226 (37%), Positives = 133/226 (58%), Gaps = 5/226 (2%)

Query: 7   SYAKAENMHTTSTL--LNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSI 64
           ++   + + ++S +  LN  I+ G        + +  EA+LT +S  ++ G+SW++F  I
Sbjct: 29  AFKDFKQLDSSSKMPKLNAFIAPGTAPEGAKLRDVAMEAKLTADSAPVEDGLSWYVFSPI 88

Query: 65  SNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAG 124
           +     L       GG  +F L PGDY ++ SFG  GV KK+TV +  +  KQV +L+AG
Sbjct: 89  AGTDGKLPLIASAKGGPAAFQLAPGDYFVNVSFGRAGVTKKLTVPADGEVGKQVMVLDAG 148

Query: 125 GIRLYSIYKPGSPIVDDELTFSIYSN---PNHKALLITDKVRSGTLVRLGTNNYQITSHY 181
           G+ L ++    + I  D+L+FSIYS+    + +  L+   V   T+VRL    Y I S Y
Sbjct: 149 GLLLNAVSGTDARIRPDQLSFSIYSSEVREDGERGLVMADVSPNTVVRLNAGTYHIVSEY 208

Query: 182 GKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADT 227
           G  NA++   ++VE GK+ + TIQ+RAA++TFKLVS+ GGEA+ADT
Sbjct: 209 GSVNAVIRADIQVEAGKLTEATIQHRAAQVTFKLVSDAGGEAIADT 254


>gi|217962847|ref|YP_002341425.1| collagen adhesion protein [Bacillus cereus AH187]
 gi|217063388|gb|ACJ77638.1| collagen adhesion protein [Bacillus cereus AH187]
          Length = 3392

 Score =  148 bits (373), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 44/325 (13%), Positives = 95/325 (29%), Gaps = 33/325 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++     T +N  + K +          +        +++ +   +   G  +
Sbjct: 2992 FVETKAPDHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELSKVDDVDGTALKGAVF 3051

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 3052 KIV-DMNGNDVRADLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQT 3110

Query: 114  NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
                V   N    G + L  +    GS +          +  + +A L TDK    ++  
Sbjct: 3111 TTASVTAKNSLTKGAVELTKVDDIDGSTLEGAIFKIVDMNGNDVRADLTTDKDGKISVSD 3170

Query: 170  LGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGGE 222
            L   +YQ                +   +     ++  VT         I    V      
Sbjct: 3171 LRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSIELTKVDMDHNG 3230

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FS 272
             +    ++IL   G  V      +         L  G+Y ++       Y  +     F+
Sbjct: 3231 TLEGAIFNILDQDGKVVREGLKTDGHGKLIINDLKPGNYQLVETKAPEGYQLDASPISFT 3290

Query: 273  VLTGKSTIVEVLMRQKRMDKNGQHN 297
            +   ++  +++ +  K+++ +   +
Sbjct: 3291 IEKAQAAPLQITVSNKKIESSSGGD 3315



 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 49/316 (15%), Positives = 93/316 (29%), Gaps = 35/316 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +   + KG+ K         +    +        + ++   G  
Sbjct: 2806 FIETKAPNHYDLNETPIKFTVKKGQEKIASVTAKNSLTKGAVELTKVDDIDGST-LEGAI 2864

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +     +         TV   +
Sbjct: 2865 FKIV-DMNGNDVRSDLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQ 2923

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V   N    G + L  +    GS +          +  + +A L TDK    ++ 
Sbjct: 2924 TATASVTAKNSLTKGAVELTKVDDIDGSTLEGAIFKIVDMNGNDVRADLTTDKDGKISVS 2983

Query: 169  RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       VE  +    ++          +    V ++ G
Sbjct: 2984 DLRPGDYQFVETKAPDHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELSKVDDVDG 3043

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EF 271
             A+    + I+  +G+ V      +         L  GDY  I      +Y        F
Sbjct: 3044 TALKGAVFKIVDMNGNDVRADLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINF 3103

Query: 272  SVLTGKSTIVEVLMRQ 287
            +V   ++T   V  + 
Sbjct: 3104 TVEKSQTTTASVTAKN 3119



 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 44/302 (14%), Positives = 86/302 (28%), Gaps = 31/302 (10%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T T      +    K  +    I        +      G  + I +  +N+    +    
Sbjct: 1697 TITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDTRTNLVTN 1756

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRL 128
              G  V  DL PG+Y +  +             + T+   ++    +   N    G ++L
Sbjct: 1757 SEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKL 1816

Query: 129  YSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
                   S I      F++      +    L TD      +  L   +YQ        + 
Sbjct: 1817 IKEDDVESSIALAGAVFTLQDANGTEIAKDLKTDDHGVIVIPDLAPGDYQFIETSAPEHY 1876

Query: 187  IVSTV---VKVEPGKIID------VTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGD 237
             +        ++ G   D      VT       +T   V ++ G  +    + I+ A   
Sbjct: 1877 KLDQTPIKFTIKKGSKDDLPVPVIVTNSLLTGGVTLTKVDDVDGATLEGAEFIIVDAHDT 1936

Query: 238  T-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLM 285
                      +      +  L  GDY  I     ++Y+       F++   +   + V  
Sbjct: 1937 KKVVRKELTTDKQGKVSASDLRPGDYQFIEVKAPKDYTLANDPIPFTIGKSQKENITVTA 1996

Query: 286  RQ 287
              
Sbjct: 1997 TN 1998



 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 100/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I KG+ K +       +    I        N     S   
Sbjct: 2244 FIETKAPKHYVLDETPIPFTIEKGQKKAISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2303

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2304 FNLLDQ-NGKVLKTDLKTNNEGKIVVENLRPGTYKFVETTAPKHYDLDKKPIVVTVEKSQ 2362

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K    V + N    GG+ L  +    G+ +               +  L T+     ++ 
Sbjct: 2363 KGIATVTMKNSLTKGGVELSKVDDVDGATLEGAVFNIVDMKGTVIRENLTTNSQGKISVP 2422

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    + ++ G
Sbjct: 2423 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQTEPISVTAKNSLTKGAVELSKMDDIDG 2482

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G+ V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2483 TALEGAVFKIVDMNGNDVRTGITTDAKGKVSIPDLHPGDYQFIETTAPKHYKLDATPIKF 2542

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2543 TIEKSQAEKLQVTAKN 2558



 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 44/287 (15%), Positives = 78/287 (27%), Gaps = 29/287 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    +        N  +  S   ++I      K    + T    G   + +L P
Sbjct: 2555 TAKNSLIEGAVELIKVDDINPDTKLSDAVFNII-DAKGKIVRTNLTTDKDGKVSASNLRP 2613

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY    +               T+   +     V   N    GG+ L  +    +    
Sbjct: 2614 GDYQFVETKAPKDYDLNNTPIPFTIEKSQTTHVSVTAKNGLTKGGVELTKVDSLDTKETL 2673

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
            +   F I     +     L+T+K        L   +YQ        +  ++       +E
Sbjct: 2674 EGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIKFTIE 2733

Query: 196  PGKIIDV----TIQNRAAKITF-KLVSEMGGEAVADTAWSILTASG-----DTVGESANA 245
              +   V    T       +   K+        +    + I+   G     D   +    
Sbjct: 2734 RSQKKHVFVTATNSLTKGSVELIKVDDVEKNTTLEGAVFKIVNKDGHDVRTDLTTDKNGR 2793

Query: 246  SPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                 L  GDY  I      +Y        F+V  G+  I  V  + 
Sbjct: 2794 LVVDELPPGDYEFIETKAPNHYDLNETPIKFTVKKGQEKIASVTAKN 2840



 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 38/286 (13%), Positives = 83/286 (29%), Gaps = 29/286 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
                 +    +T   ++ +   ++  G  + I   +   +   +      G     DL P
Sbjct: 1995 TATNSLKKGAVTLT-KIDDIDRTMLKGAIFKIV-DMKGNEVRTNLGTDKNGKISVSDLRP 2052

Query: 89   GDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY    +     +         T+   +  +  V   N    G + L  I    +    
Sbjct: 2053 GDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDIDTNTNL 2112

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVK 193
                F++           L T+      +  L    YQ        +       +   +K
Sbjct: 2113 ANAVFNLLDENGQVVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNNTPIEFTIK 2172

Query: 194  VEPGKIIDVTIQN--RAAKITFKLVSEMGGEAVADTAWSILTASGDT-----VGESANAS 246
                + + +T +N      +    V ++ G  +    ++I+   G       V  S    
Sbjct: 2173 KSQTETLHITAKNALTKGGVELSKVDDIDGTKLEGAVFNIVDMKGTVIHKDLVTNSKGKI 2232

Query: 247  PSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
                L  G+Y  I     ++Y        F++  G+   + +  + 
Sbjct: 2233 EIDDLRPGNYQFIETKAPKHYVLDETPIPFTIEKGQKKAISLTAKN 2278



 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKR-----VVDAQRITCEARLT---ENSTSIDSGV 56
            F   +  E+     T +   I KG         +V    +T    LT   +   +   G 
Sbjct: 1867 FIETSAPEHYKLDQTPIKFTIKKGSKDDLPVPVIVTNSLLTGGVTLTKVDDVDGATLEGA 1926

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1927 EFIIVDAHDTKKVVRKELTTDKQGKVSASDLRPGDYQFIEVKAPKDYTLANDPIPFTIGK 1986

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I     ++    L TDK    +
Sbjct: 1987 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKIVDMKGNEVRTNLGTDKNGKIS 2046

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2047 VSDLRPGDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDI 2106

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L  +G  V       +        L  G Y  +      +Y      
Sbjct: 2107 DTNTNLANAVFNLLDENGQVVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNNTP 2166

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + +  + 
Sbjct: 2167 IEFTIKKSQTETLHITAKN 2185



 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 53/306 (17%), Positives = 103/306 (33%), Gaps = 31/306 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+  +G  + I D+   KK 
Sbjct: 1595 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LAGAVFKIVDANDEKKV 1653

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +     V   N 
Sbjct: 1654 IRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTSPIKFTITESQTTSATVTAKNS 1713

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1714 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDTRTNLVTNSEGKLVVDDLRPGNYKL 1773

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGE---AVADTAW 229
                           +   ++    K++ +T +N   K   KL+ E   E   A+A   +
Sbjct: 1774 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSIALAGAVF 1833

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I  +   +Y  +     F++  G   
Sbjct: 1834 TLQDANGTEIAKDLKTDDHGVIVIPDLAPGDYQFIETSAPEHYKLDQTPIKFTIKKGSKD 1893

Query: 280  IVEVLM 285
             + V +
Sbjct: 1894 DLPVPV 1899



 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 96/319 (30%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++       +   I K + K V                 T++   +  +G  +
Sbjct: 1394 FVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAVF 1453

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    + T    G     DL PG Y    +             + T+   +
Sbjct: 1454 KIVDANDEKKVIRKNVTTGADGKVTVKDLEPGTYRFIETEAPKDYVLNTNPIEFTIDKSQ 1513

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L T+       
Sbjct: 1514 QSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIVDVNNNDVRTDLTTNADGKTKA 1573

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1574 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1633

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
            G A+A   + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1634 GTALAGAVFKIVDANDEKKVIRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTSP 1693

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++T   V  + 
Sbjct: 1694 IKFTITESQTTSATVTAKN 1712



 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/286 (12%), Positives = 77/286 (26%), Gaps = 33/286 (11%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
              +       ++     +G  + ++D           T    G     +L    YLI  +
Sbjct: 1149 GSLQIIKVDDKDQKVRLAGAEFTLYDQT-GTTAIRPITTGDDGVAKFNNLRRDKYLIKET 1207

Query: 97   FGHVGVVKK--------ITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIY 148
                G V          + + S+E  +         G  + +     S    +   FS+ 
Sbjct: 1208 KAPTGYVISKELREGILVELGSEEITKYTFTNKKFVGKVVLTKTDATSRERLEHAVFSLL 1267

Query: 149  SNP----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKII- 200
                        LIT+     T+  L    Y +       +  +      VK+   +   
Sbjct: 1268 DQNKQVIPEHKELITNDKGQITVDHLKPGTYYLQETKAPEHYKLDDRLIEVKIAEDQTTV 1327

Query: 201  ---DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMV 250
                 T            V +  G+ +A   +S+   +                   +  
Sbjct: 1328 INRTATNSLIPGAAILTKVDKD-GKTLAGAEFSVRDRNNIKVPGYEKLTTNDQGQIEAKD 1386

Query: 251  LSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
            L  GDY  +     ++Y  +     F+++  +   V V      + 
Sbjct: 1387 LRPGDYQFVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIK 1432


>gi|222098829|ref|YP_002532887.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus Q1]
 gi|221242888|gb|ACM15598.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus Q1]
          Length = 3404

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 44/325 (13%), Positives = 95/325 (29%), Gaps = 33/325 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++     T +N  + K +          +        +++ +   +   G  +
Sbjct: 3004 FVETKAPDHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELSKVDDVDGTALKGAVF 3063

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 3064 KIV-DMNGNDVRADLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQT 3122

Query: 114  NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
                V   N    G + L  +    GS +          +  + +A L TDK    ++  
Sbjct: 3123 TTASVTAKNSLTKGAVELTKVDDIDGSTLEGAIFKIVDMNGNDVRADLTTDKDGKISVSD 3182

Query: 170  LGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGGE 222
            L   +YQ                +   +     ++  VT         I    V      
Sbjct: 3183 LRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSIELTKVDMDHNG 3242

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FS 272
             +    ++IL   G  V      +         L  G+Y ++       Y  +     F+
Sbjct: 3243 TLEGAIFNILDQDGKVVREGLKTDGHGKLIINDLKPGNYQLVETKAPEGYQLDASPISFT 3302

Query: 273  VLTGKSTIVEVLMRQKRMDKNGQHN 297
            +   ++  +++ +  K+++ +   +
Sbjct: 3303 IEKAQAAPLQITVSNKKIESSSGGD 3327



 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 46/313 (14%), Positives = 83/313 (26%), Gaps = 33/313 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F       +     T +N  + K +        + +         ++ +       G  +
Sbjct: 2911 FIETKAPTHYDLNQTPINFTVEKSQTATASVIAKNSLTKGAVELTKVDDIDGVTLEGAVF 2970

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +               TV   + 
Sbjct: 2971 KIV-DMNGNDVRSDLTTNKDGKISVSDLRPGDYQFVETKAPDHYDLNQTPINFTVEKSQT 3029

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVR 169
                V   N    G    S              F I     +     L TDK    ++  
Sbjct: 3030 ATASVTATNSLTKGAVELSKVDDVDGTALKGAVFKIVDMNGNDVRADLTTDKDGKISVSD 3089

Query: 170  LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 3090 LRPGDYQFIETKAPTHYDLNQTPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGS 3149

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             +    + I+  +G+ V      +         L  GDY  I       Y        F+
Sbjct: 3150 TLEGAIFKIVDMNGNDVRADLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFT 3209

Query: 273  VLTGKSTIVEVLM 285
            +  G+S +  V  
Sbjct: 3210 ITKGQSQVTSVTA 3222



 Score =  131 bits (328), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/285 (14%), Positives = 80/285 (28%), Gaps = 27/285 (9%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
                 +    +           +   G  + I +           T    G  V  +L P
Sbjct: 2755 TATNSLTKGSVELIKVDDVEKNTTLEGAVFKIVNKD-GHDVRTDLTTDKNGRLVVDELPP 2813

Query: 89   GDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN---AGGIRLYSIYK-PGSPIV 139
            GDY    +     +       K TV   ++    V   N    G + L  +    GS + 
Sbjct: 2814 GDYEFIETKAPNHYDLNETPIKFTVKKGQEKIASVTAKNSLTKGAVELTKVDDIDGSTLE 2873

Query: 140  DDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEP 196
                     +  + ++ L TDK    ++  L   +YQ        +  ++       VE 
Sbjct: 2874 GAIFKIVDMNGNDVRSDLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEK 2933

Query: 197  GKIIDVTI----QNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV-----GESANASP 247
             +    ++          +    V ++ G  +    + I+  +G+ V             
Sbjct: 2934 SQTATASVIAKNSLTKGAVELTKVDDIDGVTLEGAVFKIVDMNGNDVRSDLTTNKDGKIS 2993

Query: 248  SMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
               L  GDY  +      +Y        F+V   ++    V    
Sbjct: 2994 VSDLRPGDYQFVETKAPDHYDLNQTPINFTVEKSQTATASVTATN 3038



 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/302 (14%), Positives = 86/302 (28%), Gaps = 31/302 (10%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T T      +    K  +    I        +      G  + I +  +N+    +    
Sbjct: 1709 TITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDTRTNLVTN 1768

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRL 128
              G  V  DL PG+Y +  +             + T+   ++    +   N    G ++L
Sbjct: 1769 SEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKL 1828

Query: 129  YSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
                   S I      F++      +    L TD      +  L   +YQ        + 
Sbjct: 1829 IKEDDVESSIALAGAVFTLQDANGTEIAKDLKTDDHGVIVIPDLAPGDYQFIETSAPEHY 1888

Query: 187  IVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGD 237
             +        ++ G        + VT       +T   V ++ G  +    + I+ A   
Sbjct: 1889 KLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGATLEGAEFIIVDAHDT 1948

Query: 238  T-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLM 285
                      +      +  L  GDY  I     ++Y+       F++   +   + V  
Sbjct: 1949 KKVVRKELTTDKQGKVSASDLRPGDYQFIEVKAPKDYTLANDPIPFTIGKSQKENITVTA 2008

Query: 286  RQ 287
              
Sbjct: 2009 TN 2010



 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 102/316 (32%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2256 FIETKAPKHYVLDETPIHFTIEKGQKKAISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2315

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2316 FNLLDQ-NGKVLKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQ 2374

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K+   V + N    GG+ L  +    G+ +               +  L T+     ++ 
Sbjct: 2375 KDIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMKGTVIRKSLTTNSQGKISVP 2434

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    + ++ G
Sbjct: 2435 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKMDDIDG 2494

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G+ V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2495 TALEGAVFKIVDMNGNDVRTGITTDAKGKVSIPDLHPGDYQFIETKAPKHYKLDATPIKF 2554

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2555 TIEKSQAEKLQVTAKN 2570



 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/317 (14%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I KG+ + +    + +        +++ +   +   G  +
Sbjct: 2443 FIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKMDDIDGTALEGAVF 2502

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +             K T+   + 
Sbjct: 2503 KIV-DMNGNDVRTGITTDAKGKVSIPDLHPGDYQFIETKAPKHYKLDATPIKFTIEKSQA 2561

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    +  
Sbjct: 2562 EKLQVTAKNSLIEGAVELIKVDDINPDTKLSDAVFNIIDAKGKIVRTNLTTDKDGKVSAS 2621

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  +   V++          +    V     
Sbjct: 2622 NLRPGDYQFVETKAPKHYDLNKTPIPFTIEKSQTTHVSVTAKNGLTKGGVELTKVDSLDA 2681

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2682 KETLEGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIK 2741

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F++   ++  V V    
Sbjct: 2742 FTIERSQTKHVFVTATN 2758



 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 53/310 (17%), Positives = 103/310 (33%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+  +G  + I D+   KK 
Sbjct: 1607 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LAGAVFKIVDANDEKKV 1665

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +     V   N 
Sbjct: 1666 IRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTSPIKFTITESQTTSATVTAKNS 1725

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1726 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDTRTNLVTNSEGKLVVDDLRPGNYKL 1785

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGE---AVADTAW 229
                           +   ++    K++ +T +N   K   KL+ E   E   A+A   +
Sbjct: 1786 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSIALAGAVF 1845

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I  +   +Y  +     F++  G   
Sbjct: 1846 TLQDANGTEIAKDLKTDDHGVIVIPDLAPGDYQFIETSAPEHYKLDQTPIKFTIKKGSKD 1905

Query: 280  IVEVLMRQKR 289
             + V +    
Sbjct: 1906 DLPVPVTVTN 1915



 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/319 (15%), Positives = 93/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   +  E+     T +   I KG    +     V    +T    LT   +   +   G 
Sbjct: 1879 FIETSAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGATLEGA 1938

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1939 EFIIVDAHDTKKVVRKELTTDKQGKVSASDLRPGDYQFIEVKAPKDYTLANDPIPFTIGK 1998

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I     ++    L TDK    +
Sbjct: 1999 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKIVDMKGNEVRTNLGTDKNGKIS 2058

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2059 VSDLRPGDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDI 2118

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  + +L A G  V       +        L  G Y  +      +Y      
Sbjct: 2119 DTNTKLANAVFDLLDADGQLVEKGLKTNNEGKIVVENLRPGTYQFVETIAPEHYDLNKKP 2178

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V  + 
Sbjct: 2179 IKFTIKKSQTETLHVTAKN 2197



 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 96/319 (30%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++       +   I K + K V                 T++   +  +G  +
Sbjct: 1406 FVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAVF 1465

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    + T    G     DL PG Y    +             + T+   +
Sbjct: 1466 KIVDANDEKKIIRKNVTTGADGKVTVKDLEPGTYRFIETEAPKDYVLNTNPIEFTIDKSQ 1525

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L T+       
Sbjct: 1526 QSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIVDVNNNDVRTDLTTNADGKTKA 1585

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1586 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1645

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
            G A+A   + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1646 GTALAGAVFKIVDANDEKKVIRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTSP 1705

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++T   V  + 
Sbjct: 1706 IKFTITESQTTSATVTAKN 1724



 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 87/298 (29%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   + + D+   +         
Sbjct: 2088 TIERSQTKEINVTGKNTLKKGSVELTKIDDIDTNTKLANAVFDLLDAD-GQLVEKGLKTN 2146

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA---GGIRL 128
              G  V  +L PG Y    +     +       K T+   +     V   NA   GG+ L
Sbjct: 2147 NEGKIVVENLRPGTYQFVETIAPEHYDLNKKPIKFTIKKSQTETLHVTAKNALTKGGVEL 2206

Query: 129  YSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
              +     + +          +       L+T+      +  L   +YQ        + +
Sbjct: 2207 SKVDDIDDTKLEGAVFNIVDMNGTVIHKDLVTNNKGKIEIDDLRPGDYQFIETKAPKHYV 2266

Query: 188  VSTV---VKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2267 LDETPIHFTIEKGQKKAISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVL 2326

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2327 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKDIATVTMKN 2384



 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/286 (13%), Positives = 79/286 (27%), Gaps = 33/286 (11%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
              +       ++     +G  + ++D         S T    G     +L    YLI  +
Sbjct: 1161 GSLQIIKVDDKDRKVPLAGAEFTLYDQT-GTTAIRSITTGDDGVAKFNNLRRDKYLIKET 1219

Query: 97   FGHVGVVKK--------ITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIY 148
                G V          + + S+E  +  +      G  + +     S    +   FS+ 
Sbjct: 1220 KAPQGYVISKELKEGILVELGSEEITKYTLTNKKFVGKVVLTKTDATSRERLEHAVFSLL 1279

Query: 149  SNP----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKII- 200
                        LIT+     T+  L    Y +       +  +      VK+   +   
Sbjct: 1280 DQNKQVIPEHKELITNDKGQITVDHLKPGTYYLQETKAPEHYKLDDRLIEVKIAEDQTTV 1339

Query: 201  ---DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMV 250
                 T            V +  G+ +A   +S+   +                   +  
Sbjct: 1340 INRTATNSLIPGAAILTKVDKD-GKTLAGAEFSVRDRNNIKVPGYEKLTTNDQGQIEAKD 1398

Query: 251  LSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
            L  GDY  +     ++Y  +     F+++  +   V V      + 
Sbjct: 1399 LRPGDYQFVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIK 1444



 Score = 99.2 bits (245), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 35/245 (14%), Positives = 69/245 (28%), Gaps = 29/245 (11%)

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--- 123
                   G      L PG Y +  +           + ++ ++  +         N+   
Sbjct: 1291 ELITNDKGQITVDHLKPGTYYLQETKAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIP 1350

Query: 124  GGIRLYSIYKPGSPIVDDELTFSIYSN--PNHKALLITDKVRSGTLVRLGTNNYQITSHY 181
            G   L  + K G  +   E +    +N        L T+         L   +YQ     
Sbjct: 1351 GAAILTKVDKDGKTLAGAEFSVRDRNNIKVPGYEKLTTNDQGQIEAKDLRPGDYQFVEEK 1410

Query: 182  GKYNA-----IVSTVVKVEPGKIIDVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTA 234
               +       +   +     K + VT  N      +T     ++ G A+A   + I+ A
Sbjct: 1411 APKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAVFKIVDA 1470

Query: 235  SG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVE 282
            +        +    +        L  G Y  I     ++Y       EF++   + +   
Sbjct: 1471 NDEKKIIRKNVTTGADGKVTVKDLEPGTYRFIETEAPKDYVLNTNPIEFTIDKSQQSFAT 1530

Query: 283  VLMRQ 287
            V    
Sbjct: 1531 VTATN 1535



 Score = 38.8 bits (88), Expect = 0.88,   Method: Composition-based stats.
 Identities = 26/200 (13%), Positives = 50/200 (25%), Gaps = 14/200 (7%)

Query: 105  KITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRS 164
              TV+      K        G          +     +         N   +L    + +
Sbjct: 1055 PTTVAVDGTLTKDTTNELKEGTDYKLKVTTDNDTGKQQFKVEFLHTINRAYILEYRSLIN 1114

Query: 165  GTLVRLGTNNYQIT---SHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGG 221
                   +N  +IT       +       VVKV  G       + R +    K+  +   
Sbjct: 1115 ADNNETVSNKVKITGNRLTLTQVETTEEKVVKVSSGSGGGSANKGRGSLQIIKVDDKDRK 1174

Query: 222  EAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNY------SRE 270
              +A   +++   +G T            +    L    Y +      + Y         
Sbjct: 1175 VPLAGAEFTLYDQTGTTAIRSITTGDDGVAKFNNLRRDKYLIKETKAPQGYVISKELKEG 1234

Query: 271  FSVLTGKSTIVEVLMRQKRM 290
              V  G   I +  +  K+ 
Sbjct: 1235 ILVELGSEEITKYTLTNKKF 1254


>gi|206975864|ref|ZP_03236775.1| collagen adhesion protein [Bacillus cereus H3081.97]
 gi|206745958|gb|EDZ57354.1| collagen adhesion protein [Bacillus cereus H3081.97]
          Length = 3386

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 44/325 (13%), Positives = 95/325 (29%), Gaps = 33/325 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++     T +N  + K +          +        +++ +   +   G  +
Sbjct: 2986 FVETKAPDHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELSKVDDVDGTALKGAVF 3045

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 3046 KIV-DMNGNDVRADLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQT 3104

Query: 114  NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
                V   N    G + L  +    GS +          +  + +A L TDK    ++  
Sbjct: 3105 TTASVTAKNSLTKGAVELTKVDDIDGSTLEGAIFKIVDMNGNDVRADLTTDKDGKISVSD 3164

Query: 170  LGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGGE 222
            L   +YQ                +   +     ++  VT         I    V      
Sbjct: 3165 LRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSIELTKVDMDHNG 3224

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FS 272
             +    ++IL   G  V      +         L  G+Y ++       Y  +     F+
Sbjct: 3225 TLEGAIFNILDQDGKVVREGLKTDGHGKLIINDLKPGNYQLVETKAPEAYQLDASPISFT 3284

Query: 273  VLTGKSTIVEVLMRQKRMDKNGQHN 297
            +   ++  +++ +  K+++ +   +
Sbjct: 3285 IEKAQAAPLQITVSNKKIESSSGGD 3309



 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 46/313 (14%), Positives = 83/313 (26%), Gaps = 33/313 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F       +     T +N  + K +        + +         ++ +       G  +
Sbjct: 2893 FIETKAPTHYDLNQTPINFTVEKSQTATASVIAKNSLTKGAVELTKVDDIDGVTLEGAVF 2952

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +               TV   + 
Sbjct: 2953 KIV-DMNGNDVRSDLTTNKDGKISVSDLRPGDYQFVETKAPDHYDLNQTPINFTVEKSQT 3011

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVR 169
                V   N    G    S              F I     +     L TDK    ++  
Sbjct: 3012 ATASVTATNSLTKGAVELSKVDDVDGTALKGAVFKIVDMNGNDVRADLTTDKDGKISVSD 3071

Query: 170  LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 3072 LRPGDYQFIETKAPTHYDLNQTPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGS 3131

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             +    + I+  +G+ V      +         L  GDY  I       Y        F+
Sbjct: 3132 TLEGAIFKIVDMNGNDVRADLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFT 3191

Query: 273  VLTGKSTIVEVLM 285
            +  G+S +  V  
Sbjct: 3192 ITKGQSQVTSVTA 3204



 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/285 (14%), Positives = 80/285 (28%), Gaps = 27/285 (9%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
                 +    +           +   G  + I +           T    G  V  +L P
Sbjct: 2737 TATNSLTKGSVELIKVDDVEKNTTLEGAVFKIVNKD-GHDVRTDLTTDKNGRLVVDELPP 2795

Query: 89   GDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN---AGGIRLYSIYK-PGSPIV 139
            GDY    +     +       K TV   ++    V   N    G + L  +    GS + 
Sbjct: 2796 GDYEFIETKAPNHYDLNETPIKFTVKKGQEKIASVTAKNSLTKGAVELTKVDDIDGSTLE 2855

Query: 140  DDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEP 196
                     +  + ++ L TDK    ++  L   +YQ        +  ++       VE 
Sbjct: 2856 GAIFKIVDMNGNDVRSDLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEK 2915

Query: 197  GKIIDVTI----QNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV-----GESANASP 247
             +    ++          +    V ++ G  +    + I+  +G+ V             
Sbjct: 2916 SQTATASVIAKNSLTKGAVELTKVDDIDGVTLEGAVFKIVDMNGNDVRSDLTTNKDGKIS 2975

Query: 248  SMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
               L  GDY  +      +Y        F+V   ++    V    
Sbjct: 2976 VSDLRPGDYQFVETKAPDHYDLNQTPINFTVEKSQTATASVTATN 3020



 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 43/302 (14%), Positives = 86/302 (28%), Gaps = 31/302 (10%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T T      +    K  +    I        +      G  + I +  +N+    +    
Sbjct: 1691 TITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDTRTNLVTN 1750

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRL 128
              G  V  DL PG+Y +  +             + T+   ++    +   N    G ++L
Sbjct: 1751 SEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKL 1810

Query: 129  YSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
                   S I      F++      +    L TD      +  L   +YQ        + 
Sbjct: 1811 IKEDDVESSIALAGAVFTLQDANGTEIAKDLKTDDHGVIVIPDLAPGDYQFIETSAPEHY 1870

Query: 187  IVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGD 237
             +        ++ G        + VT       +T   V ++ G  +    + I+ A   
Sbjct: 1871 KLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGATLEGAEFIIVDAHDT 1930

Query: 238  T-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLM 285
                      +      +  L  GDY  I     ++Y+       F++   +   + V  
Sbjct: 1931 KKVVRKELTTDKQGKVSASDLRPGDYQFIEVKAPKDYTLANDPIPFTIGKSQKENITVTA 1990

Query: 286  RQ 287
              
Sbjct: 1991 TN 1992



 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 100/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I KG+ K +       +    I        N     S   
Sbjct: 2238 FIETKAPKHYVLDETPIPFTIEKGQKKAISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2297

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2298 FNLLDQ-NGKVLKTDLKTNNEGKIVVENLRPGTYKFVETTAPKHYDLDKKPIVVTVEKSQ 2356

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K    V + N    GG+ L  +    G+ +               +  L T+     ++ 
Sbjct: 2357 KGIATVTMKNSLTKGGVELSKVDDVDGATLEGAVFNIVDMKGTVIRENLTTNSQGKISVP 2416

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    + ++ G
Sbjct: 2417 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQTEPISVTAKNSLTKGAVELSKMGDIDG 2476

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G+ V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2477 TALEGAVFKIVDMNGNDVRTGITTDAKGKVSIPDLHPGDYQFIETTAPKHYKLDATPIKF 2536

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2537 TIEKSQAEKLQVTAKN 2552



 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 44/287 (15%), Positives = 78/287 (27%), Gaps = 29/287 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    +        N  +  S   ++I      K    + T    G   + +L P
Sbjct: 2549 TAKNSLIEGAVELIKVDDINPDTKLSDAVFNII-DAKGKIVRTNLTTDKDGKVSASNLRP 2607

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY    +               T+   +     V   N    GG+ L  +    +    
Sbjct: 2608 GDYQFVETKAPKDYDLNNTPIPFTIEKSQTTHVSVTAKNGLTKGGVELTKVDSLDAKETL 2667

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
            +   F I     +     L+T+K        L   +YQ        +  ++       +E
Sbjct: 2668 EGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIKFTIE 2727

Query: 196  PGKIIDV----TIQNRAAKITF-KLVSEMGGEAVADTAWSILTASG-----DTVGESANA 245
              +   V    T       +   K+        +    + I+   G     D   +    
Sbjct: 2728 RSQTKHVFVTATNSLTKGSVELIKVDDVEKNTTLEGAVFKIVNKDGHDVRTDLTTDKNGR 2787

Query: 246  SPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                 L  GDY  I      +Y        F+V  G+  I  V  + 
Sbjct: 2788 LVVDELPPGDYEFIETKAPNHYDLNETPIKFTVKKGQEKIASVTAKN 2834



 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 38/286 (13%), Positives = 83/286 (29%), Gaps = 29/286 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
                 +    +T   ++ +   ++  G  + I   +   +   +      G     DL P
Sbjct: 1989 TATNSLKKGAVTLT-KIDDIDRTMLKGAIFKIV-DMKGNEVRTNLGTDKNGKISVSDLRP 2046

Query: 89   GDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY    +     +         T+   +  +  V   N    G + L  I    +    
Sbjct: 2047 GDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDIDTNTNL 2106

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVK 193
                F++           L T+      +  L    YQ        +       +   +K
Sbjct: 2107 ANAVFNLLDENGQVVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNNTPIEFTIK 2166

Query: 194  VEPGKIIDVTIQN--RAAKITFKLVSEMGGEAVADTAWSILTASGDT-----VGESANAS 246
                + + +T +N      +    V ++ G  +    ++I+   G       V  S    
Sbjct: 2167 KSQTETLHITAKNALTKGGVELSKVDDIDGTKLEGAVFNIVDMKGTVIHKDLVTNSKGKI 2226

Query: 247  PSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
                L  G+Y  I     ++Y        F++  G+   + +  + 
Sbjct: 2227 EIDDLRPGNYQFIETKAPKHYVLDETPIPFTIEKGQKKAISLTAKN 2272



 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   +  E+     T +   I KG    +     V    +T    LT   +   +   G 
Sbjct: 1861 FIETSAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGATLEGA 1920

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1921 EFIIVDAHDTKKVVRKELTTDKQGKVSASDLRPGDYQFIEVKAPKDYTLANDPIPFTIGK 1980

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I     ++    L TDK    +
Sbjct: 1981 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKIVDMKGNEVRTNLGTDKNGKIS 2040

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2041 VSDLRPGDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDI 2100

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L  +G  V       +        L  G Y  +      +Y      
Sbjct: 2101 DTNTNLANAVFNLLDENGQVVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNNTP 2160

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + +  + 
Sbjct: 2161 IEFTIKKSQTETLHITAKN 2179



 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 53/310 (17%), Positives = 103/310 (33%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+  +G  + I D+   KK 
Sbjct: 1589 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LAGAVFKIVDANDEKKV 1647

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +     V   N 
Sbjct: 1648 IRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTSPIKFTITESQTTSATVTAKNS 1707

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1708 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDTRTNLVTNSEGKLVVDDLRPGNYKL 1767

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGE---AVADTAW 229
                           +   ++    K++ +T +N   K   KL+ E   E   A+A   +
Sbjct: 1768 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSIALAGAVF 1827

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I  +   +Y  +     F++  G   
Sbjct: 1828 TLQDANGTEIAKDLKTDDHGVIVIPDLAPGDYQFIETSAPEHYKLDQTPIKFTIKKGSKD 1887

Query: 280  IVEVLMRQKR 289
             + V +    
Sbjct: 1888 DLPVPVTVTN 1897



 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 96/319 (30%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++       +   I K + K V                 T++   +  +G  +
Sbjct: 1388 FVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAVF 1447

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    + T    G     DL PG Y    +             + T+   +
Sbjct: 1448 KIVDANDEKKVIRKNVTTGADGKVTVKDLEPGTYRFIETEAPKDYVLNTNPIEFTIDKSQ 1507

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L T+       
Sbjct: 1508 QSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIVDVNNNDVRTDLTTNADGKTKA 1567

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1568 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1627

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
            G A+A   + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1628 GTALAGAVFKIVDANDEKKVIRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTSP 1687

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++T   V  + 
Sbjct: 1688 IKFTITESQTTSATVTAKN 1706



 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/286 (12%), Positives = 77/286 (26%), Gaps = 33/286 (11%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
              +       ++     +G  + ++D           T    G     +L    YLI  +
Sbjct: 1143 GSLQIIKVDDKDQKVRLAGAEFTLYDQT-GTTAIRPITTGDDGVAKFNNLRRDKYLIKET 1201

Query: 97   FGHVGVVKK--------ITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIY 148
                G V          + + S+E  +         G  + +     S    +   FS+ 
Sbjct: 1202 KAPTGYVISKELREGILVELGSEEITKYTFTNKKFVGKVVLTKTDATSRERLEHAVFSLL 1261

Query: 149  SNP----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKII- 200
                        LIT+     T+  L    Y +       +  +      VK+   +   
Sbjct: 1262 DQNKQVIPEHKELITNDKGQITVDHLKPGTYYLQETKAPEHYKLDDRLIEVKIAEDQTTV 1321

Query: 201  ---DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMV 250
                 T            V +  G+ +A   +S+   +                   +  
Sbjct: 1322 INRTATNSLIPGAAILTKVDKD-GKTLAGAEFSVRDRNNIKVPGYEKLTTNDQGQIEAKD 1380

Query: 251  LSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
            L  GDY  +     ++Y  +     F+++  +   V V      + 
Sbjct: 1381 LRPGDYQFVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIK 1426


>gi|229142101|ref|ZP_04270626.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
            BDRD-ST26]
 gi|228641390|gb|EEK97696.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
            BDRD-ST26]
          Length = 2360

 Score =  146 bits (367), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 44/325 (13%), Positives = 95/325 (29%), Gaps = 33/325 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++     T +N  + K +          +        +++ +   +   G  +
Sbjct: 1960 FVETKAPDHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELSKVDDVDGTALKGAVF 2019

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 2020 KIV-DMNGNDVRADLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQT 2078

Query: 114  NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
                V   N    G + L  +    GS +          +  + +A L TDK    ++  
Sbjct: 2079 TTASVTAKNSLTKGAVELTKVDDIDGSTLEGAIFKIVDMNGNDVRADLTTDKDGKISVSD 2138

Query: 170  LGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGGE 222
            L   +YQ                +   +     ++  VT         I    V      
Sbjct: 2139 LRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSIELTKVDMDHNG 2198

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FS 272
             +    ++IL   G  V      +         L  G+Y ++       Y  +     F+
Sbjct: 2199 TLEGAIFNILDQDGKVVREGLKTDGHGKLIINDLKPGNYQLVETKAPEGYQLDASPISFT 2258

Query: 273  VLTGKSTIVEVLMRQKRMDKNGQHN 297
            +   ++  +++ +  K+++ +   +
Sbjct: 2259 IEKAQAAPLQITVSNKKIESSSGGD 2283



 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 49/316 (15%), Positives = 93/316 (29%), Gaps = 35/316 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +   + KG+ K         +    +        + ++   G  
Sbjct: 1774 FIETKAPNHYDLNETPIKFTVKKGQEKIASVTAKNSLTKGAVELTKVDDIDGST-LEGAI 1832

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +     +         TV   +
Sbjct: 1833 FKIV-DMNGNDVRSDLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQ 1891

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V   N    G + L  +    GS +          +  + +A L TDK    ++ 
Sbjct: 1892 TATASVTAKNSLTKGAVELTKVDDIDGSTLEGAIFKIVDMNGNDVRADLTTDKDGKMSVS 1951

Query: 169  RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       VE  +    ++          +    V ++ G
Sbjct: 1952 DLRPGDYQFVETKAPDHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELSKVDDVDG 2011

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EF 271
             A+    + I+  +G+ V      +         L  GDY  I      +Y        F
Sbjct: 2012 TALKGAVFKIVDMNGNDVRADLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINF 2071

Query: 272  SVLTGKSTIVEVLMRQ 287
            +V   ++T   V  + 
Sbjct: 2072 TVEKSQTTTASVTAKN 2087



 Score =  126 bits (316), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 44/302 (14%), Positives = 86/302 (28%), Gaps = 31/302 (10%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
           T T      +    K  +    I        +      G  + I +  +N+    +    
Sbjct: 665 TITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDTRTNLVTN 724

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRL 128
             G  V  DL PG+Y +  +             + T+   ++    +   N    G ++L
Sbjct: 725 SEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKL 784

Query: 129 YSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
                  S I      F++      +    L TD      +  L   +YQ        + 
Sbjct: 785 IKEDDVESSIALAGAVFTLQDANGTEIAKDLKTDDHGVIVIPDLAPGDYQFIETSAPEHY 844

Query: 187 IVSTV---VKVEPGKIID------VTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGD 237
            +        ++ G   D      VT       +T   V ++ G  +    + I+ A   
Sbjct: 845 KLDQTPIKFTIKKGSKDDLPVPVIVTNSLLTGGVTLTKVDDVDGATLEGAEFIIVDAHDT 904

Query: 238 T-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLM 285
                     +      +  L  GDY  I     ++Y+       F++   +   + V  
Sbjct: 905 KKVVRKELTTDKQGKVSASDLRPGDYQFIEVKAPKDYTLANDPIPFTIGKSQKENITVTA 964

Query: 286 RQ 287
             
Sbjct: 965 TN 966



 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 100/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I KG+ K +       +    I        N     S   
Sbjct: 1212 FIETKAPKHYVLDETPIPFTIEKGQKKAISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 1271

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 1272 FNLLDQ-NGKVLKTDLKTNNEGKIVVENLRPGTYKFVETTAPKHYDLDKKPIVVTVEKSQ 1330

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K    V + N    GG+ L  +    G+ +               +  L T+     ++ 
Sbjct: 1331 KGIATVTMKNSLTKGGVELSKVDDVDGATLEGAVFNIVDMKGTVIRENLTTNSQGKISVP 1390

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    + ++ G
Sbjct: 1391 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQTEPISVTAKNSLTKGAVELSKMDDIDG 1450

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G+ V      ++        L  GDY  I     ++Y  +     F
Sbjct: 1451 TALEGAVFKIVDMNGNDVRTGITTDAKGKVSIPDLHPGDYQFIETTAPKHYKLDATPIKF 1510

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 1511 TIEKSQAEKLQVTAKN 1526



 Score =  120 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 44/287 (15%), Positives = 78/287 (27%), Gaps = 29/287 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    +        N  +  S   ++I      K    + T    G   + +L P
Sbjct: 1523 TAKNSLIEGAVELIKVDDINPDTKLSDAVFNII-DAKGKIVRTNLTTDKDGKVSASNLRP 1581

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY    +               T+   +     V   N    GG+ L  +    +    
Sbjct: 1582 GDYQFVETKAPKDYDLNNTPIPFTIEKSQTTHVSVTAKNGLTKGGVELTKVDSLDTKETL 1641

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
            +   F I     +     L+T+K        L   +YQ        +  ++       +E
Sbjct: 1642 EGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIKFTIE 1701

Query: 196  PGKIIDV----TIQNRAAKITF-KLVSEMGGEAVADTAWSILTASG-----DTVGESANA 245
              +   V    T       +   K+        +    + I+   G     D   +    
Sbjct: 1702 RSQKKHVFVTATNSLTKGSVELIKVDDVEKNTTLEGAVFKIVNKDGHDVRTDLTTDKNGR 1761

Query: 246  SPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                 L  GDY  I      +Y        F+V  G+  I  V  + 
Sbjct: 1762 LVVDELPPGDYEFIETKAPNHYDLNETPIKFTVKKGQEKIASVTAKN 1808



 Score =  120 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/286 (13%), Positives = 83/286 (29%), Gaps = 29/286 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
                 +    +T   ++ +   ++  G  + I   +   +   +      G     DL P
Sbjct: 963  TATNSLKKGAVTLT-KIDDIDRTMLKGAIFKIV-DMKGNEVRTNLGTDKNGKISVSDLRP 1020

Query: 89   GDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY    +     +         T+   +  +  V   N    G + L  I    +    
Sbjct: 1021 GDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDIDTNTNL 1080

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVK 193
                F++           L T+      +  L    YQ        +       +   +K
Sbjct: 1081 ANAVFNLLDENGQVVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNNTPIEFTIK 1140

Query: 194  VEPGKIIDVTIQN--RAAKITFKLVSEMGGEAVADTAWSILTASGDT-----VGESANAS 246
                + + +T +N      +    V ++ G  +    ++I+   G       V  S    
Sbjct: 1141 KSQTETLHITAKNALTKGGVELSKVDDIDGTKLEGAVFNIVDMKGTVIHKDLVTNSKGKI 1200

Query: 247  PSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
                L  G+Y  I     ++Y        F++  G+   + +  + 
Sbjct: 1201 EIDDLRPGNYQFIETKAPKHYVLDETPIPFTIEKGQKKAISLTAKN 1246



 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKR-----VVDAQRITCEARLT---ENSTSIDSGV 56
            F   +  E+     T +   I KG         +V    +T    LT   +   +   G 
Sbjct: 835  FIETSAPEHYKLDQTPIKFTIKKGSKDDLPVPVIVTNSLLTGGVTLTKVDDVDGATLEGA 894

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 895  EFIIVDAHDTKKVVRKELTTDKQGKVSASDLRPGDYQFIEVKAPKDYTLANDPIPFTIGK 954

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I     ++    L TDK    +
Sbjct: 955  SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKIVDMKGNEVRTNLGTDKNGKIS 1014

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 1015 VSDLRPGDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDI 1074

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L  +G  V       +        L  G Y  +      +Y      
Sbjct: 1075 DTNTNLANAVFNLLDENGQVVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNNTP 1134

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + +  + 
Sbjct: 1135 IEFTIKKSQTETLHITAKN 1153



 Score =  114 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 53/306 (17%), Positives = 103/306 (33%), Gaps = 31/306 (10%)

Query: 10  KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
           +AE +  T           K +  +    +        + T+  +G  + I D+   KK 
Sbjct: 563 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LAGAVFKIVDANDEKKV 621

Query: 70  -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
              +      G  ++  L PGDY          +       K T++  +     V   N 
Sbjct: 622 IRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTSPIKFTITESQTTSATVTAKNS 681

Query: 123 --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
              GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 682 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDTRTNLVTNSEGKLVVDDLRPGNYKL 741

Query: 178 TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGE---AVADTAW 229
                          +   ++    K++ +T +N   K   KL+ E   E   A+A   +
Sbjct: 742 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSIALAGAVF 801

Query: 230 SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
           ++  A+G  +      +         L+ GDY  I  +   +Y  +     F++  G   
Sbjct: 802 TLQDANGTEIAKDLKTDDHGVIVIPDLAPGDYQFIETSAPEHYKLDQTPIKFTIKKGSKD 861

Query: 280 IVEVLM 285
            + V +
Sbjct: 862 DLPVPV 867



 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 96/319 (30%), Gaps = 36/319 (11%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
           F      ++       +   I K + K V                 T++   +  +G  +
Sbjct: 362 FVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAVF 421

Query: 59  HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            I D+   KK    + T    G     DL PG Y    +             + T+   +
Sbjct: 422 KIVDANDEKKVIRKNVTTGADGKVTVKDLEPGTYRFIETEAPKDYVLNTNPIEFTIDKSQ 481

Query: 113 ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                      L  G + L  + + G         F I    N + +  L T+       
Sbjct: 482 QSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIVDVNNNDVRTDLTTNADGKTKA 541

Query: 168 VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
            +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 542 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 601

Query: 221 GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
           G A+A   + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 602 GTALAGAVFKIVDANDEKKVIRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTSP 661

Query: 271 --FSVLTGKSTIVEVLMRQ 287
             F++   ++T   V  + 
Sbjct: 662 IKFTITESQTTSATVTAKN 680



 Score =  102 bits (254), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 37/286 (12%), Positives = 77/286 (26%), Gaps = 33/286 (11%)

Query: 37  QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
             +       ++     +G  + ++D           T    G     +L    YLI  +
Sbjct: 117 GSLQIIKVDDKDQKVRLAGAEFTLYDQT-GTTAIRPITTGDDGVAKFNNLRRDKYLIKET 175

Query: 97  FGHVGVVKK--------ITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIY 148
               G V          + + S+E  +         G  + +     S    +   FS+ 
Sbjct: 176 KAPTGYVISKELREGILVELGSEEITKYTFTNKKFVGKVVLTKTDATSRERLEHAVFSLL 235

Query: 149 SNP----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKII- 200
                       LIT+     T+  L    Y +       +  +      VK+   +   
Sbjct: 236 DQNKQVIPEHKELITNDKGQITVDHLKPGTYYLQETKAPEHYKLDDRLIEVKIAEDQTTV 295

Query: 201 ---DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMV 250
                T            V +  G+ +A   +S+   +                   +  
Sbjct: 296 INRTATNSLIPGAAILTKVDKD-GKTLAGAEFSVRDRNNIKVPGYEKLTTNDQGQIEAKD 354

Query: 251 LSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
           L  GDY  +     ++Y  +     F+++  +   V V      + 
Sbjct: 355 LRPGDYQFVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIK 400


>gi|324329307|gb|ADY24567.1| cell wall anchor domain-containing protein [Bacillus thuringiensis
            serovar finitimus YBT-020]
          Length = 3196

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 41/302 (13%), Positives = 85/302 (28%), Gaps = 28/302 (9%)

Query: 22   NNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGK 81
               I+    K  +    +        +  +   G  + I   ++        T    G  
Sbjct: 2788 QEKIASVTVKNSLTKGAVELTKVDDVDGAT-LEGAVFKII-DMNGNDVRTDLTTDKDGKI 2845

Query: 82   VSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRLYSIYK 133
               DL PGDY    +               TV   +     V   N    G + L  +  
Sbjct: 2846 SVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDD 2905

Query: 134  -PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----I 187
              GS +          +  + +  L TDK    ++  L   +YQ                
Sbjct: 2906 IDGSTLEGAIFKIVDMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKTPTGYDLNAKP 2965

Query: 188  VSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV-----G 240
            +   +     ++  VT         I    V       +    ++IL   G  V      
Sbjct: 2966 IPFTITKGQSQVTSVTALNSLTTGSIELTKVDMDHNGTLEGAIFNILDQDGKVVREGLKT 3025

Query: 241  ESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMDKNGQ 295
            +         L  G+Y ++       Y  +     F++   ++  +++ +  K+++ +  
Sbjct: 3026 DGHGKLIINDLKPGNYQLVETKAPEGYQLDASPISFTIEKAQAAPLQITVSNKKIESSSG 3085

Query: 296  HN 297
             +
Sbjct: 3086 GD 3087



 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/283 (14%), Positives = 81/283 (28%), Gaps = 27/283 (9%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
                 +    +           +   G  + I +           T    G  V  +L P
Sbjct: 2701 TATNSLTKGSVELIKVDDVEENTTLEGAVFKIVNKD-GHDVRTDLTTNKNGRLVVDELPP 2759

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRLYSIYK-PGSPIV 139
            GDY    +             K TV   ++    V + N    G + L  +    G+ + 
Sbjct: 2760 GDYEFIETKAPTHYVLNETPIKFTVKKGQEKIASVTVKNSLTKGAVELTKVDDVDGATLE 2819

Query: 140  DDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEP 196
                     +  + +  L TDK    ++  L   +YQ        +  ++       VE 
Sbjct: 2820 GAVFKIIDMNGNDVRTDLTTDKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEK 2879

Query: 197  GKIIDVTIQ----NRAAKITFKLVSEMGGEAVADTAWSILTASGDTV-----GESANASP 247
             +    ++          +    V ++ G  +    + I+  +G+ V      +      
Sbjct: 2880 SQTTTASVTAKNSLTKGAVELTKVDDIDGSTLEGAIFKIVDMNGNDVRTDLTTDKDGKIS 2939

Query: 248  SMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLM 285
               L  GDY  I       Y        F++  G+S +  V  
Sbjct: 2940 VSDLRPGDYQFIETKTPTGYDLNAKPIPFTITKGQSQVTSVTA 2982



 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
                 +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1647 KNTNPIKFTITESQTTSATVTAKNSLTKGGIELIKVNAADEKETLEGAVFKIVNRDTNED 1706

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1707 VRAELVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1766

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S I      F++      +    L T+      +  L   +YQ  
Sbjct: 1767 LTKGKVKLIKEDDVESSIALAGAVFTLQDATGKEIAKDLKTNDYGVLVIPDLAPGDYQFI 1826

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + VT       +T   V ++ G  +    +
Sbjct: 1827 ETSAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGATLEGAEF 1886

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y        F++   +
Sbjct: 1887 IIVDAHDTKKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYDLRQDPIPFTIGKSQ 1946

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1947 KENISVTATN 1956



 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/317 (14%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I KG+ + +    + +        +++ +   +   G  +
Sbjct: 2389 FIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKMDDIDGTALEGAVF 2448

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +             K T+   + 
Sbjct: 2449 KIV-DMNGNDVRTGITTDAKGKVSIPDLHPGDYQFIETTAPKHYKLDATPIKFTIEKSQA 2507

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    +  
Sbjct: 2508 EKLQVTAKNSLIEGAVELIKVDDINPDTKLSDAVFNIIDAKGKIVRTNLTTDKDGKVSAS 2567

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  +   V++          +    V     
Sbjct: 2568 NLRPGDYQFVETKAPKHYDLNKTPIPFTIEKSQTTHVSVTAKNGLTKGGVELTKVDSLDA 2627

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2628 KETLEGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIK 2687

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F++   ++  V V    
Sbjct: 2688 FTIERSQTKHVFVTATN 2704



 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 45/316 (14%), Positives = 101/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2202 FIETKAPKHYVLDETPIHFTIEKGQKKAISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2261

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        + V   +
Sbjct: 2262 FNLLDQ-NGKVLKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVIVEKSQ 2320

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K+   V + N    GG+ L  +    G+ +               +  L T+     ++ 
Sbjct: 2321 KDIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMKGTVIRKNLTTNSQGKISVP 2380

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    + ++ G
Sbjct: 2381 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKMDDIDG 2440

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G+ V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2441 TALEGAVFKIVDMNGNDVRTGITTDAKGKVSIPDLHPGDYQFIETTAPKHYKLDATPIKF 2500

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2501 TIEKSQAEKLQVTAKN 2516



 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/319 (15%), Positives = 93/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   +  E+     T +   I KG    +     V    +T    LT   +   +   G 
Sbjct: 1825 FIETSAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGATLEGA 1884

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1885 EFIIVDAHDTKKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYDLRQDPIPFTIGK 1944

Query: 111  KEKNQKQVFILN----AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             +K    V   N     G I         + +          +    +  L+TD     +
Sbjct: 1945 SQKENISVTATNSLTKGGVILTKIDDIDRTMLKGAIFKVVDMNGNEVRTNLVTDDNGDIS 2004

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   NYQ        + ++        +E  +   +T+      +   +    + + 
Sbjct: 2005 VSDLRPGNYQFIETTAPEHYVLDETPIPFTIERSQTKKITVTGKNTLKKGSVELTKIDDI 2064

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  + +L A G+ V       +        L  G Y  +      +Y      
Sbjct: 2065 DTNTKLANAVFDLLDADGEIVEKGLKTNNEGKIVVENLRPGTYQFVETIAPEHYDLNKKP 2124

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V  + 
Sbjct: 2125 IKFTIKKSQTETLHVTAKN 2143



 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 54/310 (17%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1553 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1611

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +     V   N 
Sbjct: 1612 IRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNPIKFTITESQTTSATVTAKNS 1671

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +A L+T+      +  L   NY++
Sbjct: 1672 LTKGGIELIKVNAADEKETLEGAVFKIVNRDTNEDVRAELVTNSEGKLVVDDLRPGNYKL 1731

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGE---AVADTAW 229
                           +   ++    K++ +T +N   K   KL+ E   E   A+A   +
Sbjct: 1732 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSIALAGAVF 1791

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +                L+ GDY  I  +   +Y  +     F++  G   
Sbjct: 1792 TLQDATGKEIAKDLKTNDYGVLVIPDLAPGDYQFIETSAPEHYKLDQTPIKFTIKKGSKD 1851

Query: 280  IVEVLMRQKR 289
             + V +    
Sbjct: 1852 DLPVPVTVTN 1861



 Score =  115 bits (287), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++       +   I K + K V                 T++   +  +G  +
Sbjct: 1352 FVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAVF 1411

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    + T    G     DL PG Y    +             + T+   +
Sbjct: 1412 KIVDANDEKKVIRENVTTGADGKVTVKDLEPGTYKFIETEAPKDYVLNTNPIEFTIDKSQ 1471

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1472 QSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIVDVNNNDVRTDLTTDADGKTKA 1531

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1532 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1591

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
            G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1592 GTALEGAVFKIVDANDEKKVIRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNP 1651

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++T   V  + 
Sbjct: 1652 IKFTITESQTTSATVTAKN 1670



 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/298 (13%), Positives = 87/298 (29%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   + + D+   +         
Sbjct: 2034 TIERSQTKKITVTGKNTLKKGSVELTKIDDIDTNTKLANAVFDLLDAD-GEIVEKGLKTN 2092

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA---GGIRL 128
              G  V  +L PG Y    +     +       K T+   +     V   NA   GG+ L
Sbjct: 2093 NEGKIVVENLRPGTYQFVETIAPEHYDLNKKPIKFTIKKSQTETLHVTAKNALTKGGVEL 2152

Query: 129  YSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
              +    G+ +          +       L+T+      +  L   +YQ        + +
Sbjct: 2153 SKVDDIDGTKLEGAVFNIVDMNGNVIHKDLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2212

Query: 188  VSTV---VKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2213 LDETPIHFTIEKGQKKAISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVL 2272

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +       V   +  I  V M+ 
Sbjct: 2273 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVIVEKSQKDIATVTMKN 2330



 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 36/286 (12%), Positives = 76/286 (26%), Gaps = 33/286 (11%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
              +       ++     +G  + ++D           T    G     +L    YLI  +
Sbjct: 1107 GSLQIMKVDDKDQKVRLAGAEFTLYDQT-GTTAIRPITTGDDGVAKFNNLRRDKYLIKET 1165

Query: 97   FGHVGVVKK--------ITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIY 148
                G V          + + S+E  +         G  + +     S    +   FS+ 
Sbjct: 1166 KAPTGYVISKELREGILVELGSEEITKYTFTNKKFVGKVVLTKTDAKSRERLEHAVFSLL 1225

Query: 149  SNP----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKII- 200
                        L T+     T+  L    Y +       +  +      VK+   +   
Sbjct: 1226 DQNKQVIPEHKELTTNDKGQITVDNLKPGTYYLKETKAPEHYKLDDRLIEVKIAEDQTTV 1285

Query: 201  ---DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMV 250
                 T            V +  G+ +A   +S+   +                   +  
Sbjct: 1286 INRTATNSLIPGAAILTKVDKD-GKTLAGAEFSVRDRNNIKIPGYEKLTTNDQGQIEAKD 1344

Query: 251  LSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
            L  GDY  +     ++Y  +     F+++  +   V V      + 
Sbjct: 1345 LRPGDYQFVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIK 1390



 Score = 83.1 bits (203), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/225 (14%), Positives = 60/225 (26%), Gaps = 23/225 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +N  + K          K  +    +        + ++   G  
Sbjct: 2857 FVETKAPTHYDLNQTPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGST-LEGAI 2915

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +    G          T++  +
Sbjct: 2916 FKIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKTPTGYDLNAKPIPFTITKGQ 2974

Query: 113  KNQKQVFILN---AGGIRLYSIYKP-GSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V  LN    G I L  +       +               +  L TD      + 
Sbjct: 2975 SQVTSVTALNSLTTGSIELTKVDMDHNGTLEGAIFNILDQDGKVVREGLKTDGHGKLIIN 3034

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRA 208
             L   NYQ+               +S  ++      + +T+ N+ 
Sbjct: 3035 DLKPGNYQLVETKAPEGYQLDASPISFTIEKAQAAPLQITVSNKK 3079


>gi|196040999|ref|ZP_03108296.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
            NVH0597-99]
 gi|196028167|gb|EDX66777.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
            NVH0597-99]
          Length = 3314

 Score =  142 bits (358), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 44/326 (13%), Positives = 89/326 (27%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +N  + K          K  +    +        + T+   G  
Sbjct: 2898 FIETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGTT-LEGAI 2956

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I D  +        T    G     DL PGDY    +     +         TV   +
Sbjct: 2957 FKIVDQ-NGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQTPINFTVEKSQ 3015

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                 V   N    G    +          +   F I     +     L TDK    ++ 
Sbjct: 3016 TATASVTATNSLTKGAVELTKVDDIDGATLEGAVFKIVDMNGNDVRTDLTTDKDGKISVS 3075

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         +    V     
Sbjct: 3076 DLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 3135

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 3136 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 3195

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   +++ +++ +  K+++ +   +
Sbjct: 3196 TIEKAQASPLQITVSNKKVESSSGGD 3221



 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 47/313 (15%), Positives = 91/313 (29%), Gaps = 33/313 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F       +     T +   + KG+ K        +        +++ +   S   G  +
Sbjct: 2805 FIETKAPTHYKLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSALKGAVF 2864

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 2865 KIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQT 2923

Query: 114  NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
                V   N    G + L  +    G+ +          +  + +  L TDK    ++  
Sbjct: 2924 ATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDQNGNDVRTDLTTDKDGKISVSD 2983

Query: 170  LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 2984 LRPGDYQFIETKAPKHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGA 3043

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             +    + I+  +G+ V      +         L  GDY  I       Y        F+
Sbjct: 3044 TLEGAVFKIVDMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFT 3103

Query: 273  VLTGKSTIVEVLM 285
            +  G+S +  V  
Sbjct: 3104 ITKGQSQVTSVTA 3116



 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/290 (13%), Positives = 83/290 (28%), Gaps = 31/290 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    I        +      G  + I +  +N+    +      G  V  DL P
Sbjct: 1708 TAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDARTNLVTNSEGKLVVDDLRP 1767

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIVD 140
            G+Y +  +             + T+   ++    +   N    G ++L       S I  
Sbjct: 1768 GNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNSLTKGKVKLIKEDDVESSIAL 1827

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
                F++      +    L TD+     +  L   +YQ        +  +        ++
Sbjct: 1828 AGAVFTLQDANGTEIAKDLKTDEHGVLVIPDLAPGDYQFIETAAPEHYKLDQTPIKFTIK 1887

Query: 196  PGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT-------VGES 242
             G        + V        +T   V ++ G  +    + I+ A             + 
Sbjct: 1888 KGSKDDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEFIIVDAHDTEKVVRKGLTTDE 1947

Query: 243  ANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
                 +  L  GDY  I     ++Y+       F++   +   + V    
Sbjct: 1948 HGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGKSQKENITVTATN 1997



 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 98/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2243 FIETKAPKHYVLDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2302

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2303 FNLLDQ-NGKVIKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQ 2361

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKAL--LITDKVRSGTLV 168
            KN   V + N    G    S          +   F+I           L T+     ++ 
Sbjct: 2362 KNIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMNGTVIRKSLTTNSQGKISVP 2421

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    V ++ G
Sbjct: 2422 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDG 2481

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G  V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2482 TALEGAIFKIVDMNGHDVRTGITTDAKGKISISDLHPGDYQFIETTAPKHYKLDATPIKF 2541

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2542 TIEKSQAEKLQVTAKN 2557



 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/319 (15%), Positives = 96/319 (30%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   A  E+     T +   I KG    +     V    +T    LT   +   +   G 
Sbjct: 1866 FIETAAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1925

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1926 EFIIVDAHDTEKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGK 1985

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I     ++    L+TDK     
Sbjct: 1986 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKIVDMDGNEVRTNLVTDKNGKIY 2045

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2046 VPDLRPGDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDI 2105

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L A G+ V       +        L  G Y  +      +Y      
Sbjct: 2106 DTDTKLANAVFNLLDADGEIVEEGLTTNAEGKIVVENLRPGTYQFVETIAPEHYDLNKTP 2165

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + V  + 
Sbjct: 2166 IEFTIKKSQTETLHVTAKN 2184



 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/287 (14%), Positives = 76/287 (26%), Gaps = 29/287 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    +           +  S   ++I      K    + T    G   + +L P
Sbjct: 2554 TAKNSLIEGAVELIKVDDITPDTKLSDAVFNII-DAKGKVVRTNLTTDKDGKISASNLRP 2612

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY                    T+   +     V   N    GG+ L  I    +    
Sbjct: 2613 GDYQFVEMKAPKDYDLNETPIPFTIEKSQSTHVSVTAKNGLTKGGVELTKIDSLDTKETL 2672

Query: 141  DELTFSIYS--NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
            +   F I      + +  L+T+K        L   +YQ        +  ++       +E
Sbjct: 2673 EGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNETPIKFTIE 2732

Query: 196  PGKIIDVTIQ----NRAAKITF-KLVSEMGGEAVADTAWSILTASG-----DTVGESANA 245
              +   V +          +   K+        +    + I+   G     D   +    
Sbjct: 2733 RSQTKHVFVTAINSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHNVRTDLTTDKNGR 2792

Query: 246  SPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                 L  GDY  I      +Y        F+V  G+  I  V    
Sbjct: 2793 LVVDELPPGDYEFIETKAPTHYKLNETPIKFTVKKGQEKIASVTATN 2839



 Score =  114 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/298 (13%), Positives = 87/298 (29%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++ D+   +      T  
Sbjct: 2075 TIERSQTKEINVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLTTN 2133

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +       + T+   +     V   NA   G    
Sbjct: 2134 AEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIKKSQTETLHVTAKNALTKGAVEL 2193

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S          +   F+I           L+T+      +  L   +YQ        + +
Sbjct: 2194 SKVDDIDGTKLEGAVFNIVDMNGTVIHKNLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2253

Query: 188  VST---VVKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2254 LDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVI 2313

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2314 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKNIATVTMKN 2371



 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 38/308 (12%), Positives = 76/308 (24%), Gaps = 32/308 (10%)

Query: 11   AENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNT 70
            A  +  T      + +       +    +               G  + I   ++N    
Sbjct: 1500 ANPIEFTIDKSQQSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIV-DVNNNDVR 1558

Query: 71   LSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA-- 123
               T    G   +  L PG Y    +             + T+   +K    V   NA  
Sbjct: 1559 TDLTTDADGKTKADKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALK 1618

Query: 124  GGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSGTLVRLGTNNYQITS 179
             G    +              F I    +     +  + T          L   +Y+   
Sbjct: 1619 PGDVELTKVDDIDGTALAGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIE 1678

Query: 180  HYGKYNAIVST---VVKVEPGK-----IIDVTIQNRAAKITFKLVS-EMGGEAVADTAWS 230
                     +T      ++  +      +          I    V+     E +    + 
Sbjct: 1679 VTAPKYYDKNTKPIEFTIKESQGISPITVTAKNSLTKGGIELTKVNAADEKETLEGAVFK 1738

Query: 231  ILTASGDT------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKST 279
            I+    +       V  S        L  G+Y +I       Y       EF++  G+ T
Sbjct: 1739 IVNRDTNEDARTNLVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQT 1798

Query: 280  IVEVLMRQ 287
            ++ +  + 
Sbjct: 1799 LLPLTFKN 1806



 Score =  108 bits (270), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 36/312 (11%), Positives = 86/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1121 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNTLLTGAEFTLY-DRTGKTVIR 1179

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1180 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVALGTQETTTYKLANKKF 1239

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1240 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNKGQITVEHLKPGTYYLK 1299

Query: 179  SHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +      VK+   +        T            V +  G+ +    +S+
Sbjct: 1300 ETKAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIPGSAILTKVDKD-GKTLTGAEFSV 1358

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                 + +               +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1359 RDRHNNVIRGYEKLTTNDQGQIEATNLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKK 1418

Query: 280  IVEVLMRQKRMD 291
             V V      + 
Sbjct: 1419 AVTVTATNHLIK 1430



 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 46/320 (14%), Positives = 97/320 (30%), Gaps = 37/320 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++     T +   I K + K V                 T++   +  +G  +
Sbjct: 1392 FVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAIF 1451

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    +      G     DL PG Y    +             + T+   +
Sbjct: 1452 KIVDANDEKKVIRENVKTGTDGKVTVKDLEPGTYKFIETEAPKDYVLNANPIEFTIDKSQ 1511

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1512 QSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIVDVNNNDVRTDLTTDADGKTKA 1571

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1572 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1631

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            G A+A   + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1632 GTALAGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKP 1691

Query: 270  -EFSVLTGK-STIVEVLMRQ 287
             EF++   +  + + V  + 
Sbjct: 1692 IEFTIKESQGISPITVTAKN 1711



 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/281 (13%), Positives = 76/281 (27%), Gaps = 30/281 (10%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNK-KNTLSTTKKIIGGKVSFDLFPGDYLISA 95
             ++        N      G  + + D            T    G      L PG Y +  
Sbjct: 1241 GKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNKGQITVEHLKPGTYYLKE 1300

Query: 96   SFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSI 147
            +           + ++ ++  +         N+   G   L  + K G  +   E +   
Sbjct: 1301 TKAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIPGSAILTKVDKDGKTLTGAEFSVRD 1360

Query: 148  YSNP--NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKII 200
              N        L T+         L   +YQ        +       +   +     K +
Sbjct: 1361 RHNNVIRGYEKLTTNDQGQIEATNLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKKAV 1420

Query: 201  DVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMVL 251
             VT  N      +T     ++ G A+A   + I+ A+        +    +        L
Sbjct: 1421 TVTATNHLIKGGVTLTKTDDIDGTALAGAIFKIVDANDEKKVIRENVKTGTDGKVTVKDL 1480

Query: 252  SEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
              G Y  I     ++Y       EF++   + +   V    
Sbjct: 1481 EPGTYKFIETEAPKDYVLNANPIEFTIDKSQQSFATVTATN 1521



 Score = 81.9 bits (200), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 39/276 (14%), Positives = 76/276 (27%), Gaps = 29/276 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +N  + K +           +    +        +  +   G  
Sbjct: 2991 FIETKAPKHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGAT-LEGAV 3049

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +    G          T++  +
Sbjct: 3050 FKIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQ 3108

Query: 113  KNQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V  LN    G + L  +       +               +  L TD      + 
Sbjct: 3109 SQVTSVTALNSLTTGSMELTKVDIDHNGTLEGAIFNILDQDGKVVREGLKTDGHGKLIVN 3168

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITF----KLVSEM 219
             L   NYQ+               +S  ++      + +T+ N+  + +     K ++  
Sbjct: 3169 DLKPGNYQLVETKAPEGYQLDASPISFTIEKAQASPLQITVSNKKVESSSGGDNKPITPP 3228

Query: 220  GGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
              E       S    +G+   E+     S  L  G+
Sbjct: 3229 NKEEKPGKETSEELENGNP--ETHGKETSEELENGN 3262


>gi|228911197|ref|ZP_04075002.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            IBL 200]
 gi|228848373|gb|EEM93222.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            IBL 200]
          Length = 3153

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 43/326 (13%), Positives = 95/326 (29%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGK-------RVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++       +   I + + K         +    +           +   G  
Sbjct: 2748 FIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTKGSVELIKVDDAKKNTTLEGAV 2807

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +           T    G  V  +L PGDY    +     +       K TV   +
Sbjct: 2808 FKIVNKD-GHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNETPIKFTVKKGQ 2866

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            +    V   N    G + L  +    G+ +             + ++ L TDK    ++ 
Sbjct: 2867 EKIASVTATNSLTKGAVELIKVDDIDGTTLEGAIFKIVDMDGKDVRSDLTTDKDGKISVS 2926

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         I    V     
Sbjct: 2927 DLRPGDYQFIEMKAPTGYDLNVKPIPFTITKGQTQVTSVTALNSLTTGSIELTKVDIDHH 2986

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G+ +      +         L  G+Y +I     + Y  +     F
Sbjct: 2987 GTLEGAIFNILDQDGNVIREGLKTDQQGKVIINDLKPGNYQLIETKAPKGYQLDASPINF 3046

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++T +++ +  K+++ +   +
Sbjct: 3047 TIDKAQATPLQITVSNKKIESSSGGD 3072



 Score =  129 bits (323), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 40/310 (12%), Positives = 86/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               +++  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1725 KNTKSIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1784

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1785 VRTDLVTNSKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1844

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1845 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDAHGVLVIPDLAPGDYQFI 1904

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1905 EVKAPEHYKLDQTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTPLEGAEF 1964

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  +     ++Y+       F++   +
Sbjct: 1965 IIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFVEVKAPKDYTLSKEPIPFTIEKSQ 2024

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 2025 KENITVTATN 2034



 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 95/316 (30%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++   +   +   I K + + +      + +       ++ +   ++  G  +
Sbjct: 2000 FVEVKAPKDYTLSKEPIPFTIEKSQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIF 2059

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKEK 113
             I   ++ K+   +      G     DL PGDY    +      V        T+   + 
Sbjct: 2060 KIV-DMNGKEVHTNLVTDKNGKISVSDLRPGDYQFIETKAPEHYVLEETQIPFTIERSQT 2118

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
             +  V   NA   G + L  I             F++           L T+      + 
Sbjct: 2119 KEINVTGKNALKKGSVELTKIDDIDINTKLANAVFNLLDADGELVEEGLKTNDEGKIVVE 2178

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQN--RAAKITFKLVSEMGG 221
             L    YQ        +       +   +K    +++ VT  N      +    V ++ G
Sbjct: 2179 NLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTEVLHVTATNALTKGAVKLSKVDDVDG 2238

Query: 222  EAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              + D  + I+  +GD      V           L  GDY  I     ++Y  +     F
Sbjct: 2239 TVLKDAVFKIVNMNGDVVHKDLVTNDQGLIEINDLRPGDYQFIETKAPKDYVLDETPIKF 2298

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++  G+   + +    
Sbjct: 2299 TIEKGQKKSISLTATN 2314



 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 88/319 (27%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K + + +               +++ +   ++   
Sbjct: 2184 TYQFVETIAPEHYDLDKKPIVFTIKKSQTEVLHVTATNALTKGAVKLSKVDDVDGTVLKD 2243

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSS 110
              + I + ++             G     DL PGDY    +             K T+  
Sbjct: 2244 AVFKIVN-MNGDVVHKDLVTNDQGLIEINDLRPGDYQFIETKAPKDYVLDETPIKFTIEK 2302

Query: 111  KEK---NQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNH--KALLITDKVRSG 165
             +K   +      L  G I L  +          +  F++        K  L T+     
Sbjct: 2303 GQKKSISLTATNSLKQGSIELLKVDDLNDQTKLADAIFNLLDQNGKVLKTDLKTNSEGKI 2362

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST-----VVKVEPGKIIDVTIQN--RAAKITFKLVSE 218
             +  L    YQ        +  +        +K     I  VT++N      +    V  
Sbjct: 2363 VVENLRPGTYQFVETTAPEHYDLDEKPIIFTIKKSQKDIATVTMKNTLTKGSVELSKVDN 2422

Query: 219  MGGEAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            + G  +    + I+  +G       V           L  GDY  I     ++Y      
Sbjct: 2423 VDGTTLEGAVFKIVDMNGTVIRKDLVTNQHGKISISDLRPGDYQFIETTAPKHYDLNKEP 2482

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2483 IPFTITKSQTEPISVTATN 2501



 Score =  122 bits (306), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 46/298 (15%), Positives = 93/298 (31%), Gaps = 29/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T      +I+    K  +    +        + T+   G  + I   ++           
Sbjct: 2393 TIKKSQKDIATVTMKNTLTKGSVELSKVDNVDGTT-LEGAVFKIV-DMNGTVIRKDLVTN 2450

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN---AGGIRL 128
              G     DL PGDY    +     +         T++  +     V   N    G + L
Sbjct: 2451 QHGKISISDLRPGDYQFIETTAPKHYDLNKEPIPFTITKSQTEPISVTATNSLTKGTVEL 2510

Query: 129  YSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA- 186
              +    G+ + D     +  +  + +  L TD     ++  L   +YQ        +  
Sbjct: 2511 SKVDDVDGTALKDAIFKITDMNGNDIRTELTTDVHGKISVSDLRPGDYQFIETKAPEHYK 2570

Query: 187  ----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSILTASGDTV 239
                 +   +K    + + VT  N   +   +L+          ++D  ++I+ A G  V
Sbjct: 2571 LDSTPIKFTIKKSQKEKLKVTATNSLTEGAVELIKVDDINPDTKLSDAVFNIIDAKGKIV 2630

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
                  +      +  L  GDY  I     ++Y       +F++   + T V V  + 
Sbjct: 2631 RTDLTTDKDGKISATNLRPGDYQFIETKAPKHYDLNKTPIDFTIEKSQLTHVSVTAKN 2688



 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 48/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1903 FIEVKAPEHYKLDQTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTPLEGA 1962

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1963 EFIIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFVEVKAPKDYTLSKEPIPFTIEK 2022

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 2023 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2082

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2083 VSDLRPGDYQFIETKAPEHYVLEETQIPFTIERSQTKEINVTGKNALKKGSVELTKIDDI 2142

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2143 DINTKLANAVFNLLDADGELVEEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2202

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++ ++ V    
Sbjct: 2203 IVFTIKKSQTEVLHVTATN 2221



 Score =  122 bits (305), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 48/318 (15%), Positives = 87/318 (27%), Gaps = 36/318 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVV-------DAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I K + +++            +        N  +  S   
Sbjct: 2560 FIETKAPEHYKLDSTPIKFTIKKSQKEKLKVTATNSLTEGAVELIKVDDINPDTKLSDAV 2619

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            ++I      K      T    G   + +L PGDY    +     +         T+   +
Sbjct: 2620 FNII-DAKGKIVRTDLTTDKDGKISATNLRPGDYQFIETKAPKHYDLNKTPIDFTIEKSQ 2678

Query: 113  KNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
                 V   N    GG+ L  +       + +   F I     +     L+T+K      
Sbjct: 2679 LTHVSVTAKNGLTKGGVELTKVDSIDKKEMLEGAVFKITDMNGNDIRTNLVTNKDGKIIA 2738

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITF-KLVSEM 219
              L   +YQ        +  ++       +E  +   V +          +   K+    
Sbjct: 2739 KNLQPGDYQFIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTKGSVELIKVDDAK 2798

Query: 220  GGEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE---- 270
                +    + I+   G     D   +         L  GDY  I      +Y       
Sbjct: 2799 KNTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNETPI 2858

Query: 271  -FSVLTGKSTIVEVLMRQ 287
             F+V  G+  I  V    
Sbjct: 2859 KFTVKKGQEKIASVTATN 2876



 Score =  121 bits (304), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 51/310 (16%), Positives = 101/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  + +  +        + T+   G  + I D+   K  
Sbjct: 1631 RAEPIEFTIDRSQKETLLVKAENALKSGDVELTKVDDIDGTA-LEGAVFKIVDANDEKTV 1689

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
                      G   +  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1690 IRTDLKTGSDGKVTATGLRPGDYKFIEVTAPKYYDKNTKSIKFTITESQTTQATVTAKNS 1749

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1750 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYKL 1809

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1810 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1869

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      ++        L+ GDY  I      +Y  +     F++  G   
Sbjct: 1870 TLQDATGKEIMKDLTTDAHGVLVIPDLAPGDYQFIEVKAPEHYKLDQTPIKFTIKKGSKE 1929

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1930 DLPIPVTVKN 1939



 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/321 (14%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+       L   I K + K +                ++ +   +   G  +
Sbjct: 1428 FVEEKAPEHYEIDKKPLKFTIEKSQQKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1487

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1488 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGTYKFIETEAPKDYTLSTNPIEFTIDKSQ 1547

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1548 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1607

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     ++  +    V +
Sbjct: 1608 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKSGDVELTKVDD 1667

Query: 219  MGGEAVADTAWSILTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+ +           S     +  L  GDY  I     + Y +  
Sbjct: 1668 IDGTALEGAVFKIVDANDEKTVIRTDLKTGSDGKVTATGLRPGDYKFIEVTAPKYYDKNT 1727

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1728 KSIKFTITESQTTQATVTAKN 1748



 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/320 (11%), Positives = 88/320 (27%), Gaps = 33/320 (10%)

Query: 3    ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
            I+ +S    E       ++  +   G G        +  +     +   I SGV + +F 
Sbjct: 1149 ITGNSLKLTETEKIEEIVVKVSSGSGGGSATKGRGNLQIKKVDNADPNKILSGVVFTLF- 1207

Query: 63   SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKN 114
              +      + T    G     +L   +YL+       G V          + + ++E  
Sbjct: 1208 DRTGTTAIRTITTDDNGIAQFNNLKRDEYLLREMQTLDGYVISKELKAGKLVKLGAEETT 1267

Query: 115  QKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA----LLITDKVRSGTLVRL 170
               +      G  + +     +        FS+    ++       LIT+     T+  L
Sbjct: 1268 TYTLKNEKFVGKVVLTKTDAHNKEKLKNAVFSLLDQNHNVIPEHKELITNDKGQITVDNL 1327

Query: 171  GTNNYQITSHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEA 223
                Y +       +  +       K+E  +      +              V +  G  
Sbjct: 1328 KPGTYYLKEIKAPEHYQLDDQLIEFKIEEDQTTVINKEAQNSLIRGSAILTKVDKE-GNT 1386

Query: 224  VADTAWSILTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
            +    +S+   +   +               +  L  G+Y  +      +Y  +     F
Sbjct: 1387 LEGAVFSVRDRNNKKISGYTKLTTNGNGQIEAKNLLPGEYQFVEEKAPEHYEIDKKPLKF 1446

Query: 272  SVLTGKSTIVEVLMRQKRMD 291
            ++   +   + V      + 
Sbjct: 1447 TIEKSQQKALTVTATNHLIK 1466



 Score = 73.0 bits (177), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 31/308 (10%), Positives = 91/308 (29%), Gaps = 24/308 (7%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
             K+ +++ T+  ++  ++K     + + +    +     N+      + +      +   
Sbjct: 1070 EKSFHLYATTVAVDGTLTKDTTNELKEGKDYKLKITTDNNTGKQQFTIEFLHTIDRAYIL 1129

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRL 128
               S        KVS         +  +      +++I V     +         G +++
Sbjct: 1130 EYRSLINADNNEKVSNKAKITGNSLKLTE--TEKIEEIVVKVSSGSGGGSATKGRGNLQI 1187

Query: 129  YSIYKPGSPIVDDELTFSIYSNPNHK--ALLITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
              +       +   + F+++          + TD         L  + Y +         
Sbjct: 1188 KKVDNADPNKILSGVVFTLFDRTGTTAIRTITTDDNGIAQFNNLKRDEYLLREMQTLDGY 1247

Query: 187  IVSTV------VKVEPGKIIDVTIQNRA--AKITFKLVSEMGGEAVADTAWSILTASGDT 238
            ++S        VK+   +    T++N     K+          E + +  +S+L  + + 
Sbjct: 1248 VISKELKAGKLVKLGAEETTTYTLKNEKFVGKVVLTKTDAHNKEKLKNAVFSLLDQNHNV 1307

Query: 239  V-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMR 286
            +                  L  G Y +       +Y  +     F +   ++T++    +
Sbjct: 1308 IPEHKELITNDKGQITVDNLKPGTYYLKEIKAPEHYQLDDQLIEFKIEEDQTTVINKEAQ 1367

Query: 287  QKRMDKNG 294
               +  + 
Sbjct: 1368 NSLIRGSA 1375


>gi|225867339|ref|YP_002752717.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus 03BB102]
 gi|225788083|gb|ACO28300.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus 03BB102]
          Length = 3311

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 92/326 (28%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +N  + K          K  +    +        +  +   G  
Sbjct: 2911 FIETKAPTHYDLNQTPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGAT-LEGAV 2969

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I D  +        T    G     DL PGDY    +               TV   +
Sbjct: 2970 FKIVDQ-NGLDVRTDLTTDKDGKISVSDLRPGDYQFVETKAPTHYDLNQNPINFTVEKSQ 3028

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V   N    G + L  +    G+ +          +  + ++ L T+K    ++ 
Sbjct: 3029 TTTASVTAKNSLTKGAVELTKVDDIDGATLEGAIFKIVDMNGNDVRSDLTTNKDGKISVS 3088

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         +    V     
Sbjct: 3089 DLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 3148

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 3149 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 3208

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   +++ +++ +  K+++ +   +
Sbjct: 3209 TIEKAQASPLQITVSNKKVESSSGGD 3234



 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 50/317 (15%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I K          K  +    +      + N+     G  
Sbjct: 2630 FVETKAPKDYDLNKTPIPFTIEKSQPTHVSVTAKNGLTKGGVELTKVDSLNAKETLEGAV 2689

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++      +      G  ++ DL PGDY    +     +       K T+   +
Sbjct: 2690 FKI-TDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIKFTIERSQ 2748

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
                 V   N    G + L  +         +   F I +   H     L TDK     +
Sbjct: 2749 TKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVV 2808

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGK----IIDVTIQNRAAKITFKLVSEMG 220
              L   +Y+        +  ++       V+ G+     +  T       +    V ++ 
Sbjct: 2809 DELPPGDYEFIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDVD 2868

Query: 221  GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----E 270
            G A+ D  + I+  +G+ V                L  GDY  I      +Y        
Sbjct: 2869 GSALKDAVFKIVDMNGNNVRSNLTTNKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPIN 2928

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F+V   ++T   V  + 
Sbjct: 2929 FTVEKSQTTTASVTAKN 2945



 Score =  130 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 46/313 (14%), Positives = 86/313 (27%), Gaps = 33/313 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F       +     T +   + KG+ K        +        +++ +   S      +
Sbjct: 2818 FIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDVDGSALKDAVF 2877

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++      + T    G     DL PGDY    +     +         TV   + 
Sbjct: 2878 KIV-DMNGNNVRSNLTTNKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQT 2936

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVR 169
                V   N    G    +          +   F I        +  L TDK    ++  
Sbjct: 2937 TTASVTAKNSLTKGAVELTKVDDIDGATLEGAVFKIVDQNGLDVRTDLTTDKDGKISVSD 2996

Query: 170  LGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 2997 LRPGDYQFVETKAPTHYDLNQNPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGA 3056

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             +    + I+  +G+ V                L  GDY  I       Y        F+
Sbjct: 3057 TLEGAIFKIVDMNGNDVRSDLTTNKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFT 3116

Query: 273  VLTGKSTIVEVLM 285
            +  G+S +  V  
Sbjct: 3117 ITKGQSQVTSVTA 3129



 Score =  126 bits (316), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 102/316 (32%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2256 FIETKAPKHYVLDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2315

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2316 FNLLDQ-NGKVIKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKRPIVVTVEKSQ 2374

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            KN   V + N    GG+ L  +    G+ +               +  L T+     ++ 
Sbjct: 2375 KNIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMKGTVIRENLTTNSQGKISVS 2434

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    V ++ G
Sbjct: 2435 NLRPGDYQFVETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDG 2494

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G+ V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2495 TALEGAVFKIVDMNGNDVRTGITTDAKGKISISDLHPGDYQFIETTAPKHYKLDATPIKF 2554

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2555 TIEKSQAEKLQVTAKN 2570



 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/290 (13%), Positives = 83/290 (28%), Gaps = 31/290 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    I        +      G  + I +  +N+    +      G  +  DL P
Sbjct: 1721 TAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDARTNLVTNSEGKLIVDDLRP 1780

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIVD 140
            G+Y +  +             + T+   ++    +   N    G ++L       S I  
Sbjct: 1781 GNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNSLTKGKVKLIKEDDVKSSIAL 1840

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
                F++      +    L TD+     +  L   +YQ        +  +        ++
Sbjct: 1841 AGAVFTLQDANGTEIAKDLKTDEHGVLVIPDLAPGDYQFIETAAPEHYKLDQTPIKFTIK 1900

Query: 196  PGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT-------VGES 242
             G        + V        +T   V ++ G  +    + I+ A             + 
Sbjct: 1901 KGSKEDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEFIIVDAHDTEKVVRKGLTTDE 1960

Query: 243  ANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
                 +  L  GDY  I     ++Y+       F++   +   + V    
Sbjct: 1961 HGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGKSQKENITVTATN 2010



 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/317 (14%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I KG+ + +    + +        +++ +   +   G  +
Sbjct: 2443 FVETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDGTALEGAVF 2502

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +             K T+   + 
Sbjct: 2503 KIV-DMNGNDVRTGITTDAKGKISISDLHPGDYQFIETTAPKHYKLDATPIKFTIEKSQA 2561

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    +  
Sbjct: 2562 EKLQVTAKNSLIEGAVELIKVDDINPDTKLSDAVFNIIDAKGQVVRTNLTTDKDGKVSAS 2621

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  +   V++          +    V     
Sbjct: 2622 NLRPGDYQFVETKAPKDYDLNKTPIPFTIEKSQPTHVSVTAKNGLTKGGVELTKVDSLNA 2681

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2682 KETLEGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIK 2741

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F++   ++  V V    
Sbjct: 2742 FTIERSQTKHVFVTATN 2758



 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 97/319 (30%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   A  E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1879 FIETAAPEHYKLDQTPIKFTIKKGSKEDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1938

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1939 EFIIVDAHDTEKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGK 1998

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I     ++    L+T+K     
Sbjct: 1999 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKIVDMDGNEVRTNLVTNKNGKIY 2058

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2059 VPDLRPGDYQFIETKAPEHYVLDETPIPFTIERNQTKEINVTGKNTLKKGSVELTKIDDI 2118

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L A G+ V       +        L  G Y  +      +Y      
Sbjct: 2119 DTDTKLANAVFNLLDADGEIVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNKTP 2178

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + V  + 
Sbjct: 2179 IEFTIKKSQTETLHVTAKN 2197



 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 86/298 (28%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++ D+   +         
Sbjct: 2088 TIERNQTKEINVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLKTN 2146

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +       + T+   +     V   NA   G    
Sbjct: 2147 AEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIKKSQTETLHVTAKNALTKGAVEL 2206

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S          +   F+I           L+T+      +  L   +YQ        + +
Sbjct: 2207 SKVDDIDGTKLEGAVFNIVDMKGTVIHKNLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2266

Query: 188  VST---VVKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2267 LDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVI 2326

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2327 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKRPIVVTVEKSQKNIATVTMKN 2384



 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/308 (12%), Positives = 76/308 (24%), Gaps = 32/308 (10%)

Query: 11   AENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNT 70
               +  T      + +       +    +              +G  + I   ++N    
Sbjct: 1513 TNPIEFTIDKSQQSFATVTATNSLKTGEVELLKVDEFGDKKPLAGAVFKIV-DVNNNDVR 1571

Query: 71   LSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA-- 123
               T    G   +  L PG Y    +             + T+   +K    V   NA  
Sbjct: 1572 TDLTTDADGKTKADKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALK 1631

Query: 124  GGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSGTLVRLGTNNYQITS 179
             G    +              F I    +     +  + T          L   +Y+   
Sbjct: 1632 PGDVELTKVDDIDGTALAGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIE 1691

Query: 180  HYGKYNAIVST---VVKVEPGK-----IIDVTIQNRAAKITFKLVS-EMGGEAVADTAWS 230
                     +T      ++  +      +          I    V+     E +    + 
Sbjct: 1692 VTAPKYYDKNTNPIEFTIKESQGTSPITVTAKNSLTKGGIELTKVNAADEKETLEGAVFK 1751

Query: 231  ILTASGDT------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKST 279
            I+    +       V  S        L  G+Y +I       Y       EF++  G+ T
Sbjct: 1752 IVNRDTNEDARTNLVTNSEGKLIVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQT 1811

Query: 280  IVEVLMRQ 287
            ++ +  + 
Sbjct: 1812 LLPLTFKN 1819



 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/312 (11%), Positives = 87/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1134 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNTLLTGAEFTLY-DRTGKTVIR 1192

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1193 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1252

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1253 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNKGQITVDHLKPGTYYLK 1312

Query: 179  SHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +      VK+   +        T            V +  G+ +A   +S+
Sbjct: 1313 ETKAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIPGSAILTKVDKD-GKTLAGAEFSV 1371

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                 + +               +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1372 RDRHNNVIRGYEKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKK 1431

Query: 280  IVEVLMRQKRMD 291
             V V      + 
Sbjct: 1432 AVTVTATNHLIK 1443



 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/320 (14%), Positives = 98/320 (30%), Gaps = 37/320 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++     T +   I K + K V                 T++   +  +G  +
Sbjct: 1405 FVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAIF 1464

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    +      G     DL PG Y    +             + T+   +
Sbjct: 1465 KIVDANDEKKVIRENVKTGADGKVTVKDLEPGTYKFIETEAPKDYVLNTNPIEFTIDKSQ 1524

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1525 QSFATVTATNSLKTGEVELLKVDEFGDKKPLAGAVFKIVDVNNNDVRTDLTTDADGKTKA 1584

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1585 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1644

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            G A+A   + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1645 GTALAGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNP 1704

Query: 270  -EFSVLTGK-STIVEVLMRQ 287
             EF++   + ++ + V  + 
Sbjct: 1705 IEFTIKESQGTSPITVTAKN 1724



 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/281 (13%), Positives = 76/281 (27%), Gaps = 30/281 (10%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNK-KNTLSTTKKIIGGKVSFDLFPGDYLISA 95
             ++        N      G  + + D            T    G      L PG Y +  
Sbjct: 1254 GKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNKGQITVDHLKPGTYYLKE 1313

Query: 96   SFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSI 147
            +           + ++ ++  +         N+   G   L  + K G  +   E +   
Sbjct: 1314 TKAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIPGSAILTKVDKDGKTLAGAEFSVRD 1373

Query: 148  YSNP--NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKII 200
              N        L T+         L   +YQ        +       +   +     K +
Sbjct: 1374 RHNNVIRGYEKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKKAV 1433

Query: 201  DVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMVL 251
             VT  N      +T     ++ G A+A   + I+ A+        +    +        L
Sbjct: 1434 TVTATNHLIKGGVTLTKTDDIDGTALAGAIFKIVDANDEKKVIRENVKTGADGKVTVKDL 1493

Query: 252  SEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
              G Y  I     ++Y       EF++   + +   V    
Sbjct: 1494 EPGTYKFIETEAPKDYVLNTNPIEFTIDKSQQSFATVTATN 1534



 Score = 79.6 bits (194), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 35/264 (13%), Positives = 70/264 (26%), Gaps = 27/264 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +       +N  + K          K  +    +        +  +   G  
Sbjct: 3004 FVETKAPTHYDLNQNPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGAT-LEGAI 3062

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +    G          T++  +
Sbjct: 3063 FKIV-DMNGNDVRSDLTTNKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQ 3121

Query: 113  KNQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V  LN    G + L  +       +               +  L TD      + 
Sbjct: 3122 SQVTSVTALNSLTTGSMELTKVDIDHNGTLEGAIFNILDQDGKVVREGLKTDGHGKLIVN 3181

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITF----KLVSEM 219
             L   NYQ+               +S  ++      + +T+ N+  + +     K ++  
Sbjct: 3182 DLKPGNYQLVETKAPEGYQLDASPISFTIEKAQASPLQITVSNKKVESSSGGDNKPITPP 3241

Query: 220  GGEAVADTAWSILTASGDTVGESA 243
              E       S    +G+   ++ 
Sbjct: 3242 NKEEKPGKETSEELENGNPKTQTN 3265


>gi|118480390|ref|YP_897541.1| collagen adhesion protein [Bacillus thuringiensis str. Al Hakam]
 gi|118419615|gb|ABK88034.1| collagen adhesion protein [Bacillus thuringiensis str. Al Hakam]
          Length = 3320

 Score =  142 bits (357), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 92/326 (28%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +N  + K          K  +    +        +  +   G  
Sbjct: 2904 FIETKAPTHYDLNQTPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGAT-LEGAV 2962

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I D  +        T    G     DL PGDY    +               TV   +
Sbjct: 2963 FKIVDQ-NGLDVRTDLTTDKDGKISVSDLRPGDYQFVETKAPTHYDLNQNPINFTVEKSQ 3021

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V   N    G + L  +    G+ +          +  + ++ L T+K    ++ 
Sbjct: 3022 TTTASVTAKNSLTKGAVELTKVDDIDGATLEGAIFKIVDMNGNDVRSDLTTNKDGKISVS 3081

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         +    V     
Sbjct: 3082 DLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 3141

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 3142 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 3201

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   +++ +++ +  K+++ +   +
Sbjct: 3202 TIEKAQASPLQITVSNKKVESSSGGD 3227



 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 50/317 (15%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I K          K  +    +      + N+     G  
Sbjct: 2623 FVETKAPKDYDLNKTPIPFTIEKSQPTHVSVTAKNGLTKGGVELTKVDSLNAKETLEGAV 2682

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++      +      G  ++ DL PGDY    +     +       K T+   +
Sbjct: 2683 FKI-TDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIKFTIERSQ 2741

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
                 V   N    G + L  +         +   F I +   H     L TDK     +
Sbjct: 2742 TKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVV 2801

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGK----IIDVTIQNRAAKITFKLVSEMG 220
              L   +Y+        +  ++       V+ G+     +  T       +    V ++ 
Sbjct: 2802 DELPPGDYEFIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDVD 2861

Query: 221  GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----E 270
            G A+ D  + I+  +G+ V                L  GDY  I      +Y        
Sbjct: 2862 GSALKDAVFKIVDMNGNNVRSNLTTNKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPIN 2921

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F+V   ++T   V  + 
Sbjct: 2922 FTVEKSQTTTASVTAKN 2938



 Score =  130 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 46/313 (14%), Positives = 86/313 (27%), Gaps = 33/313 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F       +     T +   + KG+ K        +        +++ +   S      +
Sbjct: 2811 FIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDVDGSALKDAVF 2870

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++      + T    G     DL PGDY    +     +         TV   + 
Sbjct: 2871 KIV-DMNGNNVRSNLTTNKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQT 2929

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVR 169
                V   N    G    +          +   F I        +  L TDK    ++  
Sbjct: 2930 TTASVTAKNSLTKGAVELTKVDDIDGATLEGAVFKIVDQNGLDVRTDLTTDKDGKISVSD 2989

Query: 170  LGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 2990 LRPGDYQFVETKAPTHYDLNQNPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGA 3049

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             +    + I+  +G+ V                L  GDY  I       Y        F+
Sbjct: 3050 TLEGAIFKIVDMNGNDVRSDLTTNKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFT 3109

Query: 273  VLTGKSTIVEVLM 285
            +  G+S +  V  
Sbjct: 3110 ITKGQSQVTSVTA 3122



 Score =  126 bits (316), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 102/316 (32%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2249 FIETKAPKHYVLDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2308

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2309 FNLLDQ-NGKVIKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKRPIVVTVEKSQ 2367

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            KN   V + N    GG+ L  +    G+ +               +  L T+     ++ 
Sbjct: 2368 KNIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMKGTVIRENLTTNSQGKISVS 2427

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    V ++ G
Sbjct: 2428 NLRPGDYQFVETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDG 2487

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G+ V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2488 TALEGAVFKIVDMNGNDVRTGITTDAKGKISISDLHPGDYQFIETTAPKHYKLDATPIKF 2547

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2548 TIEKSQAEKLQVTAKN 2563



 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/290 (13%), Positives = 83/290 (28%), Gaps = 31/290 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    I        +      G  + I +  +N+    +      G  +  DL P
Sbjct: 1714 TAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDARTNLVTNSEGKLIVDDLRP 1773

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIVD 140
            G+Y +  +             + T+   ++    +   N    G ++L       S I  
Sbjct: 1774 GNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNSLTKGKVKLIKEDDVKSSIAL 1833

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
                F++      +    L TD+     +  L   +YQ        +  +        ++
Sbjct: 1834 AGAVFTLQDANGTEIAKDLKTDEHGVLVIPDLAPGDYQFIETAAPEHYKLDQTPIKFTIK 1893

Query: 196  PGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT-------VGES 242
             G        + V        +T   V ++ G  +    + I+ A             + 
Sbjct: 1894 KGSKEDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEFIIVDAHDTEKVVRKGLTTDE 1953

Query: 243  ANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
                 +  L  GDY  I     ++Y+       F++   +   + V    
Sbjct: 1954 HGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGKSQKENITVTATN 2003



 Score =  121 bits (302), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/317 (14%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I KG+ + +    + +        +++ +   +   G  +
Sbjct: 2436 FVETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDGTALEGAVF 2495

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +             K T+   + 
Sbjct: 2496 KIV-DMNGNDVRTGITTDAKGKISISDLHPGDYQFIETTAPKHYKLDATPIKFTIEKSQA 2554

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    +  
Sbjct: 2555 EKLQVTAKNSLIEGAVELIKVDDINPDTKLSDAVFNIIDAKGQVVRTNLTTDKDGKVSAS 2614

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  +   V++          +    V     
Sbjct: 2615 NLRPGDYQFVETKAPKDYDLNKTPIPFTIEKSQPTHVSVTAKNGLTKGGVELTKVDSLNA 2674

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2675 KETLEGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIK 2734

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F++   ++  V V    
Sbjct: 2735 FTIERSQTKHVFVTATN 2751



 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 97/319 (30%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   A  E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1872 FIETAAPEHYKLDQTPIKFTIKKGSKEDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1931

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1932 EFIIVDAHDTEKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGK 1991

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I     ++    L+T+K     
Sbjct: 1992 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKIVDMDGNEVRTNLVTNKNGKIY 2051

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2052 VPDLRPGDYQFIETKAPEHYVLDETPIPFTIERNQTKEINVTGKNTLKKGSVELTKIDDI 2111

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L A G+ V       +        L  G Y  +      +Y      
Sbjct: 2112 DTDTKLANAVFNLLDADGEIVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNKTP 2171

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + V  + 
Sbjct: 2172 IEFTIKKSQTETLHVTAKN 2190



 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 86/298 (28%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++ D+   +         
Sbjct: 2081 TIERNQTKEINVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLKTN 2139

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +       + T+   +     V   NA   G    
Sbjct: 2140 AEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIKKSQTETLHVTAKNALTKGAVEL 2199

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S          +   F+I           L+T+      +  L   +YQ        + +
Sbjct: 2200 SKVDDIDGTKLEGAVFNIVDMKGTVIHKNLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2259

Query: 188  VST---VVKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2260 LDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVI 2319

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2320 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKRPIVVTVEKSQKNIATVTMKN 2377



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/308 (12%), Positives = 76/308 (24%), Gaps = 32/308 (10%)

Query: 11   AENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNT 70
               +  T      + +       +    +              +G  + I   ++N    
Sbjct: 1506 TNPIEFTIDKSQQSFATVTATNSLKTGEVELLKVDEFGDKKPLAGAVFKIV-DVNNNDVR 1564

Query: 71   LSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA-- 123
               T    G   +  L PG Y    +             + T+   +K    V   NA  
Sbjct: 1565 TDLTTDADGKTKADKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALK 1624

Query: 124  GGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSGTLVRLGTNNYQITS 179
             G    +              F I    +     +  + T          L   +Y+   
Sbjct: 1625 PGDVELTKVDDIDGTALAGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIE 1684

Query: 180  HYGKYNAIVST---VVKVEPGK-----IIDVTIQNRAAKITFKLVS-EMGGEAVADTAWS 230
                     +T      ++  +      +          I    V+     E +    + 
Sbjct: 1685 VTAPKYYDKNTNPIEFTIKESQGTSPITVTAKNSLTKGGIELTKVNAADEKETLEGAVFK 1744

Query: 231  ILTASGDT------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKST 279
            I+    +       V  S        L  G+Y +I       Y       EF++  G+ T
Sbjct: 1745 IVNRDTNEDARTNLVTNSEGKLIVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQT 1804

Query: 280  IVEVLMRQ 287
            ++ +  + 
Sbjct: 1805 LLPLTFKN 1812



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/312 (12%), Positives = 86/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1127 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNTLLTGAEFTLY-DRTGKTVIR 1185

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1186 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1245

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1246 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNKGQITVEHLKPGTYYLK 1305

Query: 179  SHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +      VK+   +        T            V +  G+ +A   +S+
Sbjct: 1306 ETKAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIPGSAILTKVDKD-GKTLAGAEFSV 1364

Query: 232  LTAS-------GDTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                       G           +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1365 RDRKNKIIPGYGKLTTNDQGQIEATNLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKK 1424

Query: 280  IVEVLMRQKRMD 291
             V V      + 
Sbjct: 1425 AVTVTATNHLIK 1436



 Score =  108 bits (268), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 46/320 (14%), Positives = 98/320 (30%), Gaps = 37/320 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++     T +   I K + K V                 T++   +  +G  +
Sbjct: 1398 FVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAIF 1457

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    +      G     DL PG Y    +             + T+   +
Sbjct: 1458 KIVDANDEKKVIRENVKTGADGKVTVKDLEPGTYKFIETEAPKDYVLNTNPIEFTIDKSQ 1517

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1518 QSFATVTATNSLKTGEVELLKVDEFGDKKPLAGAVFKIVDVNNNDVRTDLTTDADGKTKA 1577

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1578 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1637

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            G A+A   + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1638 GTALAGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNP 1697

Query: 270  -EFSVLTGK-STIVEVLMRQ 287
             EF++   + ++ + V  + 
Sbjct: 1698 IEFTIKESQGTSPITVTAKN 1717



 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/281 (13%), Positives = 76/281 (27%), Gaps = 30/281 (10%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNK-KNTLSTTKKIIGGKVSFDLFPGDYLISA 95
             ++        N      G  + + D            T    G      L PG Y +  
Sbjct: 1247 GKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNKGQITVEHLKPGTYYLKE 1306

Query: 96   SFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSI 147
            +           + ++ ++  +         N+   G   L  + K G  +   E +   
Sbjct: 1307 TKAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIPGSAILTKVDKDGKTLAGAEFSVRD 1366

Query: 148  YSNP--NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKII 200
              N        L T+         L   +YQ        +       +   +     K +
Sbjct: 1367 RKNKIIPGYGKLTTNDQGQIEATNLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKKAV 1426

Query: 201  DVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMVL 251
             VT  N      +T     ++ G A+A   + I+ A+        +    +        L
Sbjct: 1427 TVTATNHLIKGGVTLTKTDDIDGTALAGAIFKIVDANDEKKVIRENVKTGADGKVTVKDL 1486

Query: 252  SEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
              G Y  I     ++Y       EF++   + +   V    
Sbjct: 1487 EPGTYKFIETEAPKDYVLNTNPIEFTIDKSQQSFATVTATN 1527



 Score = 79.6 bits (194), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 39/276 (14%), Positives = 74/276 (26%), Gaps = 29/276 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +       +N  + K          K  +    +        +  +   G  
Sbjct: 2997 FVETKAPTHYDLNQNPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGAT-LEGAI 3055

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +    G          T++  +
Sbjct: 3056 FKIV-DMNGNDVRSDLTTNKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQ 3114

Query: 113  KNQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V  LN    G + L  +       +               +  L TD      + 
Sbjct: 3115 SQVTSVTALNSLTTGSMELTKVDIDHNGTLEGAIFNILDQDGKVVREGLKTDGHGKLIVN 3174

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITF----KLVSEM 219
             L   NYQ+               +S  ++      + +T+ N+  + +     K ++  
Sbjct: 3175 DLKPGNYQLVETKAPEGYQLDASPISFTIEKAQASPLQITVSNKKVESSSGGDNKPITPP 3234

Query: 220  GGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
              E       S    +G+   E+     S  L  G+
Sbjct: 3235 NKEEKPGKETSEELENGNP--ETHGKETSEELENGN 3268


>gi|229012614|ref|ZP_04169787.1| hypothetical protein bmyco0001_30570 [Bacillus mycoides DSM 2048]
 gi|228748637|gb|EEL98489.1| hypothetical protein bmyco0001_30570 [Bacillus mycoides DSM 2048]
          Length = 698

 Score =  141 bits (356), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 41/279 (14%), Positives = 88/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  I +G  + +F++ +
Sbjct: 253 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEILAGAVFEVFNANN 312

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y++       G       + I V + E    QV  
Sbjct: 313 ESVGR--ITTGADGTAELNNLPIGTYIVKEIKAPTGYVSGDKPQTIEVKTGEIGAVQVVN 370

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR-LGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 371 NKVKGNIEIKKLSDSGKMLPN-VEFTVFTEDGKEVKKVVTKENGIANVDGLTYGKYYFLE 429

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 430 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 489

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 490 DASGKVIGEYKTDKNGEVNVKDLAYGKYSFVEKASPNGY 528



 Score = 93.8 bits (231), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 33/276 (11%), Positives = 74/276 (26%), Gaps = 25/276 (9%)

Query: 40  TCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH 99
             E +   +S  +   V + +F     +   +    K  G      L  G Y    +   
Sbjct: 376 NIEIKKLSDSGKMLPNVEFTVFTEDGKEVKKV--VTKENGIANVDGLTYGKYYFLETKTP 433

Query: 100 VGVV-----KKITVSSKEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN 152
            G +         +    K            G ++L  +         +   F +     
Sbjct: 434 NGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELKDASG 493

Query: 153 HKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNAI-VSTVVKVEPGKIIDV-----TIQ 205
                  TDK     +  L    Y           + ++  +  E  +   +        
Sbjct: 494 KVIGEYKTDKNGEVNVKDLAYGKYSFVEKASPNGYVLITEPIVFEIKEHGKIIELLAVNH 553

Query: 206 NRAAKITFKLVS-EMGGEAVADTAWSILTASGDTV----GESANASPSMVLSEGDYTVIA 260
                +    V    G   + +  ++I   +G  V     +    +    L  G YT   
Sbjct: 554 LIKGNLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 613

Query: 261 RNKERNY---SREFSVLTGKS-TIVEVLMRQKRMDK 292
               + Y      FS    ++  I++ +++ +++  
Sbjct: 614 TVAPKGYVLNEEIFSFEIKENGQIIKHIVKDEKIPS 649



 Score = 70.3 bits (170), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 35/296 (11%), Positives = 82/296 (27%), Gaps = 26/296 (8%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDS----GVSWHIFDSISNKKNTLST 73
           + L     +   G   V A+      ++   +  +      G  + I      K    + 
Sbjct: 181 TNLYTVQTNAKSGSYKVVAKNAPNGVKIVSENGEVKDQLSLGEKFRIQIPKDTKTGEFNL 240

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYK 133
           +      KV    + G   +            +  + ++ +        A G        
Sbjct: 241 SVATNLTKVQAIAYRGTDTVQ------NATVLLERNEEKLSSDLAVNWEAAGSLKIKKVG 294

Query: 134 PGSPIVDDELTFSIYSNPNHKALLITDK-VRSGTLVRLGTNNYQITSHYGKYNAIV---S 189
               I      F +++  N     IT     +  L  L    Y +         +     
Sbjct: 295 ENGEI-LAGAVFEVFNANNESVGRITTGADGTAELNNLPIGTYIVKEIKAPTGYVSGDKP 353

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASG----DTVGESAN 244
             ++V+ G+I  V + N   K   ++      G+ + +  +++ T  G      V +   
Sbjct: 354 QTIEVKTGEIGAVQVVNNKVKGNIEIKKLSDSGKMLPNVEFTVFTEDGKEVKKVVTKENG 413

Query: 245 ASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            +    L+ G Y  +       Y        F +    +  +   +    +  + +
Sbjct: 414 IANVDGLTYGKYYFLETKTPNGYIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 468



 Score = 63.8 bits (153), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 35/238 (14%), Positives = 67/238 (28%), Gaps = 24/238 (10%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 445 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAVFELKDASGKV 495

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV---VKKITVSSKEKNQKQ----VFI 120
                      G     DL  G Y         G     + I    KE  +      V  
Sbjct: 496 IGEYK--TDKNGEVNVKDLAYGKYSFVEKASPNGYVLITEPIVFEIKEHGKIIELLAVNH 553

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 554 LIKGNLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 613

Query: 180 HYGKYNAIVSTVV----KVEPGKIIDVTIQNRA-AKITFKLVSEMGGEAVADTAWSIL 232
                  +++  +      E G+II   +++     +      +  G     T+ S+ 
Sbjct: 614 TVAPKGYVLNEEIFSFEIKENGQIIKHIVKDEKIPSVKTTATDKTDGTKEMHTSKSVT 671


>gi|196045459|ref|ZP_03112690.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus 03BB108]
 gi|196023666|gb|EDX62342.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus 03BB108]
          Length = 3330

 Score =  141 bits (356), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 87/326 (26%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +N  + K          K  +    +        +  +   G  
Sbjct: 2898 FIETKAPTHYDLNQTPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGAT-LEGAV 2956

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I D  +        T    G     DL PGDY    +               TV   +
Sbjct: 2957 FKIVDQ-NGLDVRTDLTTDKDGKISVSDLRPGDYQFVETKAPTHYDLNQNPINFTVEKSQ 3015

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                 V   N    G    +          +   F I     +     L T+K    ++ 
Sbjct: 3016 TTTASVTAKNSLTKGAVELTKVDDIDGATLEGAVFKIVDMNGNDVRSDLTTNKDGKISVS 3075

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         +    V     
Sbjct: 3076 DLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 3135

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 3136 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 3195

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   +++ +++ +  K+++ +   +
Sbjct: 3196 TIEKAQASPLQITVSNKKVESSSGGD 3221



 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 49/317 (15%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I K          K  +    +      + ++     G  
Sbjct: 2617 FVETKAPKDYDLNKTPIPFTIEKSQPTHVSVTAKNGLTKGGVELTKVDSLDTKETLEGAV 2676

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++      +      G  ++ DL PGDY    +     +       K T+   +
Sbjct: 2677 FKI-TDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIKFTIERSQ 2735

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
                 V   N    G + L  +         +   F I +   H     L TDK     +
Sbjct: 2736 TKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVV 2795

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGK----IIDVTIQNRAAKITFKLVSEMG 220
              L   +Y+        +  ++       V+ G+     +  T       +    V ++ 
Sbjct: 2796 DELPPGDYEFIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDVD 2855

Query: 221  GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----E 270
            G A+ D  + I+  +G+ V                L  GDY  I      +Y        
Sbjct: 2856 GSALKDAVFKIVDMNGNNVRSNLTTNKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPIN 2915

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F+V   ++T   V  + 
Sbjct: 2916 FTVEKSQTTTASVTAKN 2932



 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 46/313 (14%), Positives = 86/313 (27%), Gaps = 33/313 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F       +     T +   + KG+ K        +        +++ +   S      +
Sbjct: 2805 FIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDVDGSALKDAVF 2864

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++      + T    G     DL PGDY    +     +         TV   + 
Sbjct: 2865 KIV-DMNGNNVRSNLTTNKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQT 2923

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVR 169
                V   N    G    +          +   F I        +  L TDK    ++  
Sbjct: 2924 TTASVTAKNSLTKGAVELTKVDDIDGATLEGAVFKIVDQNGLDVRTDLTTDKDGKISVSD 2983

Query: 170  LGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 2984 LRPGDYQFVETKAPTHYDLNQNPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGA 3043

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             +    + I+  +G+ V                L  GDY  I       Y        F+
Sbjct: 3044 TLEGAVFKIVDMNGNDVRSDLTTNKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFT 3103

Query: 273  VLTGKSTIVEVLM 285
            +  G+S +  V  
Sbjct: 3104 ITKGQSQVTSVTA 3116



 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 102/316 (32%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2243 FIETKAPKHYVLDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2302

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2303 FNLLDQ-NGKVIKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKRPIVVTVEKSQ 2361

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            KN   V + N    GG+ L  +    G+ +               +  L T+     ++ 
Sbjct: 2362 KNIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMKGTVIRENLTTNSQGKISVS 2421

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    V ++ G
Sbjct: 2422 NLRPGDYQFVETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDG 2481

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G+ V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2482 TALEGAVFKIVDMNGNDVRTGITTDAKGKISISDLHPGDYQFIETTAPKHYKLDATPIKF 2541

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2542 TIEKSQAEKLQVTAKN 2557



 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 39/290 (13%), Positives = 83/290 (28%), Gaps = 31/290 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    I        +      G  + I +  +N+    +      G  +  DL P
Sbjct: 1708 TAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDARTNLVTNSEGKLIVDDLRP 1767

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIVD 140
            G+Y +  +             + T+   ++    +   N    G ++L       S I  
Sbjct: 1768 GNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNSLTKGKVKLIKEDDVKSSIAL 1827

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
                F++      +    L TD+     +  L   +YQ        +  +        ++
Sbjct: 1828 AGAVFTLQDANGTEIAKDLKTDEHGVLVIPDLAPGDYQFIETAAPEHYKLDQTPIKFTIK 1887

Query: 196  PGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT-------VGES 242
             G        + V        +T   V ++ G  +    + I+ A             + 
Sbjct: 1888 KGSKEDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEFIIVDAHDTEKVVRKGLTTDE 1947

Query: 243  ANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
                 +  L  GDY  I     ++Y+       F++   +   + V    
Sbjct: 1948 HGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGKSQKENITVTATN 1997



 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/317 (14%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I KG+ + +    + +        +++ +   +   G  +
Sbjct: 2430 FVETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDGTALEGAVF 2489

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +             K T+   + 
Sbjct: 2490 KIV-DMNGNDVRTGITTDAKGKISISDLHPGDYQFIETTAPKHYKLDATPIKFTIEKSQA 2548

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    +  
Sbjct: 2549 EKLQVTAKNSLIEGAVELIKVDDINPDTKLSDAVFTIIDAKGQVVRTNLTTDKDGKVSAS 2608

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  +   V++          +    V     
Sbjct: 2609 NLRPGDYQFVETKAPKDYDLNKTPIPFTIEKSQPTHVSVTAKNGLTKGGVELTKVDSLDT 2668

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2669 KETLEGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIK 2728

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F++   ++  V V    
Sbjct: 2729 FTIERSQTKHVFVTATN 2745



 Score =  120 bits (299), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 97/319 (30%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   A  E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1866 FIETAAPEHYKLDQTPIKFTIKKGSKEDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1925

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1926 EFIIVDAHDTEKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGK 1985

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I     ++    L+T+K     
Sbjct: 1986 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKIVDMDGNEVRTNLVTNKNGKIY 2045

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2046 VPDLRPGDYQFIETKAPEHYVLDETPIPFTIERNQTKEINVTGKNTLKKGSVELTKIDDI 2105

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L A G+ V       +        L  G Y  +      +Y      
Sbjct: 2106 DTDTKLANAVFNLLDADGEIVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNKTP 2165

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + V  + 
Sbjct: 2166 IEFTIKKSQTETLHVTAKN 2184



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 86/298 (28%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++ D+   +         
Sbjct: 2075 TIERNQTKEINVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLKTN 2133

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +       + T+   +     V   NA   G    
Sbjct: 2134 AEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIKKSQTETLHVTAKNALTKGAVEL 2193

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S          +   F+I           L+T+      +  L   +YQ        + +
Sbjct: 2194 SKVDDIDGTKLEGAVFNIVDMKGTVIHKNLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2253

Query: 188  VST---VVKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2254 LDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVI 2313

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2314 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKRPIVVTVEKSQKNIATVTMKN 2371



 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 38/312 (12%), Positives = 86/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1121 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNTLLTGAEFTLY-DRTGKTVIR 1179

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1180 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1239

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1240 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNKGQITVEHLKPGTYYLK 1299

Query: 179  SHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +      VK+   +        T            V +  G+ +A   +S+
Sbjct: 1300 ETKAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIPGSAILTKVDKD-GKTLAGAEFSV 1358

Query: 232  LTAS-------GDTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                       G           +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1359 RDRKNKIIPGYGKLTTNDQGQIEATNLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKK 1418

Query: 280  IVEVLMRQKRMD 291
             V V      + 
Sbjct: 1419 AVTVTATNHLIK 1430



 Score =  110 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/308 (12%), Positives = 75/308 (24%), Gaps = 32/308 (10%)

Query: 11   AENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNT 70
               +  T      + +       +    +               G  + I   ++N    
Sbjct: 1500 TNPIEFTIDKSQQSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIV-DVNNNDVR 1558

Query: 71   LSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA-- 123
               T    G   +  L PG Y    +             + T+   +K    V   NA  
Sbjct: 1559 TDLTTDADGKTKADKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALK 1618

Query: 124  GGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSGTLVRLGTNNYQITS 179
             G    +              F I    +     +  + T          L   +Y+   
Sbjct: 1619 PGDVELTKVDDIDGTALAGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIE 1678

Query: 180  HYGKYNAIVST---VVKVEPGK-----IIDVTIQNRAAKITFKLVS-EMGGEAVADTAWS 230
                     +T      ++  +      +          I    V+     E +    + 
Sbjct: 1679 VTAPKYYDKNTNPIEFTIKESQGTSPITVTAKNSLTKGGIELTKVNAADEKETLEGAVFK 1738

Query: 231  ILTASGDT------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKST 279
            I+    +       V  S        L  G+Y +I       Y       EF++  G+ T
Sbjct: 1739 IVNRDTNEDARTNLVTNSEGKLIVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQT 1798

Query: 280  IVEVLMRQ 287
            ++ +  + 
Sbjct: 1799 LLPLTFKN 1806



 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 46/320 (14%), Positives = 98/320 (30%), Gaps = 37/320 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++     T +   I K + K V                 T++   +  +G  +
Sbjct: 1392 FVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAIF 1451

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    +      G     DL PG Y    +             + T+   +
Sbjct: 1452 KIVDANDEKKVIRENVKTGADGKVTVKDLEPGTYKFIETEAPKDYVLNTNPIEFTIDKSQ 1511

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1512 QSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIVDVNNNDVRTDLTTDADGKTKA 1571

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1572 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1631

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            G A+A   + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1632 GTALAGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNP 1691

Query: 270  -EFSVLTGK-STIVEVLMRQ 287
             EF++   + ++ + V  + 
Sbjct: 1692 IEFTIKESQGTSPITVTAKN 1711



 Score =  101 bits (251), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/281 (13%), Positives = 76/281 (27%), Gaps = 30/281 (10%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNK-KNTLSTTKKIIGGKVSFDLFPGDYLISA 95
             ++        N      G  + + D            T    G      L PG Y +  
Sbjct: 1241 GKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNKGQITVEHLKPGTYYLKE 1300

Query: 96   SFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSI 147
            +           + ++ ++  +         N+   G   L  + K G  +   E +   
Sbjct: 1301 TKAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIPGSAILTKVDKDGKTLAGAEFSVRD 1360

Query: 148  YSNP--NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKII 200
              N        L T+         L   +YQ        +       +   +     K +
Sbjct: 1361 RKNKIIPGYGKLTTNDQGQIEATNLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKKAV 1420

Query: 201  DVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMVL 251
             VT  N      +T     ++ G A+A   + I+ A+        +    +        L
Sbjct: 1421 TVTATNHLIKGGVTLTKTDDIDGTALAGAIFKIVDANDEKKVIRENVKTGADGKVTVKDL 1480

Query: 252  SEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
              G Y  I     ++Y       EF++   + +   V    
Sbjct: 1481 EPGTYKFIETEAPKDYVLNTNPIEFTIDKSQQSFATVTATN 1521



 Score = 80.0 bits (195), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 39/276 (14%), Positives = 74/276 (26%), Gaps = 29/276 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +       +N  + K          K  +    +        +  +   G  
Sbjct: 2991 FVETKAPTHYDLNQNPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGAT-LEGAV 3049

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +    G          T++  +
Sbjct: 3050 FKIV-DMNGNDVRSDLTTNKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQ 3108

Query: 113  KNQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V  LN    G + L  +       +               +  L TD      + 
Sbjct: 3109 SQVTSVTALNSLTTGSMELTKVDIDHNGTLEGAIFNILDQDGKVVREGLKTDGHGKLIVN 3168

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITF----KLVSEM 219
             L   NYQ+               +S  ++      + +T+ N+  + +     K ++  
Sbjct: 3169 DLKPGNYQLVETKAPEGYQLDASPISFTIEKAQASPLQITVSNKKVESSSGGDNKPITPP 3228

Query: 220  GGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
              E       S    +G+   E+     S  L  G+
Sbjct: 3229 NKEEKPGKETSEELENGNP--ETHGKETSEELENGN 3262


>gi|166091590|ref|YP_001654040.1| putative cell wall anchor protein [Bacillus thuringiensis]
 gi|165875367|gb|ABY68522.1| putative cell wall anchor protein [Bacillus thuringiensis]
          Length = 767

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 46/308 (14%), Positives = 98/308 (31%), Gaps = 27/308 (8%)

Query: 6   SSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSI 64
            +Y   + +   + LL  N  K      V+ + +   E         +  G  + +F+S+
Sbjct: 254 VAYKGTDKIQDATVLLERNEEKVSADLNVNWKSVGQLEVIKVGEQKEVLQGAVFDVFNSM 313

Query: 65  SNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVF 119
           + K  T   T    G      L  G Y +       G       ++I V + E     V 
Sbjct: 314 NEKVGT--ITTNEKGIASLSGLEIGTYTLKEVKSPTGYVMNEQPQQIEVKTGEVATITVQ 371

Query: 120 ILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQIT 178
                G             +   + F++++    +    T   +    V  L    Y   
Sbjct: 372 NTKVKGNIEIKKLSDSGKTLPK-VEFTVFTAEGKEITKTTTNEQGIAQVKDLQYGEYYFV 430

Query: 179 SHYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSI 231
              G    +++         E GK +  T++N+  K   +L+   G    + +    + +
Sbjct: 431 ETKGVEGYLLNQTKYPFEIKEQGKTLTFTVENKEVKGNVQLLKVDGENPDKKLEGAVFVL 490

Query: 232 LTASGDTV----GESANASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVE 282
             + G  +     +         L  G Y+ + +     Y     S  FS+ + +   + 
Sbjct: 491 QDSKGKKISEHKSDKNGLIEVKDLPFGAYSFVEKQAPTGYVLTKESIPFSI-SEQGKTIM 549

Query: 283 VLMRQKRM 290
           +  + K++
Sbjct: 550 LTAKNKKI 557



 Score = 96.9 bits (239), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 41/264 (15%), Positives = 73/264 (27%), Gaps = 25/264 (9%)

Query: 40  TCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH 99
             E +   +S      V + +F   +  K    TT    G     DL  G+Y    + G 
Sbjct: 378 NIEIKKLSDSGKTLPKVEFTVF--TAEGKEITKTTTNEQGIAQVKDLQYGEYYFVETKGV 435

Query: 100 VGVV-----KKITVSSKEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN 152
            G +         +  + K            G ++L  +         +   F +  +  
Sbjct: 436 EGYLLNQTKYPFEIKEQGKTLTFTVENKEVKGNVQLLKVDGENPDKKLEGAVFVLQDSKG 495

Query: 153 HKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNAIV---STVVKV-EPGKIIDVTIQNR 207
            K     +DK     +  L    Y           ++   S    + E GK I +T +N+
Sbjct: 496 KKISEHKSDKNGLIEVKDLPFGAYSFVEKQAPTGYVLTKESIPFSISEQGKTIMLTAKNK 555

Query: 208 AAKITF---KLVSEMGGEAVADTAWSILTASGDTV----GESANASPSMVLSEGDYTVIA 260
                    K+    G   + +  ++I    G  V     +         L  G YT   
Sbjct: 556 KITGELEISKVDIADGNNKLPNAEFTIFNEQGKEVVKGKTDENG-IAKFKLPYGKYTYKE 614

Query: 261 RNKERNY---SREFSVLTGKSTIV 281
                 Y      F     +   +
Sbjct: 615 TLAPDGYLLNEEIFPFEIKEDGQI 638


>gi|75758524|ref|ZP_00738644.1| Collagen adhesion protein [Bacillus thuringiensis serovar israelensis
            ATCC 35646]
 gi|228903836|ref|ZP_04067951.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            IBL 4222]
 gi|74493958|gb|EAO57054.1| Collagen adhesion protein [Bacillus thuringiensis serovar israelensis
            ATCC 35646]
 gi|228855745|gb|EEN00290.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            IBL 4222]
          Length = 3232

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 48/325 (14%), Positives = 94/325 (28%), Gaps = 33/325 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+     T +   + KG+ K        +         ++ +   +   G  +
Sbjct: 2828 FIETKAPEHYDLNKTPIKFTVKKGQEKIASVTATNSLTKGAVELTKVDDIDGTTLEGAIF 2887

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I D    K      T    G     DL PGDY    +     +       K T+   + 
Sbjct: 2888 KIVDMD-GKDVRSDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPIKFTIEKSQT 2946

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVR 169
             +  V   N    G    +           E  F I         + L TDK    ++  
Sbjct: 2947 AKASVTATNSLTKGAVELTKVDDIDGTTLAEAIFKIVDMNGKDVHSDLTTDKDGKISVSD 3006

Query: 170  LGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGGE 222
            L   +YQ                +   +     +I  VT         I    V      
Sbjct: 3007 LRPGDYQFIETKAPTGYDLNIKPIPFTITKGQSQITSVTALNSLTTGSIELTKVDIDHHG 3066

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FS 272
             +    ++IL   G  +      +         L  G+Y ++     + Y  +     F+
Sbjct: 3067 TLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETQAPKGYQLDASPINFT 3126

Query: 273  VLTGKSTIVEVLMRQKRMDKNGQHN 297
            +   ++T +++ +  K+++ +   +
Sbjct: 3127 IDKAQATPLQITVSNKKIESSSGGD 3151



 Score =  125 bits (313), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 40/310 (12%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1711 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1770

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             +  +   ++    +   N 
Sbjct: 1771 VRTDLVTNSKGMLVVDDLRPGNYKLIETKAPTYYDVNEEPIEFIIEKSQQKLIPITFKNS 1830

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    LITD      +  L   +YQ  
Sbjct: 1831 LTKGKVKLIKEDDVESAKALAGAVFTLQDATGKEIMKDLITDAHGVLVIPDLAPGDYQFI 1890

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1891 EVKAPEHYKLDQTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1950

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  +     ++Y+       F++   +
Sbjct: 1951 IIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFVEVKAPKDYTLSKEPIPFTIEKSQ 2010

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 2011 KENITVTATN 2020



 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 48/318 (15%), Positives = 88/318 (27%), Gaps = 36/318 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I K + +++       +    +        N  +  S   
Sbjct: 2546 FVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTTTNSLTEGAVELIKVDDINPDTKLSDAV 2605

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            ++I      K      T    G   + +L PGDY          +         T+   +
Sbjct: 2606 FNII-DAKGKIVRTDLTTDKDGKITATNLRPGDYQFIEMKAPKHYDLNKTPISFTIEKSQ 2664

Query: 113  KNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                 V   N    GG+ L  +       + +   F I      + +  L+T+K      
Sbjct: 2665 LTHASVTAKNGLTKGGVELTKVDSIDKKEMLEGAVFKITDLNGNDIRTNLVTNKDGKIIA 2724

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITF-KLVSEM 219
              L   +YQ        +  ++       +E  +   V +          +   K+    
Sbjct: 2725 KDLQPGDYQFIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTKGSVELIKVDDAK 2784

Query: 220  GGEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE---- 270
                +    + I+   G     D   +         L  GDY  I      +Y       
Sbjct: 2785 QNTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPI 2844

Query: 271  -FSVLTGKSTIVEVLMRQ 287
             F+V  G+  I  V    
Sbjct: 2845 KFTVKKGQEKIASVTATN 2862



 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 48/319 (15%), Positives = 94/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1889 FIEVKAPEHYKLDQTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1948

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1949 EFIIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFVEVKAPKDYTLSKEPIPFTIEK 2008

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 2009 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2068

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2069 VSDLRPGDYQFIETKAPEHYVLEETQIPFTIERSQTKEINVTGKNALKKGSVELTKIDDI 2128

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2129 DINTKLANAVFNLLDADGELVEEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYVLDKKP 2188

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2189 IVFTIKKSQTEALHVTATN 2207



 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 89/319 (27%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K + + +               +++ +   ++   
Sbjct: 2170 TYQFVETIAPEHYVLDKKPIVFTIKKSQTEALHVTATNALTKGAVKLSKVDDVDATVLKD 2229

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSS 110
              + I + ++             G     DL PGDY    +             K T+  
Sbjct: 2230 AVFKIVN-MNGDVVHKDLVTNEQGLIEINDLRPGDYQFIETKAPKDYVLNETPIKFTIEK 2288

Query: 111  KEK---NQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNH--KALLITDKVRSG 165
             +K   +      L  G I L  +          +  F++        K  L T+     
Sbjct: 2289 GQKKSISLTATNSLKQGSIELLKVDDLNDQTKLADAVFNLLDQNGKVLKTDLKTNSEGKI 2348

Query: 166  TLVRLGTNNYQITSHYGKYNAIVS-----TVVKVEPGKIIDVTIQN--RAAKITFKLVSE 218
             +  L    YQ        +  +        ++     I  VT++N      +    V +
Sbjct: 2349 VVENLRPGTYQFVETTAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDD 2408

Query: 219  MGGEAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            + G  +    + I   +G       V           L  GDY  I     ++Y+     
Sbjct: 2409 VDGTTLEGAVFKIADMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYNLNKEP 2468

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   ++  V V    
Sbjct: 2469 IPFTITQSQAEPVSVTATN 2487



 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 53/310 (17%), Positives = 103/310 (33%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1617 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1675

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L  GDY          +       K T++  +  Q  V   N 
Sbjct: 1676 IRENVKTGADGKAIATGLRLGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1735

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1736 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYKL 1795

Query: 178  TSHYGKYNAIVSTV-----VKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                      V+       ++    K+I +T +N   K   KL+        +A+A   +
Sbjct: 1796 IETKAPTYYDVNEEPIEFIIEKSQQKLIPITFKNSLTKGKVKLIKEDDVESAKALAGAVF 1855

Query: 230  SILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G       + ++        L+ GDY  I      +Y  +     F++  G   
Sbjct: 1856 TLQDATGKEIMKDLITDAHGVLVIPDLAPGDYQFIEVKAPEHYKLDQTPIKFTIKKGSKE 1915

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1916 DLPIPVTVKN 1925



 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/319 (14%), Positives = 95/319 (29%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K +        + +        +++ +   +   G
Sbjct: 2357 TYQFVETTAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDDVDGTTLEG 2416

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSS 110
              + I   ++             G     DL PGDY    +               T++ 
Sbjct: 2417 AVFKI-ADMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYNLNKEPIPFTITQ 2475

Query: 111  KEKNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             +     V   N    G + L  +    G+ + D     +  +  + +  L TD     +
Sbjct: 2476 SQAEPVSVTATNSLTKGTVELSKVDDVDGTALKDAIFKITDMNGNDIRTELTTDVHGKIS 2535

Query: 167  LVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG- 220
            +  L   +YQ        +       +   +K    + + VT  N   +   +L+     
Sbjct: 2536 VSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTTTNSLTEGAVELIKVDDI 2595

Query: 221  --GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 ++D  ++I+ A G  V      +      +  L  GDY  I     ++Y      
Sbjct: 2596 NPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITATNLRPGDYQFIEMKAPKHYDLNKTP 2655

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   + T   V  + 
Sbjct: 2656 ISFTIEKSQLTHASVTAKN 2674



 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 40/320 (12%), Positives = 89/320 (27%), Gaps = 33/320 (10%)

Query: 3    ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
            I+ +S    E       ++  +   G G        +  +     +   I SGV + +F 
Sbjct: 1135 ITGNSLKLTETEKIEEIVVKVSSGSGGGSATKGRGNLQIKKVDNADPNKILSGVVFTLF- 1193

Query: 63   SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKN 114
              +      + T    G     +L   +YL+       G V          + + ++E  
Sbjct: 1194 DRTGTTAIRTITTDDNGIAHFNNLKRDEYLLREMKTLDGYVISKELKAGKLVKLGAEETT 1253

Query: 115  QKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA----LLITDKVRSGTLVRL 170
               +      G  + +     +        FS+    ++       LIT+     T+  L
Sbjct: 1254 TYTLKNEKFVGKVVLTKTDAHNKEKLKNAVFSLLDQNHNVIPEHKELITNDKGQITVDNL 1313

Query: 171  GTNNYQITSHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEA 223
                Y +       +  +       K+E  +      +            K V +  G  
Sbjct: 1314 KPGTYYLKEIKAPEHYQLDDRLIEFKIEEDQTTVINKEAQNSLIRGSAILKKVDKE-GNT 1372

Query: 224  VADTAWSILTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
            +    +S+   +   +               +  L  G+Y  +      +Y  +     F
Sbjct: 1373 LEGAVFSVRDRNNKKIPGYTKLTTNGNGQIEAKNLLPGEYQFVEEKAPEHYEIDKKPLKF 1432

Query: 272  SVLTGKSTIVEVLMRQKRMD 291
            +V   +   + V      + 
Sbjct: 1433 TVEKSQQKALTVKATNHLIK 1452



 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+       L   + K + K +                ++ +   +   G  +
Sbjct: 1414 FVEEKAPEHYEIDKKPLKFTVEKSQQKALTVKATNHLIKGGVTLTKVDDVDGTALEGAVF 1473

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1474 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGAYKFIETEAPKDYTLSTNPIEFTIDKSQ 1533

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1534 QTLATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1593

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1594 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1653

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1654 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRLGDYKFIEVTAPKYYDKNT 1713

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1714 KPIKFTITESQTTQATVTAKN 1734



 Score = 73.8 bits (179), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 31/308 (10%), Positives = 91/308 (29%), Gaps = 24/308 (7%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
             K+ +++ T+  ++  ++K     + + +    +     N+      + +      +   
Sbjct: 1056 EKSFHLYGTTVAVDGTLTKDTTNELKEGKDYKLKITTDNNTGKQQFTIEFLHTIDRAYIL 1115

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRL 128
               S        KVS         +  +      +++I V     +         G +++
Sbjct: 1116 EYRSLINADNNEKVSNKAKITGNSLKLTE--TEKIEEIVVKVSSGSGGGSATKGRGNLQI 1173

Query: 129  YSIYKPGSPIVDDELTFSIYSNPNHK--ALLITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
              +       +   + F+++          + TD         L  + Y +         
Sbjct: 1174 KKVDNADPNKILSGVVFTLFDRTGTTAIRTITTDDNGIAHFNNLKRDEYLLREMKTLDGY 1233

Query: 187  IVSTV------VKVEPGKIIDVTIQNRA--AKITFKLVSEMGGEAVADTAWSILTASGDT 238
            ++S        VK+   +    T++N     K+          E + +  +S+L  + + 
Sbjct: 1234 VISKELKAGKLVKLGAEETTTYTLKNEKFVGKVVLTKTDAHNKEKLKNAVFSLLDQNHNV 1293

Query: 239  V-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMR 286
            +                  L  G Y +       +Y  +     F +   ++T++    +
Sbjct: 1294 IPEHKELITNDKGQITVDNLKPGTYYLKEIKAPEHYQLDDRLIEFKIEEDQTTVINKEAQ 1353

Query: 287  QKRMDKNG 294
               +  + 
Sbjct: 1354 NSLIRGSA 1361


>gi|229094470|ref|ZP_04225539.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
            Rock3-42]
 gi|228688854|gb|EEL42684.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
            Rock3-42]
          Length = 3330

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/325 (12%), Positives = 95/325 (29%), Gaps = 33/325 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++     T +N  + K +          +         ++ +  +    G  +
Sbjct: 2898 FIETKAPKHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIESVTLEGAVF 2957

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 2958 KIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQT 3016

Query: 114  NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
                V   N    G + L  +    G+ +          +  + +A L TDK    ++  
Sbjct: 3017 ATASVTATNSLTKGAVELTKVDDIDGTTLEGAIFKIVDQNGNDVRADLTTDKDGKISVSD 3076

Query: 170  LGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGGE 222
            L   +YQ                +   +     ++  VT         +    V      
Sbjct: 3077 LRPGDYQFIEKKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHNG 3136

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FS 272
             +    ++IL   G  V      +         L  G+Y ++       Y  +     F+
Sbjct: 3137 TLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISFT 3196

Query: 273  VLTGKSTIVEVLMRQKRMDKNGQHN 297
            +   +++ +++ +  K+++ +   +
Sbjct: 3197 IEKAQASPLQITVSNKKVESSSGGD 3221



 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 46/313 (14%), Positives = 90/313 (28%), Gaps = 33/313 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F       +     T +   + KG+ K      + +        +++ +   S   G  +
Sbjct: 2805 FIETKAPTHYKLNETPIKFTVKKGQEKIASVTAKNSLTKGAVELSKVDDVDGSALKGAVF 2864

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++        T    G     DL PG+Y    +     +         TV   + 
Sbjct: 2865 KIV-DMNGNDVRTDLTTDKDGKISVSDLRPGNYQFIETKAPKHYDLNQTPINFTVEKSQT 2923

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVR 169
                V   N    G    +       +  +   F I     +     L TDK    ++  
Sbjct: 2924 ATASVTATNSLTKGAVELTKVDDIESVTLEGAVFKIVDMNGNDVRTDLTTDKDGKISVSD 2983

Query: 170  LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 2984 LRPGDYQFIETKAPTHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGT 3043

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             +    + I+  +G+ V      +         L  GDY  I +     Y        F+
Sbjct: 3044 TLEGAIFKIVDQNGNDVRADLTTDKDGKISVSDLRPGDYQFIEKKAPTGYDLNAKPIPFT 3103

Query: 273  VLTGKSTIVEVLM 285
            +  G+S +  V  
Sbjct: 3104 ITKGQSQVTSVTA 3116



 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/317 (14%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I K          K  +    +      + ++     G  
Sbjct: 2617 FVETKAPKHYDLNETPIPFTIEKSQSTHVSVTAKNGLTKGGVELTKIDSLDTKETLEGAV 2676

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++      +      G  ++ DL PGDY    +     +       K T+   +
Sbjct: 2677 FKI-TDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNETPIKFTIERSQ 2735

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
                 V  +N    G + L  +         +   F I +   H     L TDK     +
Sbjct: 2736 TKHVFVTAINSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVV 2795

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
              L   +Y+        +  ++       V+ G+    ++          +    V ++ 
Sbjct: 2796 DELPPGDYEFIETKAPTHYKLNETPIKFTVKKGQEKIASVTAKNSLTKGAVELSKVDDVD 2855

Query: 221  GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----E 270
            G A+    + I+  +G+ V      +         L  G+Y  I     ++Y        
Sbjct: 2856 GSALKGAVFKIVDMNGNDVRTDLTTDKDGKISVSDLRPGNYQFIETKAPKHYDLNQTPIN 2915

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F+V   ++    V    
Sbjct: 2916 FTVEKSQTATASVTATN 2932



 Score =  125 bits (314), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 40/290 (13%), Positives = 84/290 (28%), Gaps = 31/290 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    I        +      G  + I +  +N+    +      G  V  DL P
Sbjct: 1708 TAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDARTNLVTNSEGKLVVDDLRP 1767

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIVD 140
            G+Y +  +             + T+   ++    +   N    G ++L       S I  
Sbjct: 1768 GNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNSLTKGKVKLIKEDDVESSIAL 1827

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
                F++      +    L TD+  +  +  L   +YQ        +  +        ++
Sbjct: 1828 AGAVFTLQDANGTEIAKDLKTDEHGALVIPDLAPGDYQFIETAAPEHYKLDQTPIKFTIK 1887

Query: 196  PGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT-------VGES 242
             G        + V        +T   V ++ G  +    + I+ A             + 
Sbjct: 1888 KGSKDDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEFIIVDAHDTKKVVRKGLTTDE 1947

Query: 243  ANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
                 +  L  GDY  I     ++Y+       F++   +   + V    
Sbjct: 1948 HGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGKSQKENITVTATN 1997



 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 47/316 (14%), Positives = 97/316 (30%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2243 FIETKAPKHYVLDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2302

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2303 FNLLDQ-NGKVIKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQ 2361

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKAL--LITDKVRSGTLV 168
            KN   V + N    G    S          +   F+I           L T+     ++ 
Sbjct: 2362 KNIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMNGTVIRKSLTTNSQGKISVP 2421

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +      ++ G
Sbjct: 2422 DLRPGDYQFIETMAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKADDIDG 2481

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G  V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2482 TALEGAIFKIVDMNGHDVRTGITTDAKGKVSISDLHPGDYQFIETTAPKHYKLDATPIKF 2541

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2542 TIEKSQAEKLQVTAKN 2557



 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 50/319 (15%), Positives = 96/319 (30%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   A  E+     T +   I KG    +     V    +T    LT   +   +   G 
Sbjct: 1866 FIETAAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1925

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1926 EFIIVDAHDTKKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGK 1985

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I     ++    L+TDK     
Sbjct: 1986 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKIVDMDGNEVRTNLVTDKNGKIH 2045

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2046 IPDLRPGDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDI 2105

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L A G+ V       +        L  G Y  +      +Y      
Sbjct: 2106 DTDTKLANAVFNLLDADGEIVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNKTP 2165

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + V  + 
Sbjct: 2166 IEFTIKKSQTETLHVTAKN 2184



 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 45/315 (14%), Positives = 92/315 (29%), Gaps = 35/315 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I KG+ + +    + +        ++  +   +   G  +
Sbjct: 2430 FIETMAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKADDIDGTALEGAIF 2489

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +             K T+   + 
Sbjct: 2490 KIV-DMNGHDVRTGITTDAKGKVSISDLHPGDYQFIETTAPKHYKLDATPIKFTIEKSQA 2548

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    +  
Sbjct: 2549 EKLQVTAKNSLIEGAVELIKVDDINPDTKLSDAVFNIIDAKGKVVRTNLTTDKDGKISAS 2608

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  +   V++          +    +     
Sbjct: 2609 NLRPGDYQFVETKAPKHYDLNETPIPFTIEKSQSTHVSVTAKNGLTKGGVELTKIDSLDT 2668

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2669 KETLEGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNETPIK 2728

Query: 271  FSVLTGKSTIVEVLM 285
            F++   ++  V V  
Sbjct: 2729 FTIERSQTKHVFVTA 2743



 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/308 (12%), Positives = 77/308 (25%), Gaps = 32/308 (10%)

Query: 11   AENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNT 70
             + +  T      + +       +    +              +G  + I   ++N    
Sbjct: 1500 TKPIEFTIDKSQQSFATVTATNSLKTGEVELLKVDEFGDKKPLAGAVFKIV-DVNNNDVR 1558

Query: 71   LSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA-- 123
               T    G   +  L PG Y    +             + T+   +K    V   NA  
Sbjct: 1559 TDLTTDADGKTKADKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALK 1618

Query: 124  GGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSGTLVRLGTNNYQITS 179
             G    +              F I    +     +  + T          L   +Y+   
Sbjct: 1619 PGDVELTKVDDIDGTALAGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIE 1678

Query: 180  HYGKYNAIVST---VVKVEPGK-----IIDVTIQNRAAKITFKLVS-EMGGEAVADTAWS 230
                     +T      ++  +      +          I    V+     E +    + 
Sbjct: 1679 VTAPKYYDKNTKPIEFTIKESQGISPITVTAKNSLTKGGIELTKVNAADEKETLEGAVFK 1738

Query: 231  ILTASGDT------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKST 279
            I+    +       V  S        L  G+Y +I       Y       EF++  G+ T
Sbjct: 1739 IVNRDTNEDARTNLVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQT 1798

Query: 280  IVEVLMRQ 287
            ++ +  + 
Sbjct: 1799 LLPLTFKN 1806



 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 86/298 (28%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++ D+   +         
Sbjct: 2075 TIERSQTKEINVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLKTN 2133

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +       + T+   +     V   NA   G    
Sbjct: 2134 AEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIKKSQTETLHVTAKNALTKGAVEL 2193

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S          +   F+I           L+T+      +  L   +YQ        + +
Sbjct: 2194 SKVDDIDGTKLEGTVFNIVDMKGTVIHKNLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2253

Query: 188  VST---VVKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2254 LDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVI 2313

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2314 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKNIATVTMKN 2371



 Score =  110 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 38/312 (12%), Positives = 86/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1121 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNTLLTGAEFTLY-DRTGKTVIR 1179

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1180 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1239

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1240 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNKGQITVDHLKPGIYYLK 1299

Query: 179  SHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +      VK+   +        T            V +  G+ +A   +S+
Sbjct: 1300 ETKAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIPGSAILTKVDKD-GKTLAGAEFSV 1358

Query: 232  LTAS-------GDTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                       G           +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1359 RDRKNKIIPGYGKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKK 1418

Query: 280  IVEVLMRQKRMD 291
             V V      + 
Sbjct: 1419 AVTVTATNHLIK 1430



 Score =  107 bits (266), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 47/320 (14%), Positives = 97/320 (30%), Gaps = 37/320 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++     T +   I K + K V                 T++   +  +G  +
Sbjct: 1392 FVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAIF 1451

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV---VKKITVSSKEK- 113
             I D+   KK    +      G     DL PG Y    +          K I  +  +  
Sbjct: 1452 KIVDANDEKKVIRENVKTGADGKVTVKDLEPGTYKFIETEAPKDYVLNTKPIEFTIDKSQ 1511

Query: 114  ----NQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1512 QSFATVTATNSLKTGEVELLKVDEFGDKKPLAGAVFKIVDVNNNDVRTDLTTDADGKTKA 1571

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1572 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1631

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            G A+A   + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1632 GTALAGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKP 1691

Query: 270  -EFSVLTGK-STIVEVLMRQ 287
             EF++   +  + + V  + 
Sbjct: 1692 IEFTIKESQGISPITVTAKN 1711



 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/281 (13%), Positives = 76/281 (27%), Gaps = 30/281 (10%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNK-KNTLSTTKKIIGGKVSFDLFPGDYLISA 95
             ++        N      G  + + D            T    G      L PG Y +  
Sbjct: 1241 GKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNKGQITVDHLKPGIYYLKE 1300

Query: 96   SFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSI 147
            +           + ++ ++  +         N+   G   L  + K G  +   E +   
Sbjct: 1301 TKAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIPGSAILTKVDKDGKTLAGAEFSVRD 1360

Query: 148  YSNP--NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKII 200
              N        L T+         L   +YQ        +       +   +     K +
Sbjct: 1361 RKNKIIPGYGKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKKAV 1420

Query: 201  DVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMVL 251
             VT  N      +T     ++ G A+A   + I+ A+        +    +        L
Sbjct: 1421 TVTATNHLIKGGVTLTKTDDIDGTALAGAIFKIVDANDEKKVIRENVKTGADGKVTVKDL 1480

Query: 252  SEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
              G Y  I     ++Y       EF++   + +   V    
Sbjct: 1481 EPGTYKFIETEAPKDYVLNTKPIEFTIDKSQQSFATVTATN 1521


>gi|229187585|ref|ZP_04314723.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus BGSC
            6E1]
 gi|228595837|gb|EEK53519.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus BGSC
            6E1]
          Length = 1510

 Score =  141 bits (354), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 93/326 (28%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +N  + K          K  +    +        +  +   G  
Sbjct: 1078 FIETKAPTHYDLNQTPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGAT-LEGAV 1136

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I D  +        T    G     DL PGDY    +               TV   +
Sbjct: 1137 FKIVDQ-NGLDVRTDLTTDKDGKISVSDLRPGDYQFVETKAPTHYDLNQNPINFTVEKSQ 1195

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V   N    G + L  +    G+ +          +  + ++ L T+K    ++ 
Sbjct: 1196 TTTASVTAKNSLTKGAVELTKVDDIDGATLEGAIFKIVDMNGNDVRSDLTTNKDGKISVS 1255

Query: 169  RLGTNNYQITSHYGKYNAIVS-----TVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ           ++       +     ++  VT         +    V     
Sbjct: 1256 DLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 1315

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 1316 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 1375

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   +++ +++ +  K+++ +   +
Sbjct: 1376 TIEKAQASPLQITVSNKKVESSSGGD 1401



 Score =  131 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 50/317 (15%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I K          K  +    +      + N+     G  
Sbjct: 797  FVETKAPKDYDLNKTPIPFTIEKSQPTHVSVTAKNGLTKGGVELTKVDSLNAKETLEGAV 856

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++      +      G  ++ DL PGDY    +     +       K T+   +
Sbjct: 857  FKI-TDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIKFTIERSQ 915

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
                 V   N    G + L  +         +   F I +   H     L TDK     +
Sbjct: 916  TKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVV 975

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGK----IIDVTIQNRAAKITFKLVSEMG 220
              L   +Y+        +  ++       V+ G+     +  T       +    V ++ 
Sbjct: 976  DELPPGDYEFIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDVD 1035

Query: 221  GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----E 270
            G A+ D  + I+  +G+ V                L  GDY  I      +Y        
Sbjct: 1036 GSALKDAVFKIVDMNGNNVRSNLTTNKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPIN 1095

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F+V   ++T   V  + 
Sbjct: 1096 FTVEKSQTTTASVTAKN 1112



 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 46/313 (14%), Positives = 86/313 (27%), Gaps = 33/313 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F       +     T +   + KG+ K        +        +++ +   S      +
Sbjct: 985  FIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDVDGSALKDAVF 1044

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++      + T    G     DL PGDY    +     +         TV   + 
Sbjct: 1045 KIV-DMNGNNVRSNLTTNKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQT 1103

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVR 169
                V   N    G    +          +   F I        +  L TDK    ++  
Sbjct: 1104 TTASVTAKNSLTKGAVELTKVDDIDGATLEGAVFKIVDQNGLDVRTDLTTDKDGKISVSD 1163

Query: 170  LGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 1164 LRPGDYQFVETKAPTHYDLNQNPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGA 1223

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             +    + I+  +G+ V                L  GDY  I       Y        F+
Sbjct: 1224 TLEGAIFKIVDMNGNDVRSDLTTNKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFT 1283

Query: 273  VLTGKSTIVEVLM 285
            +  G+S +  V  
Sbjct: 1284 ITKGQSQVTSVTA 1296



 Score =  125 bits (314), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 102/316 (32%), Gaps = 34/316 (10%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
           F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 423 FIETKAPKHYVLDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 482

Query: 58  WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
           +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 483 FNLLDQ-NGKVIKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKRPIVVTVEKSQ 541

Query: 113 KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
           KN   V + N    GG+ L  +    G+ +               +  L T+     ++ 
Sbjct: 542 KNIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMKGTVIRENLTTNSQGKISVS 601

Query: 169 RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
            L   +YQ        +  ++       +E G+   +++          +    V ++ G
Sbjct: 602 NLRPGDYQFVETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDG 661

Query: 222 EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
            A+    + I+  +G+ V      ++        L  GDY  I     ++Y  +     F
Sbjct: 662 TALEGAVFKIVDMNGNDVRTGITTDAKGKISISDLHPGDYQFIETTAPKHYKLDATPIKF 721

Query: 272 SVLTGKSTIVEVLMRQ 287
           ++   ++  ++V  + 
Sbjct: 722 TIEKSQAEKLQVTAKN 737



 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 46/317 (14%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
           F      ++       +   I KG+ + +    + +        +++ +   +   G  +
Sbjct: 610 FVETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDGTALEGAVF 669

Query: 59  HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
            I   ++        T    G     DL PGDY    +             K T+   + 
Sbjct: 670 KIV-DMNGNDVRTGITTDAKGKISISDLHPGDYQFIETTAPKHYKLDATPIKFTIEKSQA 728

Query: 114 NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
            + QV   N+   G + L  +          +  F+I        +  L TDK    +  
Sbjct: 729 EKLQVTAKNSLIEGAVELIKVDDINPDTKLSDAVFNIIDAKGQVVRTNLTTDKDGKVSAS 788

Query: 169 RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
            L   +YQ        +  ++       +E  +   V++          +    V     
Sbjct: 789 NLRPGDYQFVETKAPKDYDLNKTPIPFTIEKSQPTHVSVTAKNGLTKGGVELTKVDSLNA 848

Query: 221 GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
            E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 849 KETLEGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIK 908

Query: 271 FSVLTGKSTIVEVLMRQ 287
           F++   ++  V V    
Sbjct: 909 FTIERSQTKHVFVTATN 925



 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 97/319 (30%), Gaps = 36/319 (11%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
           F   A  E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 46  FIETAAPEHYKLDQTPIKFTIKKGSKEDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 105

Query: 57  SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
            + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 106 EFIIVDAHDTEKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGK 165

Query: 111 KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
            +K    V   N    G    +        +     F I     ++    L+T+K     
Sbjct: 166 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKIVDMDGNEVRTNLVTNKNGKIY 225

Query: 167 LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
           +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 226 VPDLRPGDYQFIETKAPEHYVLDETPIPFTIERNQTKEINVTGKNTLKKGSVELTKIDDI 285

Query: 219 MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                +A+  +++L A G+ V       +        L  G Y  +      +Y      
Sbjct: 286 DTDTKLANAVFNLLDADGEIVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNKTP 345

Query: 270 -EFSVLTGKSTIVEVLMRQ 287
            EF++   ++  + V  + 
Sbjct: 346 IEFTIKKSQTETLHVTAKN 364



 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 86/298 (28%), Gaps = 28/298 (9%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
           T            GK  +    +        ++ +  +   +++ D+   +         
Sbjct: 255 TIERNQTKEINVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLKTN 313

Query: 77  IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
             G  V  +L PG Y    +     +       + T+   +     V   NA   G    
Sbjct: 314 AEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIKKSQTETLHVTAKNALTKGAVEL 373

Query: 130 SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
           S          +   F+I           L+T+      +  L   +YQ        + +
Sbjct: 374 SKVDDIDGTKLEGAVFNIVDMKGTVIHKNLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 433

Query: 188 VST---VVKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
           +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 434 LDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVI 493

Query: 240 -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                  +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 494 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKRPIVVTVEKSQKNIATVTMKN 551



 Score =  107 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/265 (13%), Positives = 73/265 (27%), Gaps = 31/265 (11%)

Query: 53  DSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKIT 107
            +G  + +    +  +          G  V  DL PGDY    +             K T
Sbjct: 7   LAGAVFTL-QDANGTEIAKDLKTDAHGVLVIPDLAPGDYQFIETAAPEHYKLDQTPIKFT 65

Query: 108 VSSKEKNQKQVFILNA----GGIRLYSIYKPGSPIVDDELTFSIYSNPN----HKALLIT 159
           +    K    V +        G    +          +   F I    +     +  L T
Sbjct: 66  IKKGSKEDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEFIIVDAHDTEKVVRKGLTT 125

Query: 160 DKVRSGTLVRLGTNNYQITSHYGKYNAIV---STVVKVEPGKIIDVTIQ----NRAAKIT 212
           D+    +   L   +YQ        +  +        +   +  ++T+      +   +T
Sbjct: 126 DEHGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGKSQKENITVTATNSLKKGAVT 185

Query: 213 FKLVSEMGGEAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNY 267
              + ++    +    + I+   G+      V           L  GDY  I      +Y
Sbjct: 186 LTKIDDIDRTMLKGAIFKIVDMDGNEVRTNLVTNKNGKIYVPDLRPGDYQFIETKAPEHY 245

Query: 268 SR-----EFSVLTGKSTIVEVLMRQ 287
                   F++   ++  + V  + 
Sbjct: 246 VLDETPIPFTIERNQTKEINVTGKN 270



 Score = 79.2 bits (193), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 39/276 (14%), Positives = 74/276 (26%), Gaps = 29/276 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +       +N  + K          K  +    +        +  +   G  
Sbjct: 1171 FVETKAPTHYDLNQNPINFTVEKSQTTTASVTAKNSLTKGAVELTKVDDIDGAT-LEGAI 1229

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +    G          T++  +
Sbjct: 1230 FKIV-DMNGNDVRSDLTTNKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQ 1288

Query: 113  KNQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V  LN    G + L  +       +               +  L TD      + 
Sbjct: 1289 SQVTSVTALNSLTTGSMELTKVDIDHNGTLEGAIFNILDQDGKVVREGLKTDGHGKLIVN 1348

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITF----KLVSEM 219
             L   NYQ+               +S  ++      + +T+ N+  + +     K ++  
Sbjct: 1349 DLKPGNYQLVETKAPEGYQLDASPISFTIEKAQASPLQITVSNKKVESSSGGDNKPITPP 1408

Query: 220  GGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
              E       S    +G+   E+     S  L  G+
Sbjct: 1409 NKEEKPGKETSEELENGNP--ETHGKETSEELENGN 1442



 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 24/176 (13%), Positives = 49/176 (27%), Gaps = 23/176 (13%)

Query: 135 GSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV- 191
            S I      F++      +    L TD      +  L   +YQ        +  +    
Sbjct: 2   ESSIALAGAVFTLQDANGTEIAKDLKTDAHGVLVIPDLAPGDYQFIETAAPEHYKLDQTP 61

Query: 192 --VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT----- 238
               ++ G        + V        +T   V ++ G  +    + I+ A         
Sbjct: 62  IKFTIKKGSKEDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEFIIVDAHDTEKVVRK 121

Query: 239 --VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
               +      +  L  GDY  I     ++Y+       F++   +   + V    
Sbjct: 122 GLTTDEHGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGKSQKENITVTATN 177



 Score = 53.8 bits (127), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 29/82 (35%), Gaps = 10/82 (12%)

Query: 218 EMGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-- 270
                A+A   +++  A+G  +      ++        L+ GDY  I      +Y  +  
Sbjct: 1   MESSIALAGAVFTLQDANGTEIAKDLKTDAHGVLVIPDLAPGDYQFIETAAPEHYKLDQT 60

Query: 271 ---FSVLTGKSTIVEVLMRQKR 289
              F++  G    + V +  K 
Sbjct: 61  PIKFTIKKGSKEDLPVPVTVKN 82


>gi|169344626|ref|ZP_02865592.1| cell wall surface anchor family protein [Clostridium perfringens C
           str. JGS1495]
 gi|169297236|gb|EDS79348.1| cell wall surface anchor family protein [Clostridium perfringens C
           str. JGS1495]
          Length = 757

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 42/275 (15%), Positives = 85/275 (30%), Gaps = 28/275 (10%)

Query: 35  DAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLIS 94
           +  ++    + ++N  +   G  +++ +           T    G     DL PG+Y   
Sbjct: 306 NIGKVILTKKDSQNGHT-LKGAIFNLQNQE-GINIRTDLTTDENGQISLNDLAPGNYQFI 363

Query: 95  ASFGHVGV-----VKKITVSSKEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSI 147
            +    G        K T+   +K   ++  +N    G  + +     S  V     F++
Sbjct: 364 ETKAPEGYELDETPVKFTIVVGQKEAIKIEKVNIATPGSVILTKKDSQSGHVLKGAIFNL 423

Query: 148 YSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKII 200
            +         L TD+    +L  L   +YQ                V   + V   + I
Sbjct: 424 QNQEGINIRTDLTTDENGQISLNDLAPGDYQFIETKAPEGYELDETPVKFTIVVGQKEAI 483

Query: 201 DVTIQNRA--AKITFKLVSEMGGEAVADTAWSILTASG-----DTVGESANASPSMVLSE 253
            +   N A    +         G  +    +++    G     D   +         L+ 
Sbjct: 484 KIEKVNIATPGSVILTKKDSQSGHVLKGAIFNLQNQEGINIRTDLTTDENGQISLNDLAP 543

Query: 254 GDYTVIARNKERNYSRE-----FSVLTGKSTIVEV 283
           GDY  I       Y  +     F+++ G+   ++V
Sbjct: 544 GDYQFIETKAPEGYELDETPVKFTIVVGQKEAIKV 578



 Score =  110 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 46/312 (14%), Positives = 84/312 (26%), Gaps = 50/312 (16%)

Query: 5   FSSYAKAENMHTTSTLLNNNI-------SKGKGKRVVDAQRITCEARLTENSTSIDSGVS 57
           F      E      T +   I        K +   +     +    + ++ S  +  G  
Sbjct: 362 FIETKAPEGYELDETPVKFTIVVGQKEAIKIEKVNIATPGSVILTKKDSQ-SGHVLKGAI 420

Query: 58  WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
           +++ +           T    G     DL PGDY    +    G        K T+   +
Sbjct: 421 FNLQNQE-GINIRTDLTTDENGQISLNDLAPGDYQFIETKAPEGYELDETPVKFTIVVGQ 479

Query: 113 KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
           K   ++  +N    G  + +     S  V     F++ +         L TD+    +L 
Sbjct: 480 KEAIKIEKVNIATPGSVILTKKDSQSGHVLKGAIFNLQNQEGINIRTDLTTDENGQISLN 539

Query: 169 RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFK--LVSEMGG 221
            L   +YQ                V   + V   + I V   N   ++  K   V +   
Sbjct: 540 DLAPGDYQFIETKAPEGYELDETPVKFTIVVGQKEAIKVEKVNDPNQVELKISKVDKENA 599

Query: 222 EAVADTAWSIL----------------------TASGDTV---GESANASPSMVLSEGDY 256
           + +    + I                          GD+        ++     L  GDY
Sbjct: 600 KPLEGAEFEIFSINDIKNPLKFSFSNLYQKYEFNNQGDSTLKAKSGYSSFTINKLEYGDY 659

Query: 257 TVIARNKERNYS 268
            +        Y 
Sbjct: 660 ILKEIKAPSGYK 671



 Score =  105 bits (262), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 42/266 (15%), Positives = 73/266 (27%), Gaps = 33/266 (12%)

Query: 48  NSTSIDSGVSWHIFDSI------------SNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
           N+  I  G  +++  SI            + +       K   GG       P   LI A
Sbjct: 223 NNKPIKVGQEFYLESSIKPNPDLKLKINYNYQDVKFYFYKYSRGGVKVKPDKPYQSLIRA 282

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGS-PIVDDELTFSIYSNPNHK 154
                   K   ++        V   N G + L          +             N +
Sbjct: 283 ELEDKTNEKSYEIAIDGN---FVPTQNIGKVILTKKDSQNGHTLKGAIFNLQNQEGINIR 339

Query: 155 ALLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRA- 208
             L TD+    +L  L   NYQ                V   + V   + I +   N A 
Sbjct: 340 TDLTTDENGQISLNDLAPGNYQFIETKAPEGYELDETPVKFTIVVGQKEAIKIEKVNIAT 399

Query: 209 -AKITFKLVSEMGGEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARN 262
              +         G  +    +++    G     D   +         L+ GDY  I   
Sbjct: 400 PGSVILTKKDSQSGHVLKGAIFNLQNQEGINIRTDLTTDENGQISLNDLAPGDYQFIETK 459

Query: 263 KERNYSRE-----FSVLTGKSTIVEV 283
               Y  +     F+++ G+   +++
Sbjct: 460 APEGYELDETPVKFTIVVGQKEAIKI 485



 Score = 71.1 bits (172), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 33/276 (11%), Positives = 70/276 (25%), Gaps = 42/276 (15%)

Query: 5   FSSYAKAENMHTTSTLLNNNI-------SKGKGKRVVDAQRITCEARLTENSTSIDSGVS 57
           F      E      T +   I        K +   +     +    + ++ S  +  G  
Sbjct: 455 FIETKAPEGYELDETPVKFTIVVGQKEAIKIEKVNIATPGSVILTKKDSQ-SGHVLKGAI 513

Query: 58  WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
           +++ +           T    G     DL PGDY    +    G        K T+   +
Sbjct: 514 FNLQNQE-GINIRTDLTTDENGQISLNDLAPGDYQFIETKAPEGYELDETPVKFTIVVGQ 572

Query: 113 KNQKQVF--ILNAGGIRLYSIYKPGSPIVDDELTFSI----------------------Y 148
           K   +V             S     +    +   F I                      +
Sbjct: 573 KEAIKVEKVNDPNQVELKISKVDKENAKPLEGAEFEIFSINDIKNPLKFSFSNLYQKYEF 632

Query: 149 SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRA 208
           +N     L       S T+ +L   +Y +          +   + +     +D       
Sbjct: 633 NNQGDSTLKAKSGYSSFTINKLEYGDYILKEIKAPSGYKLGKDIYI----HLDSNNSYYK 688

Query: 209 AKITFKLVSEMGGEAVADTAWSILTASGDTVGESAN 244
                K ++    E++     ++    G  + ++  
Sbjct: 689 VGENGKNINLDKNESLNLYEINVENEKGIVLPDTGG 724


>gi|229130606|ref|ZP_04259562.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
            BDRD-Cer4]
 gi|228652945|gb|EEL08827.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
            BDRD-Cer4]
          Length = 3139

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/326 (13%), Positives = 94/326 (28%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGK-------RVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++       +   I + + K         +    +           +   G  
Sbjct: 2734 FIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTEGSVELIKVDDAKQNTTLEGAV 2793

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +           T    G  V  +L PGDY    +     +       K TV   +
Sbjct: 2794 FKIVNKD-GHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPIKFTVKKGQ 2852

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            +    V   N    G + L  +    G+ +             + ++ L TDK    ++ 
Sbjct: 2853 EKIASVTATNSLTKGAVELTKVDDIDGTTLEGAIFKIVDMDGKDVRSDLTTDKDGKISVS 2912

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     +I  VT         I    V     
Sbjct: 2913 DLRPGDYQFIETKAPTGYDLNIKPIPFTITKGQSQITSVTALNSLTTGSIELTKVDIDHH 2972

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 2973 GTLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETQAPKGYQLDASPINF 3032

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++T +++ +  K+++ +   +
Sbjct: 3033 TIDKAQATPLQITVSNKKIESSSGGD 3058



 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1711 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1770

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1771 VRTDLVTNSKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1830

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1831 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFI 1890

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1891 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTILEGAEF 1950

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1951 IIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 2010

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 2011 KENITVTATN 2020



 Score =  122 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +I  G 
Sbjct: 1889 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTILEGA 1948

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1949 EFIIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 2008

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 2009 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2068

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2069 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKNGSVELTKIDDI 2128

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2129 DINTKLANAVFNLLDADGELVKEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKRP 2188

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2189 IVFTIKKSQTETLHVTATN 2207



 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 48/318 (15%), Positives = 88/318 (27%), Gaps = 36/318 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I K + +++       +    +        N  +  S   
Sbjct: 2546 FVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELVKVDDINPDTKLSDAV 2605

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            ++I      K      T    G   + +L PGDY    +               T+   +
Sbjct: 2606 FNII-DAKGKIVRTDLTTDKDGKITATNLRPGDYQFIETKAPKDYDLNKTPISFTIERSQ 2664

Query: 113  KNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                 V   N    GG+ L  +       + +   F I      + +  L+T+K      
Sbjct: 2665 LTHASVTAKNGLTKGGVELTKVDSIDKKEMLEGAVFKITDLNGNDIRTNLVTNKDGKIIA 2724

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITF-KLVSEM 219
              L   +YQ        +  ++       +E  +   V +          +   K+    
Sbjct: 2725 KDLQPGDYQFIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTEGSVELIKVDDAK 2784

Query: 220  GGEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE---- 270
                +    + I+   G     D   +         L  GDY  I      +Y       
Sbjct: 2785 QNTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPI 2844

Query: 271  -FSVLTGKSTIVEVLMRQ 287
             F+V  G+  I  V    
Sbjct: 2845 KFTVKKGQEKIASVTATN 2862



 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 52/310 (16%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1617 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1675

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1676 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1735

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1736 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYKL 1795

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1796 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1855

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1856 TLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1915

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1916 DLPIPVTVKN 1925



 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 93/319 (29%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K +        + +        +++ +   +   G
Sbjct: 2357 TYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDDVDGTTLEG 2416

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              + I   ++      +      G     DL PGDY    +     +         T++ 
Sbjct: 2417 AVFKIV-DMNGTVIRKNLVTNQQGKISVSDLRPGDYQFIETTAPKHYDLNKEPIPFTITK 2475

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGT 166
             + +   V   N    G    S           +  F I      + +  L TD     +
Sbjct: 2476 SQADPISVTATNSLTKGAVELSKVDDVDGTALKDAVFKITDLNGNDIRTELTTDVHGKIS 2535

Query: 167  LVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG- 220
            +  L   +YQ        +       +   +K    + + VT  N   +   +LV     
Sbjct: 2536 VSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELVKVDDI 2595

Query: 221  --GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 ++D  ++I+ A G  V      +      +  L  GDY  I     ++Y      
Sbjct: 2596 NPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITATNLRPGDYQFIETKAPKDYDLNKTP 2655

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   + T   V  + 
Sbjct: 2656 ISFTIERSQLTHASVTAKN 2674



 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/320 (11%), Positives = 88/320 (27%), Gaps = 33/320 (10%)

Query: 3    ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
            I+ +S    E       ++  +   G G        +  +     +   I SGV + +F 
Sbjct: 1135 ITGNSLKLTETEKIEEIVVKVSSGSGGGSATKGRGNLQIKKVDNADPNKILSGVVFTLF- 1193

Query: 63   SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKN 114
              +      + T    G     +L   +YL+       G V          + + ++E  
Sbjct: 1194 DRTGTTAIRTITTDKNGIAQFNNLKRDEYLLREMKTLDGYVISKELKAGKLVKLGAEETT 1253

Query: 115  QKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA----LLITDKVRSGTLVRL 170
               +      G  + +     +        FS+    ++       LIT+     T+  L
Sbjct: 1254 TYTLKNEKFVGKVVLTKTDAHNKEKLKNAVFSLLDQNHNVIPEHKELITNDKGQITVDNL 1313

Query: 171  GTNNYQITSHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEA 223
                Y +       +  +        +E  +      +         +    V +  G  
Sbjct: 1314 KPGTYYLKEIKAPEHYQLDDRLIEFTIEEDQTTVINKEAQNNLIRGSVILTKVDKE-GNT 1372

Query: 224  VADTAWSILTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
            +    +S+   +   +               +  L  G+Y  +      +Y  +     F
Sbjct: 1373 LEGAVFSVRDRNNKRIPGYTKLTTNGNGQIEAKNLLPGEYQFVEEKAPEHYEIDKKPLKF 1432

Query: 272  SVLTGKSTIVEVLMRQKRMD 291
            +V   +   + V      + 
Sbjct: 1433 TVEKSQQKALTVTATNHLIK 1452



 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/298 (13%), Positives = 83/298 (27%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        +  +  +   +++ D+   +         
Sbjct: 2098 TIERSQTKEINVTGKNALKNGSVELTKIDDIDINTKLANAVFNLLDAD-GELVKEGLKTN 2156

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +         T+   +     V   N    G    
Sbjct: 2157 DEGKIVVENLRPGTYQFVETIAPEHYDLDKRPIVFTIKKSQTETLHVTATNTLTKGAVKL 2216

Query: 130  SIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S        V  +  F I +         L+T++     +  L   +YQ        + +
Sbjct: 2217 SKVDDVDGTVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYV 2276

Query: 188  VSTV---VKVEPGK----IIDVTIQNRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+     +  T   +   I   K+        +AD  +++L   G  +
Sbjct: 2277 LDETPIKFTIEKGQKKAISLTATNSLKQGSIELLKVDDLNTQTKLADAVFNLLDQDGKVL 2336

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   S        L  G Y  +      +Y  +     F++   +  I  V M+ 
Sbjct: 2337 KTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKN 2394



 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 43/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+       L   + K + K +                ++ +   +   G  +
Sbjct: 1414 FVEEKAPEHYEIDKKPLKFTVEKSQQKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1473

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1474 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGAYKFIETEAPKDYTLSTNPIEFTIDKSQ 1533

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1534 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1593

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1594 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1653

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1654 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1713

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1714 KPIKFTITESQTTQATVTAKN 1734


>gi|255605664|ref|XP_002538430.1| conserved hypothetical protein [Ricinus communis]
 gi|223512190|gb|EEF23954.1| conserved hypothetical protein [Ricinus communis]
          Length = 241

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 84/167 (50%), Positives = 117/167 (70%), Gaps = 3/167 (1%)

Query: 128 LYSIYKPGSPIVDDELTFSIY---SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKY 184
           L  +  P   I  +EL+FSIY   +  + +  L+ D V+  TLV L    Y + S YG+ 
Sbjct: 23  LECVSGPDVCIPPNELSFSIYSSETKEDGERGLVMDDVKPNTLVGLSAGTYHVVSEYGEV 82

Query: 185 NAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESAN 244
           NA++   ++VE GK+ + TIQ+RAAK+TFKLVS+ GGEA+ADTAWSILTA+GD VGES +
Sbjct: 83  NAVIRADIQVEAGKVTEATIQHRAAKLTFKLVSDAGGEAIADTAWSILTAAGDIVGESVS 142

Query: 245 ASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMD 291
           A P+MVL+EG YT +ARNK++ Y R+F+V  G +T VEVLM+Q++  
Sbjct: 143 AFPTMVLAEGRYTAVARNKDKIYQRDFTVAAGMNTDVEVLMKQQQPQ 189



 Score = 49.2 bits (115), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/168 (11%), Positives = 46/168 (27%), Gaps = 5/168 (2%)

Query: 41  CEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHV 100
            E     +     + +S+ I+ S + +          +       L  G Y + + +G V
Sbjct: 23  LECVSGPDVCIPPNELSFSIYSSETKEDGERGLVMDDVKPNTLVGLSAGTYHVVSEYGEV 82

Query: 101 GVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITD 160
             V +  +  +     +  I +      + +          +  +SI +           
Sbjct: 83  NAVIRADIQVEAGKVTEATIQHRAAKLTFKLVSDAGGEAIADTAWSILTAAGDIVGE--- 139

Query: 161 KVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKIIDVTIQNRA 208
            V +   + L    Y   +              V  G   DV +  + 
Sbjct: 140 SVSAFPTMVLAEGRYTAVARNKDKIYQ--RDFTVAAGMNTDVEVLMKQ 185


>gi|52140206|ref|YP_086625.1| collagen adhesion protein [Bacillus cereus E33L]
 gi|51973675|gb|AAU15225.1| collagen adhesion protein [Bacillus cereus E33L]
          Length = 3393

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 45/326 (13%), Positives = 92/326 (28%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +N  + K          K  +    +        + T+   G  
Sbjct: 2977 FIETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGTT-LEGAI 3035

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I DS +        T    G     DL PGDY    +     +         TV   +
Sbjct: 3036 FKIVDS-NGHDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQ 3094

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                 V   N    G    +          +   F I  +  H     L TDK    ++ 
Sbjct: 3095 TATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDSNGHDVRTDLTTDKDGKISVS 3154

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ           ++       +  G+    ++          +    V     
Sbjct: 3155 DLRPGDYQFIETKAPTGYDLNAKPIPFTIPKGQSQVTSVTALNSLTTGSMELTKVDIDHN 3214

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 3215 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 3274

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   +++ +++ +  K+++ +   +
Sbjct: 3275 TIEKAQASPLQITVSNKKVESSSGGD 3300



 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 45/316 (14%), Positives = 85/316 (26%), Gaps = 35/316 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +   + KG+ K         +    +        +  +   G  
Sbjct: 2791 FIETKAPNHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELTKVDDIDGAT-LEGAV 2849

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +     +         TV   +
Sbjct: 2850 FKIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQTPINFTVEKSQ 2908

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                 V   N    G    +          +   F I     +     L TDK    ++ 
Sbjct: 2909 TATASVTATNSLTKGAVELTKVDDIDGATLEGAVFKIVDMNGNDVRTDLTTDKDGKISVS 2968

Query: 169  RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       VE  +    ++          +    V ++ G
Sbjct: 2969 DLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDG 3028

Query: 222  EAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSR-----EF 271
              +    + I+ ++G     D   +         L  GDY  I      +Y        F
Sbjct: 3029 TTLEGAIFKIVDSNGHDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINF 3088

Query: 272  SVLTGKSTIVEVLMRQ 287
            +V   ++    V  + 
Sbjct: 3089 TVEKSQTATASVTAKN 3104



 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 43/310 (13%), Positives = 87/310 (28%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
                 +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1674 KNTNPIKFTITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1733

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
               +      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1734 ARTNLVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1793

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S I      F++      +    L TD      +  L   +YQ  
Sbjct: 1794 LTKGKVKLIKEDDVDSKIALAGAVFTLQDATGKEIAKDLKTDDYGVLVIPDLAPGDYQFI 1853

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + VT       +T   V ++ G  +    +
Sbjct: 1854 ETDAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGVTLEGAEF 1913

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1914 IIVDAHDTKKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGKSQ 1973

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1974 KENITVTATN 1983



 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 102/316 (32%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2229 FIETKAPKHYVLDETPIHFTIEKGQKKAISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2288

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2289 FNLLDQ-NGKVLKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQ 2347

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K+   V + N    GG+ L  +    G+ +               +  L T+     ++ 
Sbjct: 2348 KDIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMKGTVIRKSLTTNSQGKISVP 2407

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    V ++ G
Sbjct: 2408 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVDLSKVDDIDG 2467

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G  V      ++   +    L  GDY  I     ++Y  +     F
Sbjct: 2468 TALEGAIFKIVDMNGHDVRTGITTDAKGKASISDLHPGDYQFIETTAPKHYKLDATPIKF 2527

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  +++  + 
Sbjct: 2528 TIEKSQAEKLQITAKN 2543



 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 43/287 (14%), Positives = 79/287 (27%), Gaps = 29/287 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    +        N  +  S   ++I      K    + T    G   + +L P
Sbjct: 2540 TAKNSLIEGAVELIKVDDINPDTKLSDAVFNII-DAKGKIVRANLTTDKDGKVSASNLRP 2598

Query: 89   GDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY    +     +         T+   +     V   N    GG+ L  +    +    
Sbjct: 2599 GDYQFVETKAPKHYDLNKTPIPFTIEKSQTTHVSVTAKNGLTKGGVELTKVDSIDAKDTL 2658

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
            +   F I     +     L+T+K        L   +YQ        +  ++       +E
Sbjct: 2659 EGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNETPIKFTIE 2718

Query: 196  PGKIIDVTIQ----NRAAKITF-KLVSEMGGEAVADTAWSILTASG-----DTVGESANA 245
              +   V++          +   K+        +    + I+   G     D   +    
Sbjct: 2719 RSQTKHVSVTATNSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHDVRTDLTTDKNGR 2778

Query: 246  SPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                 L  GDY  I      +Y        F+V  G+  I  V    
Sbjct: 2779 LVVDGLPPGDYEFIETKAPNHYDLNETPIKFTVKKGQEKIASVTATN 2825



 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 50/310 (16%), Positives = 99/310 (31%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1580 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1638

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +     V   N 
Sbjct: 1639 IRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNPIKFTITESQTTSATVTAKNS 1698

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH---KALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   +   +  L+T+      +  L   NY++
Sbjct: 1699 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDARTNLVTNSEGKLVVDDLRPGNYKL 1758

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+         A+A   +
Sbjct: 1759 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVDSKIALAGAVF 1818

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I  +   +Y  +     F++  G   
Sbjct: 1819 TLQDATGKEIAKDLKTDDYGVLVIPDLAPGDYQFIETDAPEHYKLDQTPIKFTIKKGSKD 1878

Query: 280  IVEVLMRQKR 289
             + V +    
Sbjct: 1879 DLPVPVTVTN 1888



 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG    +     V    +T    LT   +       G 
Sbjct: 1852 FIETDAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGVTLEGA 1911

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1912 EFIIVDAHDTKKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGK 1971

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I     ++    L+TDK     
Sbjct: 1972 SQKENITVTATNNLKKGAVTLTKIDDIDRTMLKGAIFKIVDMDGNEVRTNLVTDKNGKIY 2031

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2032 VPDLRPGDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDI 2091

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L A+G+ V       +        L  G Y  +      +Y      
Sbjct: 2092 DTDTKLANAVFNLLDANGEIVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNKTP 2151

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + V  + 
Sbjct: 2152 IEFTIKKSQTETLRVTAKN 2170



 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++       +   I K + K V                 T++   +  +G  +
Sbjct: 1379 FVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAVF 1438

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    + T    G     DL PG Y    +             + T+   +
Sbjct: 1439 KIVDANDEKKVIRKNVTTGADGKVTVKDLEPGTYKFIETEAPKDYVLNTNPIEFTIDKSQ 1498

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1499 QSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIVDVNNNDVRTDLTTDADGKTKA 1558

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1559 DKLRPGTYKFIETEAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1618

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
            G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1619 GTALEGAVFKIVDANDEKKVIRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNP 1678

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++T   V  + 
Sbjct: 1679 IKFTITESQTTSATVTAKN 1697



 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/298 (12%), Positives = 87/298 (29%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++    + +         
Sbjct: 2061 TIERSQTKEINVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLL-DANGEIVEEGLKTN 2119

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA---GGIRL 128
              G  V  +L PG Y    +     +       + T+   +    +V   NA   GG+ L
Sbjct: 2120 AEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIKKSQTETLRVTAKNALTKGGVEL 2179

Query: 129  YSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
              +     + +                  L+T+      +  L   +YQ        + +
Sbjct: 2180 SKVDDIDDTKLEGAVFNIVDMKGTVIHKDLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2239

Query: 188  VSTV---VKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2240 LDETPIHFTIEKGQKKAISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVL 2299

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2300 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKDIATVTMKN 2357



 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/287 (12%), Positives = 78/287 (27%), Gaps = 34/287 (11%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
              +       +N     SG  + ++   + K      T    G     +L    YL+  +
Sbjct: 1133 GNLEIIKVDNDNKKVPLSGAEFTLY-DRTGKTVIRKITTDKDGIAKFNNLKRDKYLLKET 1191

Query: 97   FGHVGVVKK--------ITVSSKEKNQKQVFILN-AGGIRLYSIYKPGSPIVDDELTFSI 147
                G V          + + S+E    ++      G + L         +      F++
Sbjct: 1192 KAPEGYVISWDLKQGKIVELGSQETTTYKLANKKFVGKVVLTKSDDLNKNVTLQGAVFTL 1251

Query: 148  YSNP----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKII 200
                    +    L T+     T+  L    Y +       +  +      VK+   +  
Sbjct: 1252 LDKDKKIISEHEELTTNDKGQITVDHLKPGTYYLKEIKAPEHYKLDDRLIEVKIAEDQTT 1311

Query: 201  ----DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSM 249
                  T            V +  G+ +A   +S+   +                   + 
Sbjct: 1312 VINRTATNSLIPGSAILTKVDKD-GKTLAGAEFSVRDRNNIKVPGYEKLTTNDQGQIEAK 1370

Query: 250  VLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
             L  GDY  +     ++Y  +     F+++  +   V V      + 
Sbjct: 1371 DLRPGDYQFVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIK 1417


>gi|218234357|ref|YP_002370134.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus B4264]
 gi|218162314|gb|ACK62306.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus B4264]
          Length = 3210

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 47/325 (14%), Positives = 98/325 (30%), Gaps = 33/325 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+     T +   + KG+ K        +         ++ +   +   G  +
Sbjct: 2806 FIETKAPEHYDLNDTPIKFTVKKGQEKIASVTATNSLTKGAVELTKVDDIDGTTLEGAIF 2865

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I D    K      T    G     DL PGDY    +     +       K T+   + 
Sbjct: 2866 KIVDMD-GKNVRSDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPIKFTIEKNQT 2924

Query: 114  NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
             +  V   N    G + L  +    G+ +          +  + +  L TDK    ++  
Sbjct: 2925 AKASVTATNSLTKGAVELIKVDDIDGTTLKGAIFKIVDMNGKDVRTDLTTDKDGKISVSN 2984

Query: 170  LGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGGE 222
            L   +YQ                +   +     ++  VT      A  I    V      
Sbjct: 2985 LRPGDYQFIETKAPTGYDLNVKPIPFTITKGQSQVTSVTALNSLTAGSIELTKVDIDHHG 3044

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FS 272
             +    ++IL   G  +      +         L  G Y ++     + Y  +     F+
Sbjct: 3045 TLEGAIFNILDQDGKVIREGLKTDQHGKVIVNDLKPGTYQLVETKAPKGYQLDASPINFT 3104

Query: 273  VLTGKSTIVEVLMRQKRMDKNGQHN 297
            +   ++T +++ +  K+++ +   +
Sbjct: 3105 IDKAQATPLQITVSNKKIESSSGGD 3129



 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 84/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1689 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1748

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +                + T+   ++    +   N 
Sbjct: 1749 VRTDLVTNSKGMLVVDDLRPGNYKLIEIKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1808

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1809 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDHGVLVIPDLAPGDYQFI 1868

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1869 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1928

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  +     ++YS       F++   +
Sbjct: 1929 IIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFVEVKAPKDYSLSKDSIPFTIEKSQ 1988

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1989 KENITVTATN 1998



 Score =  125 bits (314), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 44/316 (13%), Positives = 95/316 (30%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++   +   +   I K + + +      + +       ++ +   ++  G  +
Sbjct: 1964 FVEVKAPKDYSLSKDSIPFTIEKSQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIF 2023

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++ K+   +      G     DL PGDY    +     +         T+   + 
Sbjct: 2024 KIV-DMNGKEVHTNLVTDKNGKISVSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQT 2082

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
             +  V   NA   G + L  I             F++           L T+      + 
Sbjct: 2083 KEINVTGKNALKKGSVELTKIDDIDINTKLANAVFNLLDADGELVEEGLKTNDEGKIVVE 2142

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQN--RAAKITFKLVSEMGG 221
             L    YQ        +       +   +K    + + +T  N      +    V ++ G
Sbjct: 2143 NLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHITATNALTKGAVKLSKVDDVDG 2202

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              + D  + I+  +GD V                L  GDY  I     ++Y  +     F
Sbjct: 2203 TVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKF 2262

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++  G+   + +  + 
Sbjct: 2263 TIEKGQKKAISLTAKN 2278



 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 50/318 (15%), Positives = 84/318 (26%), Gaps = 36/318 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGK-------RVVDAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I K + +         +    +        N  +  S   
Sbjct: 2524 FIETKAPEHYKLDSTPIKFTIKKSQKEKFQVTATNSLTEGSVELIKVDDINPDTKLSDAV 2583

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            ++I      K      T    G     DL PGDY    +               T+   +
Sbjct: 2584 FNIV-DAKGKIVRSDLTTDKDGKISVSDLRPGDYQFIETKAPKDYDLNKTPIDFTIERSQ 2642

Query: 113  KNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
                 V   N    GG+ L  I       + +   F I     +     L+T+K      
Sbjct: 2643 LTHVSVTAKNGLTKGGVELTKIDSVDKKEMLEGAVFKITDMNGNDIRTNLVTNKDGKIIA 2702

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITF-KLVSEM 219
              L   +YQ        +  ++       +E  +   V +          +   K+    
Sbjct: 2703 KDLQPGDYQFIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTKGSVELIKVDDAK 2762

Query: 220  GGEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE---- 270
                +    + I+   G     D   +         L  GDY  I      +Y       
Sbjct: 2763 QNTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNDTPI 2822

Query: 271  -FSVLTGKSTIVEVLMRQ 287
             F+V  G+  I  V    
Sbjct: 2823 KFTVKKGQEKIASVTATN 2840



 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 95/316 (30%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I KG+ K +       +    I        N+ +  +   
Sbjct: 2244 FIETKAPKHYVLDETPIKFTIEKGQKKAISLTAKNSLKQGSIELLKVDDLNTQTKLADAV 2303

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA-----SFGHVGVVKKITVSSKE 112
            +++ D    K           G  V  +L PG Y          +         T+   +
Sbjct: 2304 FNLLDQD-GKVLKTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQ 2362

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K+   V + N    GG+ L  +    G+ +          +    +  L+T++    ++ 
Sbjct: 2363 KDIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFKIVDMNGTVIRKDLVTNQQGKISVS 2422

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +   +   +++          +    V ++ G
Sbjct: 2423 DLRPGDYQFIETTAPKHYDLNKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVEG 2482

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+ D  + I   +G+ +                L  GDY  I      +Y  +     F
Sbjct: 2483 TALKDAIFKITDMNGNDIRTELTTNVHGKIYVSDLRPGDYQFIETKAPEHYKLDSTPIKF 2542

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   +    +V    
Sbjct: 2543 TIKKSQKEKFQVTATN 2558



 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 52/310 (16%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1595 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1653

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1654 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1713

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1714 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYKL 1773

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1774 IEIKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1833

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1834 TLQDATGKEIMKDLTTDDHGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1893

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1894 DLPIPVTVKN 1903



 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 94/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1867 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1926

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1927 EFIIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFVEVKAPKDYSLSKDSIPFTIEK 1986

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1987 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2046

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2047 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKKGSVELTKIDDI 2106

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2107 DINTKLANAVFNLLDADGELVEEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2166

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + +    
Sbjct: 2167 IVFTIKKSQTETLHITATN 2185



 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 34/312 (10%), Positives = 85/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1121 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1179

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1180 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1239

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1240 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNQGQITVDNLKPGTYYLQ 1299

Query: 179  SHYGKYNAIVSTV---VKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  + +      ++  +        T              +  G+ +A   +S+
Sbjct: 1300 ETTAPEHYKLDSTPIQFTIKEDQTTVINRTATNSLIPGSAILTKFDKD-GKTLAGAEFSV 1358

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                   +               +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1359 RDRYNKVIRGYEKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKKPIEFTIIKSQKK 1418

Query: 280  IVEVLMRQKRMD 291
             V V      + 
Sbjct: 1419 AVTVTATNHLIK 1430



 Score =  110 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 43/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++       +   I K + K V                ++ +   +   G  +
Sbjct: 1392 FVEEKAPKDYDIDKKPIEFTIIKSQKKAVTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1451

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1452 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGAYKFIETEAPKDYTLSTNPIEFTIDKSQ 1511

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1512 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1571

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1572 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1631

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1632 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1691

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1692 KPIKFTITESQTTQATVTAKN 1712


>gi|296505781|ref|YP_003667481.1| collagen adhesion protein [Bacillus thuringiensis BMB171]
 gi|296326833|gb|ADH09761.1| collagen adhesion protein [Bacillus thuringiensis BMB171]
          Length = 3121

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/326 (13%), Positives = 94/326 (28%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGK-------RVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++       +   I + + K         +    +           +   G  
Sbjct: 2716 FIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTEGSVELIKVDDAKQNTTLEGAV 2775

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +           T    G  V  +L PGDY    +     +       K TV   +
Sbjct: 2776 FKIVNKD-GHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPIKFTVKKGQ 2834

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            +    V   N    G + L  +    G+ +             + ++ L TDK    ++ 
Sbjct: 2835 EKIASVTATNSLTKGAVELTKVDDIDGTTLEGAIFKIVDMDGKDVRSDLTTDKDGKISVS 2894

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     +I  VT         I    V     
Sbjct: 2895 DLRPGDYQFIETKAPTGYDLNIKPIPFTITKGQSQITSVTALNSLTTGSIELTKVDIDHH 2954

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 2955 GTLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETQAPKGYQLDASPINF 3014

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++T +++ +  K+++ +   +
Sbjct: 3015 TIDKAQATPLQITVSNKKIESSSGGD 3040



 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1693 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1752

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1753 VRTDLVTNSKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1812

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1813 LTKGKVKLIKEDDVESSKALARAVFTLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFI 1872

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1873 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTILEGAEF 1932

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1933 IIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 1992

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1993 KENITVTATN 2002



 Score =  121 bits (304), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +I  G 
Sbjct: 1871 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTILEGA 1930

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1931 EFIIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 1990

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1991 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2050

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2051 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKNGSVELTKIDDI 2110

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2111 DINTKLANAVFNLLDADGELVKEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2170

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2171 IVFTIKKSQTETLHVTATN 2189



 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/318 (15%), Positives = 88/318 (27%), Gaps = 36/318 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I K + +++       +    +        N  +  S   
Sbjct: 2528 FVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELVKVDDINPDTKLSDAV 2587

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            ++I      K      T    G   + +L PGDY    +               T+   +
Sbjct: 2588 FNII-DAKGKIVRTDLTTDKDGKITATNLRPGDYQFIETKAPKDYDLNKTPISFTIERSQ 2646

Query: 113  KNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                 V   N    GG+ L  +       + +   F I      + +  L+T+K      
Sbjct: 2647 LTHASVTAKNGLTKGGVELTKVDSIDKKEMLEGAVFKITDLNGNDIRTNLVTNKDGKIIA 2706

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITF-KLVSEM 219
              L   +YQ        +  ++       +E  +   V +          +   K+    
Sbjct: 2707 KDLQPGDYQFIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTEGSVELIKVDDAK 2766

Query: 220  GGEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE---- 270
                +    + I+   G     D   +         L  GDY  I      +Y       
Sbjct: 2767 QNTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPI 2826

Query: 271  -FSVLTGKSTIVEVLMRQ 287
             F+V  G+  I  V    
Sbjct: 2827 KFTVKKGQEKIASVTATN 2844



 Score =  119 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 52/310 (16%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1599 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1657

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1658 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1717

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1718 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYKL 1777

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1778 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALARAVF 1837

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1838 TLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1897

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1898 DLPIPVTVKN 1907



 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 93/319 (29%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K +        + +        +++ +   +   G
Sbjct: 2339 TYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDDVDGTTLEG 2398

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              + I   ++      +      G     DL PGDY    +     +         T++ 
Sbjct: 2399 AVFKIV-DMNGTVIRKNLVTNQQGKISVSDLRPGDYQFIETTAPKHYDLNKEPIPFTITK 2457

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGT 166
             + +   V   N    G    S           +  F I      + +  L TD     +
Sbjct: 2458 SQADPISVTATNSLTKGAVELSKVDDVDGTALKDAVFKITDLNGNDIRTELTTDVHGKIS 2517

Query: 167  LVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG- 220
            +  L   +YQ        +       +   +K    + + VT  N   +   +LV     
Sbjct: 2518 VSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELVKVDDI 2577

Query: 221  --GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 ++D  ++I+ A G  V      +      +  L  GDY  I     ++Y      
Sbjct: 2578 NPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITATNLRPGDYQFIETKAPKDYDLNKTP 2637

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   + T   V  + 
Sbjct: 2638 ISFTIERSQLTHASVTAKN 2656



 Score =  114 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 38/320 (11%), Positives = 88/320 (27%), Gaps = 33/320 (10%)

Query: 3    ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
            I+ +S    E       ++  +   G G        +  +     +   I SGV + +F 
Sbjct: 1117 ITGNSLKLTETEKIEEIVVKVSSGSGGGSATKGRGNLQIKKVDNADPNKILSGVVFTLF- 1175

Query: 63   SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKN 114
              +      + T    G     +L   +YL+       G V          + + ++E  
Sbjct: 1176 DRTGTTAIRTITTDKNGIAQFNNLKRDEYLLREMKTLDGYVISKELKAGKLVKLGAEETT 1235

Query: 115  QKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA----LLITDKVRSGTLVRL 170
               +      G  + +     +        FS+    ++       LIT+     T+  L
Sbjct: 1236 TYTLKNEKFVGKVVLTKTDAHNKEKLKNAVFSLLDQNHNVIPEHKELITNDKGQITVDNL 1295

Query: 171  GTNNYQITSHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEA 223
                Y +       +  +        +E  +      +         +    V +  G  
Sbjct: 1296 KPGTYYLKEIKAPEHYQLDDRLIEFTIEEDQTTVINKEAQNNLIRGSVILTKVDKE-GNT 1354

Query: 224  VADTAWSILTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
            +    +S+   +   +               +  L  G+Y  +      +Y  +     F
Sbjct: 1355 LEGAVFSVRDRNNKRIPGYTKLTTNGNGQIEAKNLLPGEYQFVEEKAPEHYEIDKKPLKF 1414

Query: 272  SVLTGKSTIVEVLMRQKRMD 291
            +V   +   + V      + 
Sbjct: 1415 TVEKSQQKALTVTATNHLIK 1434



 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/298 (13%), Positives = 83/298 (27%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        +  +  +   +++ D+   +         
Sbjct: 2080 TIERSQTKEINVTGKNALKNGSVELTKIDDIDINTKLANAVFNLLDAD-GELVKEGLKTN 2138

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +         T+   +     V   N    G    
Sbjct: 2139 DEGKIVVENLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHVTATNTLTKGAATL 2198

Query: 130  SIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S        V  +  F I +         L+T++     +  L   +YQ        + +
Sbjct: 2199 SKVDDVDGTVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYV 2258

Query: 188  VSTV---VKVEPGK----IIDVTIQNRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+     +  T   +   I   K+        +AD  +++L   G  +
Sbjct: 2259 LDETPIKFTIEKGQKKAISLTATNSLKQGSIELLKVDDLNTQTKLADAVFNLLDQDGKVL 2318

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   S        L  G Y  +      +Y  +     F++   +  I  V M+ 
Sbjct: 2319 KTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKN 2376



 Score =  112 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 43/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+       L   + K + K +                ++ +   +   G  +
Sbjct: 1396 FVEEKAPEHYEIDKKPLKFTVEKSQQKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1455

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1456 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGAYKFIETEAPKDYTLSTNPIEFTIDKSQ 1515

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1516 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1575

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1576 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1635

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1636 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1695

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1696 KPIKFTITESQTTQATVTAKN 1716


>gi|229146091|ref|ZP_04274468.1| hypothetical protein bcere0012_32380 [Bacillus cereus BDRD-ST24]
 gi|228637431|gb|EEK93884.1| hypothetical protein bcere0012_32380 [Bacillus cereus BDRD-ST24]
          Length = 939

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 39/279 (13%), Positives = 86/279 (30%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 222 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNANN 281

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 282 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKTQTIEVKTGETGAVQIVN 339

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 340 NKVKGNIEIKKLSDSGKVLPN-VEFTVFTEDGKEVQKVVTKENGIANVEGLTYGKYYFLE 398

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 399 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 458

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
             SG  V     +         L+ G Y+ + +     Y
Sbjct: 459 DESGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPHGY 497



 Score = 95.4 bits (235), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 38/301 (12%), Positives = 81/301 (26%), Gaps = 25/301 (8%)

Query: 15  HTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTT 74
             T T+       G  + V +  +   E +   +S  +   V + +F     +       
Sbjct: 320 DKTQTIEVKTGETGAVQIVNNKVKGNIEIKKLSDSGKVLPNVEFTVFTEDGKEV--QKVV 377

Query: 75  KKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKEKNQKQVFILN--AGGIR 127
            K  G      L  G Y    +    G +         +    K            G ++
Sbjct: 378 TKENGIANVEGLTYGKYYFLETKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVK 437

Query: 128 LYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
           L  +         +   F +            TDK     +  L    Y        +  
Sbjct: 438 LLKVDNEDISKKLEGAVFELKDESGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPHGY 497

Query: 187 I-VSTVVKVEPGKIIDV-----TIQNRAAKITFKLVS-EMGGEAVADTAWSILTASGDTV 239
           + V   +  E  +   +             +    V    G   + +  ++I   +G  V
Sbjct: 498 VLVKEPIMFEIKEHGKIIELLAVNHLIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEV 557

Query: 240 ----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKS-TIVEVLMRQKRMD 291
                +    +    L  G YT       + Y      FS    ++  I++ +++ +++ 
Sbjct: 558 VKGKTDDKGIAKFEKLPFGKYTYKETVAPKGYVLNEETFSFEIKENGQIIKHIVKDEKIP 617

Query: 292 K 292
            
Sbjct: 618 S 618



 Score = 48.8 bits (114), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 32/86 (37%), Gaps = 10/86 (11%)

Query: 208 AAKITFKLVSEMGGEAVADTAWSILTAS----GDTVGESANASPSMVLSEGDYTVIARNK 263
           A  +  K V    GE +A   + +  A+    G     +   +    L  G YT+     
Sbjct: 254 AGSLKIKKV-GENGEVLAGAVFEVFNANNESVGKITTGADGMAELNNLPIGTYTLKEIKA 312

Query: 264 ERNY-----SREFSVLTGKSTIVEVL 284
              Y     ++   V TG++  V+++
Sbjct: 313 PTGYVSDDKTQTIEVKTGETGAVQIV 338


>gi|49478977|ref|YP_039349.1| collagen adhesion protein [Bacillus thuringiensis serovar konkukian
            str. 97-27]
 gi|49330533|gb|AAT61179.1| collagen adhesion protein [Bacillus thuringiensis serovar konkukian
            str. 97-27]
          Length = 3333

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 44/326 (13%), Positives = 89/326 (27%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +N  + K          K  +    +        + T+   G  
Sbjct: 2916 FVETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGTT-LEGAI 2974

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +     +         TV   +
Sbjct: 2975 FKIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQ 3033

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                 V   N    G    +          +   F I  +  H     L T+K    ++ 
Sbjct: 3034 TATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDSNGHDVRTDLTTNKDGKISVS 3093

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         +    V     
Sbjct: 3094 DLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 3153

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 3154 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 3213

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   +++ +++ +  K++D +    
Sbjct: 3214 TIEKAQASPLQITVSNKKIDSSSGGE 3239



 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 47/313 (15%), Positives = 90/313 (28%), Gaps = 33/313 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F       +     T +   + KG+ K        +        +++ +   S   G  +
Sbjct: 2823 FIETKAPTHYKLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSALKGAVF 2882

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 2883 KIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQT 2941

Query: 114  NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
                V   N    G + L  +    G+ +          +  + +  L TDK    ++  
Sbjct: 2942 ATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDMNGNDVRTDLTTDKDGKISVSD 3001

Query: 170  LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 3002 LRPGDYQFIETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGT 3061

Query: 223  AVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             +    + I+ ++G     D             L  GDY  I       Y        F+
Sbjct: 3062 TLEGAIFKIVDSNGHDVRTDLTTNKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFT 3121

Query: 273  VLTGKSTIVEVLM 285
            +  G+S +  V  
Sbjct: 3122 ITKGQSQVTSVTA 3134



 Score =  126 bits (316), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 42/310 (13%), Positives = 88/310 (28%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
                 +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1706 KNTNPIKFTITESQTMSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1765

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
               +      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1766 ARTNLVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNS 1825

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S I      F++      +    L TD+  +  +  L   +YQ  
Sbjct: 1826 LTKGKVKLIKEDDVESSIALAGAVFTLQDANGTEIAKDLKTDEHGALVIPDLAPGDYQFI 1885

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1886 ETAAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1945

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1946 IIVDAHDTEKVVRKGLTTDEHGKISASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGKSQ 2005

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 2006 KENITVTATN 2015



 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 98/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2261 FIETKAPKHYVLDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2320

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2321 FNLLDQ-NGKVIKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQ 2379

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKAL--LITDKVRSGTLV 168
            KN   V + N    G    S          +   F+I           L T+     ++ 
Sbjct: 2380 KNIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMNGTVIRKSLTTNSQGKISVP 2439

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    V ++ G
Sbjct: 2440 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDG 2499

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G  V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2500 TALEGAIFKIVDMNGHDVRTGITTDAKGKVSISDLHPGDYQFIETTAPKHYKLDATPIKF 2559

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2560 TIEKSQAEKLQVTAKN 2575



 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 50/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   A  E+     T +   I KG    +     V    +T    LT   +   +   G 
Sbjct: 1884 FIETAAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1943

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1944 EFIIVDAHDTEKVVRKGLTTDEHGKISASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGK 2003

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I     ++    L TDK     
Sbjct: 2004 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKIVDMDGNEVRTNLGTDKNGKIH 2063

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2064 VPDLRPGDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDI 2123

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L A G+ V       +        L  G Y  +      +Y      
Sbjct: 2124 DTDTKLANAVFNLLDADGEIVEEGLTTNAEGKIVVENLRPGTYQFVETIAPEHYDLNKTP 2183

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + V  + 
Sbjct: 2184 IEFTIKKSQTETLHVTAKN 2202



 Score =  120 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 43/287 (14%), Positives = 76/287 (26%), Gaps = 29/287 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    +           +  S   ++I      K    + T    G   + +L P
Sbjct: 2572 TAKNSLIEGAVELIKVDDITPDTKLSDAVFNII-DAKGKVVRTNLTTDKDGKISASNLRP 2630

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY                    T+   +     V   N    GG+ L  I    +    
Sbjct: 2631 GDYQFVEMKAPQDYDLNETPIPFTIEKSQSTHVSVTAKNGLTKGGVELTKIDSLDTKETL 2690

Query: 141  DELTFSIYS--NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
            +   F I      + +  L+T+K        L   +YQ        +  ++       +E
Sbjct: 2691 EGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLPPGDYQFIETKAPKHYDLNETPIKFTIE 2750

Query: 196  PGKIIDVTIQ----NRAAKITF-KLVSEMGGEAVADTAWSILTASG-----DTVGESANA 245
              +   V +          +   K+        +    + I+   G     D   +    
Sbjct: 2751 RSQTKHVFVTAINSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHNVRTDLTTDKNGR 2810

Query: 246  SPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                 L  GDY  I      +Y        F+V  G+  I  V    
Sbjct: 2811 LVVDELPPGDYEFIETKAPTHYKLNETPIKFTVKKGQEKIASVTATN 2857



 Score =  116 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 53/310 (17%), Positives = 101/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1612 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1670

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +     V   N 
Sbjct: 1671 IRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNPIKFTITESQTMSATVTAKNS 1730

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH---KALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   +   +  L+T+      +  L   NY++
Sbjct: 1731 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDARTNLVTNSEGKLVVDDLRPGNYKL 1790

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGE---AVADTAW 229
                           +   ++     ++ +T +N   K   KL+ E   E   A+A   +
Sbjct: 1791 IETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNSLTKGKVKLIKEDDVESSIALAGAVF 1850

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +   A     L+ GDY  I      +Y  +     F++  G   
Sbjct: 1851 TLQDANGTEIAKDLKTDEHGALVIPDLAPGDYQFIETAAPEHYKLDQTPIKFTIKKGSKD 1910

Query: 280  IVEVLMRQKR 289
             + V +  K 
Sbjct: 1911 DLPVPVTVKN 1920



 Score =  114 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/298 (13%), Positives = 87/298 (29%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++ D+   +      T  
Sbjct: 2093 TIERSQTKEINVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLTTN 2151

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +       + T+   +     V   NA   G    
Sbjct: 2152 AEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIKKSQTETLHVTAKNALTKGAVEL 2211

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S          +   F+I           L+T+      +  L   +YQ        + +
Sbjct: 2212 SKVDDIDGTKLEGAVFNIVDMNGTVIHKNLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2271

Query: 188  VST---VVKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2272 LDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVI 2331

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2332 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKNIATVTMKN 2389



 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 38/307 (12%), Positives = 79/307 (25%), Gaps = 31/307 (10%)

Query: 11   AENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNT 70
             + +  T      + +       +    +              +G  + I   ++N    
Sbjct: 1519 TKPIEFTIDKSQQSFATVTATNSLKTGEVELLKVDEFGDKKPLAGAVFKIV-DVNNNDVR 1577

Query: 71   LSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA-- 123
               T    G   +  L PG Y    +             + T+   +K    V   NA  
Sbjct: 1578 TDLTTDADGKTKADKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALK 1637

Query: 124  GGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSGTLVRLGTNNYQITS 179
             G    +          +   F I    +     +  + T          L   +Y+   
Sbjct: 1638 PGDVELTKVDDIDGTALEGAVFKIVDANDEKKVIRENIKTGADGKAIATGLRPGDYKFIE 1697

Query: 180  HYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVS-EMGGEAVADTAWSI 231
                     +T      +   + +  T+          I    V+     E +    + I
Sbjct: 1698 VTAPKYYDKNTNPIKFTITESQTMSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKI 1757

Query: 232  LTASGDT------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTI 280
            +    +       V  S        L  G+Y +I       Y       EF++  G+ T+
Sbjct: 1758 VNRDTNEDARTNLVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQTL 1817

Query: 281  VEVLMRQ 287
            + +  + 
Sbjct: 1818 LPLTFKN 1824



 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/287 (11%), Positives = 81/287 (28%), Gaps = 34/287 (11%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
              +       +N  ++ +G  + ++   + K      T    G     +L    YL+  +
Sbjct: 1165 GNLEIIKVDNDNKNTLLTGAEFTLY-DRTGKTVIRKITTDKDGIAKFNNLKRDKYLLKET 1223

Query: 97   FGHVGVVKK--------ITVSSKEKNQKQVFILN-AGGIRLYSIYKPGSPIVDDELTFSI 147
                G V          + + S+E    ++      G + L         +      F++
Sbjct: 1224 KAPEGYVISWDLKQGKIVELGSQETTTYKLANKKFVGKVVLTKSDDLNKNVTLQGAVFTL 1283

Query: 148  YSNP----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKII 200
                    +    L T+     T+  L    Y +       +  + +      ++  +  
Sbjct: 1284 LDKDKKIISEHEKLTTNDQGQITVDHLKPGTYYLQETTAPEHYKLDSTPIQFTIKEDQTT 1343

Query: 201  ----DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV-------GESANASPSM 249
                  T            V +  G+ +A   +S+     + +               + 
Sbjct: 1344 VINRTATNSLIPGSAILTKVDKD-GKTLAGAEFSVRDRHNNVIRGYEKLTTNDQGQIEAT 1402

Query: 250  VLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
             L  GDY  +     ++Y  +     F+++  +   V V      + 
Sbjct: 1403 NLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIK 1449



 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 94/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++     T +   I K + K V                 T++   +  +G  +
Sbjct: 1411 FVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAIF 1470

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV---VKKITVSSKEK- 113
             I D+   KK    +      G     DL PG Y    +          K I  +  +  
Sbjct: 1471 KIVDANDEKKVIRENVKTGADGKVTVKDLEPGTYKFIETEAPKDYVLNTKPIEFTIDKSQ 1530

Query: 114  ----NQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1531 QSFATVTATNSLKTGEVELLKVDEFGDKKPLAGAVFKIVDVNNNDVRTDLTTDADGKTKA 1590

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1591 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1650

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
            G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1651 GTALEGAVFKIVDANDEKKVIRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNP 1710

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++    V  + 
Sbjct: 1711 IKFTITESQTMSATVTAKN 1729



 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/281 (14%), Positives = 74/281 (26%), Gaps = 30/281 (10%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNK-KNTLSTTKKIIGGKVSFDLFPGDYLISA 95
             ++        N      G  + + D            T    G      L PG Y +  
Sbjct: 1260 GKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNDQGQITVDHLKPGTYYLQE 1319

Query: 96   SFGH-----VGVVKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSI 147
            +             + T+   +         N+   G   L  + K G  +   E +   
Sbjct: 1320 TTAPEHYKLDSTPIQFTIKEDQTTVINRTATNSLIPGSAILTKVDKDGKTLAGAEFSVRD 1379

Query: 148  YSNP--NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKII 200
              N        L T+         L   +YQ        +       +   +     K +
Sbjct: 1380 RHNNVIRGYEKLTTNDQGQIEATNLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKKAV 1439

Query: 201  DVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMVL 251
             VT  N      +T     ++ G A+A   + I+ A+        +    +        L
Sbjct: 1440 TVTATNHLIKGGVTLTKTDDIDGTALAGAIFKIVDANDEKKVIRENVKTGADGKVTVKDL 1499

Query: 252  SEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
              G Y  I     ++Y       EF++   + +   V    
Sbjct: 1500 EPGTYKFIETEAPKDYVLNTKPIEFTIDKSQQSFATVTATN 1540



 Score = 81.9 bits (200), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 44/276 (15%), Positives = 76/276 (27%), Gaps = 29/276 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +N  + K          K  +    +        + T+   G  
Sbjct: 3009 FIETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGTT-LEGAI 3067

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I DS +        T    G     DL PGDY    +    G          T++  +
Sbjct: 3068 FKIVDS-NGHDVRTDLTTNKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQ 3126

Query: 113  KNQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V  LN    G + L  +       +               +  L TD      + 
Sbjct: 3127 SQVTSVTALNSLTTGSMELTKVDIDHNGTLEGAIFNILDQDGKVVREGLKTDGHGKLIVN 3186

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRA----AKITFKLVSEM 219
             L   NYQ+               +S  ++      + +T+ N+     +    K V+  
Sbjct: 3187 DLKPGNYQLVETKAPEGYQLDASPISFTIEKAQASPLQITVSNKKIDSSSGGEEKPVTPP 3246

Query: 220  GGEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
              E       S     G+   E+     S  L +G+
Sbjct: 3247 NKEEETGKETSEELEKGNP--EAHGKGTSEELEKGN 3280


>gi|218235240|ref|YP_002368336.1| collagen adhesion protein [Bacillus cereus B4264]
 gi|218163197|gb|ACK63189.1| collagen adhesion protein [Bacillus cereus B4264]
          Length = 1093

 Score =  140 bits (352), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 89/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 253 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNANN 312

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 313 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 370

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 371 NKVKGNIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIANVEDLTYGKYYFLE 429

Query: 180 HYGKYNAIVSTVVKV----EPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K ++ T++N   K + KL+        + +   A+ + 
Sbjct: 430 TKTPNGYIGNKTKYPFEIREHNKTLNFTVENTEVKGSVKLLKVDNEDISKKLEGAAFELK 489

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  V     +         L+ G Y+ + +     Y
Sbjct: 490 DASGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 528



 Score = 70.7 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 39/296 (13%), Positives = 88/296 (29%), Gaps = 26/296 (8%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDS----GVSWHIFDSISNKKNTLST 73
           + L +   +   G   V A+      R+   S  +      G  + I    + K    + 
Sbjct: 181 TNLYSVQTNAKSGSYKVVAKNAPNGVRIVSESGEVKDQLSVGEKFRIQIPKNTKTGEFNL 240

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYK 133
           +      KV    + G   +  +   +          K  +   V    AG +++  + +
Sbjct: 241 SVAANLTKVQAIAYRGTDTVQNATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGE 295

Query: 134 PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIVS--- 189
            G   V     F +++  N     IT        +  L    Y +         +     
Sbjct: 296 NGE--VLAGAVFEVFNANNESVGKITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKP 353

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASG----DTVGESAN 244
             ++V+ G+   V I N   K   ++      G+ + +  +++ T  G      V +   
Sbjct: 354 QTIEVKTGETGAVQIVNNKVKGNIEIKKLSDSGKILPNVEFTVFTEDGKEVKKVVTKENG 413

Query: 245 ASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            +    L+ G Y  +       Y        F +    +  +   +    +  + +
Sbjct: 414 IANVEDLTYGKYYFLETKTPNGYIGNKTKYPFEIRE-HNKTLNFTVENTEVKGSVK 468



 Score = 59.6 bits (142), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 32/268 (11%), Positives = 68/268 (25%), Gaps = 26/268 (9%)

Query: 29  KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
             +       +       E+ +    G ++ + D+               G     DL  
Sbjct: 457 TVENTEVKGSVKLLKVDNEDISKKLEGAAFELKDASGKVVGEYK--TDKNGEINVKDLAY 514

Query: 89  GDYLISASFGHVGV-----VKKITVSSKEKNQKQ--VFILNAGGIRLYSIYKPGSPIVDD 141
           G Y         G           +    K  +   V  L  G + +  +          
Sbjct: 515 GKYSFVEKASPNGYVLVKEPIMFEIKEHGKVIELLAVNHLIKGDLEITKVDVADGNNKLP 574

Query: 142 ELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKII 200
              F+IY+    + +   TD        +L    Y           +++           
Sbjct: 575 NAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKETVAPKGYVLNEE--------- 625

Query: 201 DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESAN-----ASPSMVLSEG- 254
             + + +      K + +        T  +  T     +  S +           L  G 
Sbjct: 626 TFSFEIKENGQIIKHIVKDEKIPSIKTTATDKTDGTKEMHTSKSVTIQDKVEYKDLQVGK 685

Query: 255 DYTVIARNKERNYSREFSVLTGKSTIVE 282
           +Y +  +   +  ++   V+ GK   VE
Sbjct: 686 EYNLKGKLMNKETNKPL-VVNGKEVTVE 712


>gi|30021628|ref|NP_833259.1| collagen adhesion protein [Bacillus cereus ATCC 14579]
 gi|29897183|gb|AAP10460.1| Collagen adhesion protein [Bacillus cereus ATCC 14579]
          Length = 1093

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 87/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F+  +
Sbjct: 253 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNVNN 312

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 313 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 370

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 371 NKVKGSIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLE 429

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +   A+ + 
Sbjct: 430 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAAFELK 489

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  V     +         L+ G Y+ + +     Y
Sbjct: 490 DASGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 528



 Score = 70.7 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/274 (12%), Positives = 81/274 (29%), Gaps = 22/274 (8%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +   +   E    +  G  + I    + K    + +      KV    + G   +  
Sbjct: 203 PNGVRIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNLSVAANLIKVQAIAYRGTDTVQN 262

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA 155
           +   +          K  +   V    AG +++  + + G   V     F +++  N   
Sbjct: 263 ATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGENGE--VLAGAVFEVFNVNNESV 315

Query: 156 LLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIVS---TVVKVEPGKIIDVTIQNRAAKI 211
             IT        +  L    Y +         +       ++V+ G+   V I N   K 
Sbjct: 316 GKITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVNNKVKG 375

Query: 212 TFKLVS-EMGGEAVADTAWSILTASG----DTVGESANASPSMVLSEGDYTVIARNKERN 266
           + ++      G+ + +  +++ T  G      V +    +    L+ G Y  +       
Sbjct: 376 SIEIKKLSDSGKILPNVEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLETKTPNG 435

Query: 267 Y-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
           Y        F +    +  +   +    +  + +
Sbjct: 436 YIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 468



 Score = 61.5 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 43/287 (14%), Positives = 80/287 (27%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G ++ + D+    
Sbjct: 445 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAAFELKDASGKV 495

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK-------KITVSSKEKNQKQVFI 120
                      G     DL  G Y         G V        +I    K      V  
Sbjct: 496 VGEYK--TDKNGEINVKDLAYGKYSFVEKASPNGYVLVKEPIMFEIKEHGKIIELLAVNH 553

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 554 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 613

Query: 180 HYGKYNAIVSTV----VKVEPGKIIDVTIQNRA-AKITFKLVSEMGGEAVADTAWSILTA 234
                  +++         E G+II   +++     I  K   +  G     T+ S+   
Sbjct: 614 TVAPKGYVLNEETFSFEIKENGQIIKHIVKDEKIPSIETKATDKTDGTKEMHTSKSVTIQ 673

Query: 235 SGDTVGESANASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
                           L  G +YT+  +   +  ++   V   + T 
Sbjct: 674 D---------KVEYKDLQVGKEYTLKGKLMNKETNKPLVVNGKEVTA 711


>gi|206972368|ref|ZP_03233314.1| collagen adhesion protein [Bacillus cereus AH1134]
 gi|206732693|gb|EDZ49869.1| collagen adhesion protein [Bacillus cereus AH1134]
          Length = 840

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 48/307 (15%), Positives = 102/307 (33%), Gaps = 25/307 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y     +   + LL     K  G   V+ + I   + +    +    SG  + +F+S +
Sbjct: 260 AYKGTNTIQDATVLLERGEEKISGDLSVNWESIGNLKLKKIGENNEALSGAVFDVFNSNN 319

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVG-----VVKKITVSSKEKNQKQVFI 120
            K  T+  T    G     +L  G Y +  +    G       + I + + E    +V  
Sbjct: 320 QKVGTM--TTDKNGIGTLTNLPIGSYTVKETKAPEGHILKENNQTIEIKTGETATIEVKN 377

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR-LGTNNYQITS 179
            +  G            I+   + F+++++   +   +         V  L    Y I  
Sbjct: 378 ESIKGNIEIKKLSDNGKILP-GVEFTVFTSEGKEITKVNTDKNGIAKVDNLKFGKYYIQE 436

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITF---KLVSEMGGEAVADTAWSIL 232
                  +++T        E GK +   ++N+    +    K+    G   + +  ++I 
Sbjct: 437 TKALDGYVINTTKYPFEIKEHGKTLTFEVKNQGITGSLEITKVDVADGNNKLPNAEFTIF 496

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKS-TIVEVL 284
              G  V      +   +    L  G YT         Y      FS    ++  I++ +
Sbjct: 497 NEEGKEVIKGKTNTEGIAKFEKLPFGKYTYRETLAPEGYVLNEETFSFEIKENGQIIKHI 556

Query: 285 MRQKRMD 291
           +  K+++
Sbjct: 557 VEDKKIE 563



 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/288 (13%), Positives = 85/288 (29%), Gaps = 27/288 (9%)

Query: 29  KGKRVVDAQRI--TCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDL 86
                V  + I    E +   ++  I  GV + +F S   +   ++      G     +L
Sbjct: 370 TATIEVKNESIKGNIEIKKLSDNGKILPGVEFTVFTSEGKEITKVN--TDKNGIAKVDNL 427

Query: 87  FPGDYLISASFGHVGVVK-----KITVSS-KEKNQKQVFILN-AGGIRLYSIYKPGSPIV 139
             G Y I  +    G V         +    +    +V      G + +  +        
Sbjct: 428 KFGKYYIQETKALDGYVINTTKYPFEIKEHGKTLTFEVKNQGITGSLEITKVDVADGNNK 487

Query: 140 DDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
                F+I++    + +   T+        +L    Y           +++      +++
Sbjct: 488 LPNAEFTIFNEEGKEVIKGKTNTEGIAKFEKLPFGKYTYRETLAPEGYVLNEETFSFEIK 547

Query: 196 PGKIID---VTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASGDTV----GESANASP 247
               I    V  +     +    V    G   + +  ++I    G  V      +   + 
Sbjct: 548 ENGQIIKHIVEDKKIEGSLEITKVDVADGNNKLPNAEFTIFNEEGKEVVKGKTNTEGIAK 607

Query: 248 SMVLSEGDYTVIARNKERNY---SREFSVLTGKS-TIVEVLMRQKRMD 291
              L  G YT         Y      FS    ++  I++ ++  K+++
Sbjct: 608 FEKLPFGKYTYRETLAPEGYVLNEETFSFEIKENGQIIKHIVEDKKIE 655



 Score =  101 bits (250), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/286 (10%), Positives = 73/286 (25%), Gaps = 26/286 (9%)

Query: 37  QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
             +        +  +      + IF+    +           G      L  G Y    +
Sbjct: 472 GSLEITKVDVADGNNKLPNAEFTIFNEEGKEVIKGK--TNTEGIAKFEKLPFGKYTYRET 529

Query: 97  FGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYS 149
               G           +    +  K +       G + +  +             F+I++
Sbjct: 530 LAPEGYVLNEETFSFEIKENGQIIKHIVEDKKIEGSLEITKVDVADGNNKLPNAEFTIFN 589

Query: 150 NPNHKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIID---V 202
               + +   T+        +L    Y           +++      +++    I    V
Sbjct: 590 EEGKEVVKGKTNTEGIAKFEKLPFGKYTYRETLAPEGYVLNEETFSFEIKENGQIIKHIV 649

Query: 203 TIQNRAAKITFKLVS-EMGGEAVADTAWSILTASGDTV----GESANASPSMVLSEGDYT 257
             +     +    V    G   + +  ++I    G  V      +   +    L  G YT
Sbjct: 650 EDKKIEGSLEITKVDVADGNNKLPNAEFTIFNEEGKEVVKGKTNTEGIAKFEKLPFGKYT 709

Query: 258 VIARNKERNY---SREFSVLTGKSTIV--EVLMRQKRMDKNGQHNT 298
                    Y      FS    ++  +   ++  QK+ ++     T
Sbjct: 710 YRETLAPEGYVLNEETFSFEIKENGQIIKHIVENQKKPEQPTNPET 755



 Score = 73.4 bits (178), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 40/269 (14%), Positives = 83/269 (30%), Gaps = 34/269 (12%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
            Q I       E    ++ G  + I    +      +             L         
Sbjct: 210 PQGIKIVNENGEVKEQLNVGEKFRIQIPKNTNSGKFNLKVISN----LSKLQA------I 259

Query: 96  SFGHVGVVKKITV-----SSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN 150
           ++     ++  TV       K      V   + G ++L  I    +        F ++++
Sbjct: 260 AYKGTNTIQDATVLLERGEEKISGDLSVNWESIGNLKLKKIG--ENNEALSGAVFDVFNS 317

Query: 151 PNHKALLITDKVRS-GTLVRLGTNNYQITSHYGKYNAIV---STVVKVEPGKIIDVTIQN 206
            N K   +T      GTL  L   +Y +         I+   +  ++++ G+   + ++N
Sbjct: 318 NNQKVGTMTTDKNGIGTLTNLPIGSYTVKETKAPEGHILKENNQTIEIKTGETATIEVKN 377

Query: 207 R--AAKITFKLVSEMGGEAVADTAWSILTASGDTV----GESANASPSMVLSEGDYTVIA 260
                 I  K +S   G+ +    +++ T+ G  +     +    +    L  G Y +  
Sbjct: 378 ESIKGNIEIKKLS-DNGKILPGVEFTVFTSEGKEITKVNTDKNGIAKVDNLKFGKYYIQE 436

Query: 261 RNKERNY-----SREFSVLT-GKSTIVEV 283
                 Y        F +   GK+   EV
Sbjct: 437 TKALDGYVINTTKYPFEIKEHGKTLTFEV 465


>gi|229151719|ref|ZP_04279920.1| hypothetical protein bcere0011_32620 [Bacillus cereus m1550]
 gi|228631780|gb|EEK88408.1| hypothetical protein bcere0011_32620 [Bacillus cereus m1550]
          Length = 939

 Score =  140 bits (352), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 40/279 (14%), Positives = 86/279 (30%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 222 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENEEVLAGAVFEVFNANN 281

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 282 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 339

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 340 NKVKGSIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLE 398

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 399 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 458

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
             SG  V     +         L+ G Y+ + +     Y
Sbjct: 459 DESGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 497



 Score = 62.3 bits (149), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 38/287 (13%), Positives = 74/287 (25%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D     
Sbjct: 414 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAVFELKDESGKV 464

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK-------KITVSSKEKNQKQVFI 120
                      G     DL  G Y         G V        +I    K      V  
Sbjct: 465 VGEYK--TDKNGEINVKDLAYGKYSFVEKASPNGYVLVKEPIMFEIKEHGKIIELLAVNH 522

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 523 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 582

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
                  +++             + + +      K + +        T  +  T     +
Sbjct: 583 TVAPKGYVLNEE---------TFSFEIKENGQIIKHIVKDEKIPSIKTTATDKTDGTKEM 633

Query: 240 GESAN-----ASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
             S +           L  G +YT+  +   +  ++   V   + T 
Sbjct: 634 HTSKSVTIQDKVEYKDLQVGKEYTLKGKLMNKETNKPLVVNGKEVTA 680



 Score = 46.1 bits (107), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 30/86 (34%), Gaps = 10/86 (11%)

Query: 208 AAKITFKLVSEMGGEAVADTAWSILTAS----GDTVGESANASPSMVLSEGDYTVIARNK 263
           A  +  K V     E +A   + +  A+    G     +   +    L  G YT+     
Sbjct: 254 AGSLKIKKV-GENEEVLAGAVFEVFNANNESVGKITTGADGMAELNNLPIGTYTLKEIKA 312

Query: 264 ERNYS-----REFSVLTGKSTIVEVL 284
              Y      +   V TG++  V+++
Sbjct: 313 PTGYVSDDKPQTIEVKTGETGAVQIV 338


>gi|228968489|ref|ZP_04129477.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            serovar sotto str. T04001]
 gi|228791195|gb|EEM38809.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            serovar sotto str. T04001]
          Length = 3222

 Score =  140 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 47/325 (14%), Positives = 99/325 (30%), Gaps = 33/325 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+     T +   + KG+ K        +         ++ +   +   G  +
Sbjct: 2818 FIETKAPEHYDLNKTPIKFTVKKGQEKIASVTATNSLTKGAVELTKVDDIDGTTLEGAIF 2877

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I D    K      T    G     DL PGDY    +     +       K T+   + 
Sbjct: 2878 KIVDMD-GKDVRSDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPIKFTIEKSQT 2936

Query: 114  NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
             +  V   N    G + L  +    G+ + +        +  +  + L TDK    ++  
Sbjct: 2937 AKASVTATNSLTKGAVELTKVDDIDGTTLAEAIFKIVDMNGKDVHSDLTTDKDGKISVSD 2996

Query: 170  LGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGGE 222
            L   +YQ                +   +     +I  VT         I    V      
Sbjct: 2997 LRPGDYQFIETKAPTGYDLNIKPIPFTITKGQSQITSVTALNSLTTGSIELTKVDIDHHG 3056

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FS 272
             +    ++IL   G  +      +         L  G+Y ++     + Y  +     F+
Sbjct: 3057 TLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETKAPKGYQLDASPINFT 3116

Query: 273  VLTGKSTIVEVLMRQKRMDKNGQHN 297
            +   ++T +++ +  K+++ +   +
Sbjct: 3117 IDKAQATPLQITVSNKKIESSSGGD 3141



 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/286 (14%), Positives = 82/286 (28%), Gaps = 28/286 (9%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    +      + +   +  G  + I   ++      +      G  ++ DL P
Sbjct: 2661 TAKNGLTKGGVELTKVDSIDKKEMLEGAVFKI-TDLNGNDIRTNLVTNKDGKIIAKDLQP 2719

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIVD 140
            GDY    +             K T+   +     V  +N    G + L  +         
Sbjct: 2720 GDYEFIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTKGSVELIKVDDAKQNTTL 2779

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
            +   F I +   H     L TDK     +  L   +Y+        +  ++       V+
Sbjct: 2780 EGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPIKFTVK 2839

Query: 196  PGK----IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV-----GESANAS 246
             G+     +  T       +    V ++ G  +    + I+   G  V      +     
Sbjct: 2840 KGQEKIASVTATNSLTKGAVELTKVDDIDGTTLEGAIFKIVDMDGKDVRSDLTTDKDGKI 2899

Query: 247  PSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                L  GDY  I     ++Y        F++   ++    V    
Sbjct: 2900 SVSDLRPGDYQFIETKAPKHYDLNQNPIKFTIEKSQTAKASVTATN 2945



 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 54/320 (16%), Positives = 104/320 (32%), Gaps = 37/320 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVV-------DAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I KG+   +V           +    +L +   +   G  
Sbjct: 1598 FIETKAPEHYELRSTPIEFTIEKGQKTPIVITAENGLLPGDVELT-KLDDTDGTALIGAV 1656

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +   N+           G  ++  L PG+Y          +       + T+   +
Sbjct: 1657 FKIVN-NKNEDVRTELVTNQEGKIIATGLRPGNYKFIEMKAPEHYALNKTPIEFTIKESQ 1715

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
                 V   N    GGI L  +    +    +   F I ++        L TDK     +
Sbjct: 1716 ATAINVTATNSLTKGGIELTKVDSVNAKETLEGAVFKIVNDKGEDVRTELTTDKDGKLVV 1775

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV-----VKVEPGKIIDVTIQNRAAKITFKLV---SEM 219
              L   NY++          V+       ++    K+I +T +N   K   KL+      
Sbjct: 1776 QDLRPGNYKLIETKAPTYYDVNEEPIEFIIEKSQQKLIPITFKNSLTKGKVKLIKEDDVE 1835

Query: 220  GGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE---- 270
              +A+A   +++  A+G  +      ++        L+ GDY  I      +Y  +    
Sbjct: 1836 SAKALAGAVFTLQDATGKEIMKDLITDAHGVLVIPDLAPGDYQFIEVKAPEHYKLDQTPI 1895

Query: 271  -FSVLTGKSTIVEVLMRQKR 289
             F++  G    + + +  K 
Sbjct: 1896 KFTIKKGSKEDLPIPVTVKN 1915



 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 89/319 (27%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K + + +               +++ +   ++   
Sbjct: 2160 TYQFVETIAPEHYVLDKKPIVFTIKKSQTEALHVTATNALTKGAVKLSKVDDVDATVLKD 2219

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSS 110
              + I + ++             G     DL PGDY    +             K T+  
Sbjct: 2220 AVFKIVN-MNGDVVHKDLVTNEQGLIEINDLRPGDYQFIETKAPKDYVLDETPIKFTIEK 2278

Query: 111  KEK---NQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNH--KALLITDKVRSG 165
             +K   +      L  G I L  +          +  F++        K  L T+     
Sbjct: 2279 GQKKSISLTTTNSLKQGSIELLKVDDLNDQTKLADAVFNLLDQNGKVLKTDLKTNSEGKI 2338

Query: 166  TLVRLGTNNYQITSHYGKYNAIVS-----TVVKVEPGKIIDVTIQN--RAAKITFKLVSE 218
             +  L    YQ        +  +        ++     I  VT++N      +    V +
Sbjct: 2339 VVENLRPGTYQFVETTAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDD 2398

Query: 219  MGGEAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            + G  +    + I   +G       V           L  GDY  I     ++Y+     
Sbjct: 2399 VDGTTLEGAVFKIADMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYNLNKEP 2458

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   ++  V V    
Sbjct: 2459 IPFTITQSQAEPVSVTATN 2477



 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/319 (15%), Positives = 94/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1879 FIEVKAPEHYKLDQTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1938

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1939 EFIIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFVEVKAPKDYTLSKEPIPFTIEK 1998

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1999 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2058

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2059 VSDLRPGDYQFIETKAPEHYVLEETQIPFTIERSQTKEINVTGKNALKKGSVELTKIDDI 2118

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2119 DINTKLANAVFNLLDADGELVEEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYVLDKKP 2178

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2179 IVFTIKKSQTEALHVTATN 2197



 Score =  115 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/312 (10%), Positives = 81/312 (25%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N   + +G  + ++   + K    
Sbjct: 1140 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNVLLAGAEFTLY-DRTGKTVIR 1198

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1199 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1258

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L                F++             L T+      + +L    Y + 
Sbjct: 1259 VGKVVLTKSDDLNKNATLQGAIFTLLDKDKKVIPKHKELTTNNNGQIIIDKLKPGTYYLQ 1318

Query: 179  SHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  + +      +   +        T            V     + +A   +++
Sbjct: 1319 ETKAPEHYQLDSKLIPFTISIDQTTVVNLTATNSLTKGSALLTKVDNY-NKTLAGAEFTV 1377

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
               +G  +               +  L  G Y  +      +Y  +     F +   ++T
Sbjct: 1378 QDRNGKNIPRYEKLTTNEHGQIEAKDLRPGKYQFVETKAPEHYELDKTPILFEIEKSQTT 1437

Query: 280  IVEVLMRQKRMD 291
            +  V  +   + 
Sbjct: 1438 VASVTAKNALIK 1449



 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 46/319 (14%), Positives = 94/319 (29%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K +        + +        +++ +   +   G
Sbjct: 2347 TYQFVETTAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDDVDGTTLEG 2406

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSS 110
              + I   ++             G     DL PGDY    +               T++ 
Sbjct: 2407 AVFKI-ADMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYNLNKEPIPFTITQ 2465

Query: 111  KEKNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             +     V   N    G + L  +    G+ + D     +  +  + +  L TD     +
Sbjct: 2466 SQAEPVSVTATNSLTKGTVELSKVDDVDGTALKDAIFKITDMNGNDIRTELTTDVHGKIS 2525

Query: 167  LVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG- 220
            +  L   +YQ        +       +   +K    + + VT  N   +   +L+     
Sbjct: 2526 VSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTTTNSLTEGAVELIKVDDI 2585

Query: 221  --GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 ++D  ++I+ A G  V      +      +  L  GDY  I     ++Y      
Sbjct: 2586 NPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITATNLRPGDYQFIEMKAPKHYDLNKTP 2645

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F +   + T   V  + 
Sbjct: 2646 ISFIIEKSQLTHASVTAKN 2664



 Score =  110 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 46/314 (14%), Positives = 86/314 (27%), Gaps = 33/314 (10%)

Query: 7    SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA-----RLTENSTSIDSGVSWHIF 61
                 E+    S L+   IS  +   V      +           +N     +G  + + 
Sbjct: 1319 ETKAPEHYQLDSKLIPFTISIDQTTVVNLTATNSLTKGSALLTKVDNYNKTLAGAEFTVQ 1378

Query: 62   DSISNKKNTL-STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK-----ITVSSKEKNQ 115
            D            T    G   + DL PG Y    +                +   +   
Sbjct: 1379 DRNGKNIPRYEKLTTNEHGQIEAKDLRPGKYQFVETKAPEHYELDKTPILFEIEKSQTTV 1438

Query: 116  KQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLG 171
              V   NA   G    +          +   F I ++ N      L T+K  + T+  L 
Sbjct: 1439 ASVTAKNALIKGDITLTKVDDTDGTTLEGAVFKIVNDKNEDVRTNLKTEKDGTLTVKDLD 1498

Query: 172  TNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE-MGGEA 223
              +YQ           ++       +E  +   ++I          +    V E      
Sbjct: 1499 PGDYQFIETTPPKYYDLNKEPIPFTIEKSQTSIISITAKNSLTTGAVELLKVDEFDKKTP 1558

Query: 224  VADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFSV 273
            +A   + I+    + V      ++     +  L  G Y  I      +Y       EF++
Sbjct: 1559 LAGAMFKIVNDKNEDVRTELTTDTNGTVKASDLRPGKYKFIETKAPEHYELRSTPIEFTI 1618

Query: 274  LTGKSTIVEVLMRQ 287
              G+ T + +    
Sbjct: 1619 EKGQKTPIVITAEN 1632



 Score = 77.3 bits (188), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 27/218 (12%), Positives = 59/218 (27%), Gaps = 23/218 (10%)

Query: 100  VGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LL 157
                + I V     +         G + +  +      ++     F++Y          +
Sbjct: 1141 TETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNVLLAGAEFTLYDRTGKTVIRKI 1200

Query: 158  ITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITF 213
             TDK        L  + Y +         ++S  +K    VE G     T +    K   
Sbjct: 1201 TTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKFVG 1260

Query: 214  KLV-----SEMGGEAVADTAWSILTASGDTV-------GESANASPSMVLSEGDYTVIAR 261
            K+V            +    +++L      +         +        L  G Y +   
Sbjct: 1261 KVVLTKSDDLNKNATLQGAIFTLLDKDKKVIPKHKELTTNNNGQIIIDKLKPGTYYLQET 1320

Query: 262  NKERNYSR-----EFSVLTGKSTIVEVLMRQKRMDKNG 294
                +Y        F++   ++T+V +         + 
Sbjct: 1321 KAPEHYQLDSKLIPFTISIDQTTVVNLTATNSLTKGSA 1358


>gi|301056826|ref|YP_003795037.1| collagen adhesion protein [Bacillus anthracis CI]
 gi|300378995|gb|ADK07899.1| collagen adhesion protein [Bacillus cereus biovar anthracis str. CI]
          Length = 3407

 Score =  140 bits (351), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 44/326 (13%), Positives = 89/326 (27%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +N  + K          K  +    +        + T+   G  
Sbjct: 2991 FVETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGTT-LEGAI 3049

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +     +         TV   +
Sbjct: 3050 FKIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQ 3108

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                 V   N    G    +          +   F I  +  H     L T+K    ++ 
Sbjct: 3109 TATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDSNGHDVRTDLTTNKDGKISVS 3168

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         +    V     
Sbjct: 3169 DLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 3228

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 3229 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 3288

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   +++ +++ +  K++D +    
Sbjct: 3289 TIEKAQASPLQITVSNKKIDSSSGGE 3314



 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 46/315 (14%), Positives = 91/315 (28%), Gaps = 33/315 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F       +     T +   + KG+ K        +        +++ +   S   G  +
Sbjct: 2805 FIETKAPTHYKLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSALKGAVF 2864

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 2865 KIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQT 2923

Query: 114  NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
                V   N    G + L  +    G+ +          +  + +  L TDK    ++  
Sbjct: 2924 ATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDMNGNDVRTDLTTDKDGKISVSD 2983

Query: 170  LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 2984 LRPGDYQFVETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGT 3043

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             +    + I+  +G+ V      +         L  GDY  I      +Y        F+
Sbjct: 3044 TLEGAIFKIVDMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFT 3103

Query: 273  VLTGKSTIVEVLMRQ 287
            V   ++    V  + 
Sbjct: 3104 VEKSQTATASVTAKN 3118



 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/310 (14%), Positives = 89/310 (28%), Gaps = 37/310 (11%)

Query: 15   HTTSTLLNNNISKGKGKRVVDA------QRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
            +T         S+G     V A        I        +      G  + I +  +N+ 
Sbjct: 1688 NTKPIEFTIKESQGTSPITVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1747

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
               +      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1748 ARTNLVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNS 1807

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S I      F++      +    L TD+  +  +  L   +YQ  
Sbjct: 1808 LTKGKVKLIKEDDVESSIALAGAVFTLQDASGTEIAKDLKTDEHGALVIPDLAPGDYQFI 1867

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1868 ETAAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1927

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1928 IIVDAHDTEKVVRKGLTTDEHGKISASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGKSQ 1987

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1988 KENITVTATN 1997



 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 98/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2243 FIETKAPKHYVLDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2302

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2303 FNLLDQ-NGKVIKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQ 2361

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKAL--LITDKVRSGTLV 168
            KN   V + N    G    S          +   F+I           L T+     ++ 
Sbjct: 2362 KNIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMNGTVIRKSLTTNSQGKISVP 2421

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    V ++ G
Sbjct: 2422 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDG 2481

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G  V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2482 TALEGAIFKIVDMNGHDVRTGITTDAKGKVSISDLHPGDYQFIETTAPKHYKLDATPIKF 2541

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2542 TIEKSQAEKLQVTAKN 2557



 Score =  120 bits (299), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 50/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   A  E+     T +   I KG    +     V    +T    LT   +   +   G 
Sbjct: 1866 FIETAAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1925

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1926 EFIIVDAHDTEKVVRKGLTTDEHGKISASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGK 1985

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I     ++    L TDK     
Sbjct: 1986 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKIVDMDGNEVRTNLGTDKNGKIH 2045

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2046 VPDLRPGDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDI 2105

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L A G+ V       +        L  G Y  +      +Y      
Sbjct: 2106 DTDTKLANAVFNLLDADGEIVEEGLTTNAEGKIVVENLRPGTYQFVETIAPEHYDLNKTP 2165

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + V  + 
Sbjct: 2166 IEFTIKKSQTETLHVTAKN 2184



 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 43/287 (14%), Positives = 76/287 (26%), Gaps = 29/287 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    +           +  S   ++I      K    + T    G   + +L P
Sbjct: 2554 TAKNSLIEGAVELIKVDDITPDTKLSDAVFNII-DAKGKVVRTNLTTDKDGKISASNLRP 2612

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY                    T+   +     V   N    GG+ L  I    +    
Sbjct: 2613 GDYQFVEMKAPKDYDLNETPIPFTIEKSQSTHVSVTAKNGLTKGGVELTKIDSLDTKETL 2672

Query: 141  DELTFSIYS--NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
            +   F I      + +  L+T+K        L   +YQ        +  ++       +E
Sbjct: 2673 EGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLPPGDYQFIETKAPKHYDLNETPIKFTIE 2732

Query: 196  PGKIIDVTIQ----NRAAKITF-KLVSEMGGEAVADTAWSILTASG-----DTVGESANA 245
              +   V +          +   K+        +    + I+   G     D   +    
Sbjct: 2733 RSQTKHVFVTAINSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHNVRTDLTTDKNGR 2792

Query: 246  SPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                 L  GDY  I      +Y        F+V  G+  I  V    
Sbjct: 2793 LVVDELPPGDYEFIETKAPTHYKLNETPIKFTVKKGQEKIASVTATN 2839



 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/298 (13%), Positives = 87/298 (29%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++ D+   +      T  
Sbjct: 2075 TIERSQTKEINVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLTTN 2133

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +       + T+   +     V   NA   G    
Sbjct: 2134 AEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIKKSQTETLHVTAKNALTKGAVEL 2193

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S          +   F+I           L+T+      +  L   +YQ        + +
Sbjct: 2194 SKVDDIDGTKLEGAVFNIVDMNGTVIHKNLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2253

Query: 188  VST---VVKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2254 LDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVI 2313

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2314 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKNIATVTMKN 2371



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/287 (11%), Positives = 78/287 (27%), Gaps = 34/287 (11%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
              +       +N     SG  + ++   + K      T    G     +L    YL+  +
Sbjct: 1146 GNLEIIKVDNDNKKVPLSGAEFTLY-DRTGKTVIRKITTDKDGIAKFNNLKRDKYLLKET 1204

Query: 97   FGHVGVVKK--------ITVSSKEKNQKQVFILN-AGGIRLYSIYKPGSPIVDDELTFSI 147
                G V          + + S+E    ++      G + L         +      F++
Sbjct: 1205 KAPEGYVISWDLKQGKIVELGSQETTTYKLANKKFVGKVVLTKSDDLNKNVTLQGAVFTL 1264

Query: 148  YSNPN----HKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKII 200
                         L T+     T+  L    Y +       +  + +      ++  +  
Sbjct: 1265 LDKDKKIILEHEKLTTNDQGQITVDNLKPGTYYLQETTAPEHYKLDSTPIQFTIKEDQTT 1324

Query: 201  ----DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV-------GESANASPSM 249
                  T            V +  G+ +A   +S+     + +               + 
Sbjct: 1325 VINRTATNSLIPGSAILTKVDKD-GKTLAGAEFSVRDRHNNVIRGYEKLTTNDQGQIEAT 1383

Query: 250  VLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
             L  GDY  +     ++Y  +     F+++  +   V V      + 
Sbjct: 1384 NLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIK 1430



 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 45/320 (14%), Positives = 98/320 (30%), Gaps = 37/320 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++     T +   I K + K V                 T++  ++  +G  +
Sbjct: 1392 FVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDSTALAGAVF 1451

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    +      G     DL PG Y    +             + T+   +
Sbjct: 1452 KIVDANDEKKVIRENVKTDADGKVTVKDLEPGTYKFIETEAPKDYVLNANPIEFTIDKSQ 1511

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1512 QSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIVDVNNNDVRTDLTTDADGKTKA 1571

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1572 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1631

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1632 GTALEGAVFKIVDANDEKKVIRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKP 1691

Query: 270  -EFSVLTGK-STIVEVLMRQ 287
             EF++   + ++ + V  + 
Sbjct: 1692 IEFTIKESQGTSPITVTAKN 1711



 Score =  106 bits (263), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 39/281 (13%), Positives = 75/281 (26%), Gaps = 30/281 (10%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNK-KNTLSTTKKIIGGKVSFDLFPGDYLISA 95
             ++        N      G  + + D            T    G     +L PG Y +  
Sbjct: 1241 GKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIILEHEKLTTNDQGQITVDNLKPGTYYLQE 1300

Query: 96   SFGH-----VGVVKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSI 147
            +             + T+   +         N+   G   L  + K G  +   E +   
Sbjct: 1301 TTAPEHYKLDSTPIQFTIKEDQTTVINRTATNSLIPGSAILTKVDKDGKTLAGAEFSVRD 1360

Query: 148  YSNP--NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKII 200
              N        L T+         L   +YQ        +       +   +     K +
Sbjct: 1361 RHNNVIRGYEKLTTNDQGQIEATNLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKKAV 1420

Query: 201  DVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMVL 251
             VT  N      +T     ++   A+A   + I+ A+        +   ++        L
Sbjct: 1421 TVTATNHLIKGGVTLTKTDDIDSTALAGAVFKIVDANDEKKVIRENVKTDADGKVTVKDL 1480

Query: 252  SEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
              G Y  I     ++Y       EF++   + +   V    
Sbjct: 1481 EPGTYKFIETEAPKDYVLNANPIEFTIDKSQQSFATVTATN 1521


>gi|229176034|ref|ZP_04303528.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus MM3]
 gi|228607378|gb|EEK64706.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus MM3]
          Length = 2805

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 46/326 (14%), Positives = 92/326 (28%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGK-------RVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++       +   I + + K         +    +           +   G  
Sbjct: 2388 FIETKAPKHYDLNEEPIKFTIERSQTKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAV 2447

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +           T    G  V  +L PGDY    +     +       K TV   +
Sbjct: 2448 FKIVNKD-GHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPNHYDLNETPIKFTVKKGQ 2506

Query: 113  KNQKQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
            +    V   N+   G    S        V  +  F I     H     L TDK    ++ 
Sbjct: 2507 EKIASVTATNSLMKGAVELSKVDDVDGSVLKDAVFKIVDMNGHNVRSDLTTDKDGKISVS 2566

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         +    +     
Sbjct: 2567 DLRPGDYQFVETKAPIGYDLSAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKIDIDHH 2626

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +A   ++IL   G  V      +         L  G+Y ++     + Y  +     F
Sbjct: 2627 GTLAGALFNILDHDGKVVREGLQTDGHGKLIVNDLKPGNYQLVETKAPKGYQLDASPINF 2686

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++  ++V +  K++D +   +
Sbjct: 2687 TIEKAQAAPLQVTVSNKKIDSSSGGD 2712



 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 42/310 (13%), Positives = 82/310 (26%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
                 +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1365 KNTNPIKFTITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1424

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1425 VRTELVTNSKGILVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1484

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S I      F +           L TD      +  L   +YQ  
Sbjct: 1485 LTKGKVKLIKEDDVDSKIALAGAVFKLQDATGTDIMKDLKTDDYGVLVIPDLAPGDYQFI 1544

Query: 179  SHYGKYNAIVSTV---VKVEPGKI------IDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1545 ETEAPEHYKLDQTPIKFTIKKGSTEDLPIPVTVKNSLLTGGVTLTKVDDVDGITLEGAEF 1604

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y        F++   +
Sbjct: 1605 IIVDAHDTKKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYDLSKNPIPFTIGKSQ 1664

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1665 QENITVTATN 1674



 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/316 (13%), Positives = 94/316 (29%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +N  I KG+ K +       +    I        N  +  +   
Sbjct: 1920 FIETEAPKHYVLDETPINFTIEKGQKKTISLTAKNSLKQGSIELIKVDDLNDQTKLADAV 1979

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  +  +L PG Y    +     +        +TV   +
Sbjct: 1980 FNLLDQ-NGKVLKTDLKTNSEGKIIVENLRPGTYQFVETTAPKHYDLDKKPIVVTVKKSQ 2038

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
            K+   V + N    G    +          +   F+I           L T+     ++ 
Sbjct: 2039 KDIATVTMKNSLTKGGVELTKVDDVDGTTLEGAVFNIVDMNGTVIRKNLTTNSQGKISVS 2098

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    V ++ G
Sbjct: 2099 NLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDG 2158

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+    + V                L  GDY  I      +Y  +     F
Sbjct: 2159 TALEGAVFKIVDDKNNDVRTDLTTVKDGKISVPDLRPGDYQFIEIKAPEHYKLDSTPLKF 2218

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V    
Sbjct: 2219 TIKKSQAEKLQVTATN 2234



 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/317 (15%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I KG+ + +    + +        +++ +   +   G  +
Sbjct: 2107 FIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDGTALEGAVF 2166

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I D  +N       T    G     DL PGDY                  K T+   + 
Sbjct: 2167 KIVDDKNN-DVRTDLTTVKDGKISVPDLRPGDYQFIEIKAPEHYKLDSTPLKFTIKKSQA 2225

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    +  
Sbjct: 2226 EKLQVTATNSLIEGTVELIKVDDINPDTKLSDAVFNIIDAKGKVVRTNLTTDKDGKVSAS 2285

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        N  ++       +E  +   V++          +    V     
Sbjct: 2286 NLRPGDYQFVETKAPKNYDLNKTPIPFTIEKSQPAHVSVTAKNGLTKGGVELTKVDSLDA 2345

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2346 KETLEGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEEPIK 2405

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F++   ++  V V    
Sbjct: 2406 FTIERSQTKHVFVTATN 2422



 Score =  118 bits (295), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 46/319 (14%), Positives = 94/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +       G 
Sbjct: 1543 FIETEAPEHYKLDQTPIKFTIKKGSTEDLPIPVTVKNSLLTGGVTLTKVDDVDGITLEGA 1602

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA-----SFGHVGVVKKITVSS 110
             + I D+  + K      T    G   + DL PGDY          +         T+  
Sbjct: 1603 EFIIVDAHDTKKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYDLSKNPIPFTIGK 1662

Query: 111  KE----KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             +           +   G I         + + D             +  L+T+     +
Sbjct: 1663 SQQENITVTATNSLTKGGVILTKIDDIDRTMLKDAVFKIVDMKGNEVRTNLVTNDNGEIS 1722

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +   +T+      +   +    + + 
Sbjct: 1723 VSNLRPGDYQFIETAAPEHYMLDETPIPFTIERSQTEKITVTGKNTLKKGSVELTKIDDI 1782

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNY-----S 268
                 +A+  +++L A G+ V       +        L  G Y  I      +Y     +
Sbjct: 1783 DTDTKLANAVFNLLDADGEIVEEGLKTNAEGKIVVENLRPGTYKFIETAAPEHYDLNKKT 1842

Query: 269  REFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + V  + 
Sbjct: 1843 IEFTIKKSQTETLHVTAKN 1861



 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/291 (16%), Positives = 95/291 (32%), Gaps = 31/291 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN-TLSTTKKIIGGKVSFDLF 87
            K +  +    +        + T+   G  + I D+   KK    +      G  ++  L 
Sbjct: 1290 KAENALKPGDVELTKVDDIDGTT-LEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLR 1348

Query: 88   PGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIV 139
            PGDY          +       K T++  +     V   N    GGI L  +        
Sbjct: 1349 PGDYKFIEVTAPKYYDKNTNPIKFTITESQTTSATVTAKNSLTKGGIELTKVNAADEKET 1408

Query: 140  DDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTV 191
             +   F I +   N + +  L+T+      +  L   NY++               +   
Sbjct: 1409 LEGAVFKIVNRDTNEDVRTELVTNSKGILVVDDLRPGNYKLIETKAPTYYDVNVEPIEFT 1468

Query: 192  VKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAWSILTASGDTV-----GESA 243
            ++    K++ +T +N   K   KL+         A+A   + +  A+G  +      +  
Sbjct: 1469 IEKGQQKLLPLTFKNSLTKGKVKLIKEDDVDSKIALAGAVFKLQDATGTDIMKDLKTDDY 1528

Query: 244  NASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKR 289
                   L+ GDY  I      +Y  +     F++  G +  + + +  K 
Sbjct: 1529 GVLVIPDLAPGDYQFIETEAPEHYKLDQTPIKFTIKKGSTEDLPIPVTVKN 1579



 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/298 (13%), Positives = 86/298 (28%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++ D+   +         
Sbjct: 1752 TIERSQTEKITVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLKTN 1810

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +             + T+   +     V   NA   G    
Sbjct: 1811 AEGKIVVENLRPGTYKFIETAAPEHYDLNKKTIEFTIKKSQTETLHVTAKNALTKGAVEL 1870

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA- 186
            S          +   F+I           L+T+      +  L   +YQ        +  
Sbjct: 1871 SKVDDIDDTTLEGAVFNIVDMNGTVIHKDLVTNGKGKIEINDLRPGDYQFIETEAPKHYV 1930

Query: 187  ----IVSTVVKVEPGKIIDVTIQNRAAKIT---FKLVSEMGGEAVADTAWSILTASGDTV 239
                 ++  ++    K I +T +N   + +    K+        +AD  +++L  +G  +
Sbjct: 1931 LDETPINFTIEKGQKKTISLTAKNSLKQGSIELIKVDDLNDQTKLADAVFNLLDQNGKVL 1990

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   S        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 1991 KTDLKTNSEGKIIVENLRPGTYQFVETTAPKHYDLDKKPIVVTVKKSQKDIATVTMKN 2048



 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/320 (14%), Positives = 96/320 (30%), Gaps = 37/320 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVD-------AQRITCEARLTENSTSIDSGVS 57
            F      E+       +   I K + K V            +        ++ +  +G  
Sbjct: 1069 FVEEKAPEHYDIDKKPIEFTIVKSQKKAVTVTATNHLIKGGVILTKTDDIDNKTTLAGAI 1128

Query: 58   WHIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSK 111
            + I D+   KK    +      G     DL PG Y    +             + T+   
Sbjct: 1129 FKIVDANDEKKVIRENVKTGADGKVTVKDLEPGTYKFIETEAPKDYVLNANPIEFTIDKS 1188

Query: 112  E---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGT 166
            +           L  G + L  + + G     +   F I    N + +  L TD      
Sbjct: 1189 QQSFATVTATNSLKTGEVELLKVDEFGDKKPLEGAVFKIVDLNNNDVRTDLTTDADGKTK 1248

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEM 219
              +L   NY+        + ++       K++  +   + ++     +   +    V ++
Sbjct: 1249 ADKLRPGNYKFIETKAPEHYVLDETPIPFKIDRSQKETLLVKAENALKPGDVELTKVDDI 1308

Query: 220  GGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE-- 270
             G  +    + I+ A+        +    +   + +  L  GDY  I     + Y +   
Sbjct: 1309 DGTTLEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTN 1368

Query: 271  ---FSVLTGKSTIVEVLMRQ 287
               F++   ++T   V  + 
Sbjct: 1369 PIKFTITESQTTSATVTAKN 1388



 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/307 (12%), Positives = 76/307 (24%), Gaps = 31/307 (10%)

Query: 11   AENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNT 70
            A  +  T      + +       +    +               G  + I D  +N    
Sbjct: 1178 ANPIEFTIDKSQQSFATVTATNSLKTGEVELLKVDEFGDKKPLEGAVFKIVDLNNN-DVR 1236

Query: 71   LSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA-- 123
               T    G   +  L PG+Y    +     +          +   +K    V   NA  
Sbjct: 1237 TDLTTDADGKTKADKLRPGNYKFIETKAPEHYVLDETPIPFKIDRSQKETLLVKAENALK 1296

Query: 124  GGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSGTLVRLGTNNYQITS 179
             G    +          +   F I    +     +  + T          L   +Y+   
Sbjct: 1297 PGDVELTKVDDIDGTTLEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIE 1356

Query: 180  HYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVS-EMGGEAVADTAWSI 231
                     +T      +   +    T+          I    V+     E +    + I
Sbjct: 1357 VTAPKYYDKNTNPIKFTITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKI 1416

Query: 232  LTASGDT------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTI 280
            +    +       V  S        L  G+Y +I       Y       EF++  G+  +
Sbjct: 1417 VNRDTNEDVRTELVTNSKGILVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKL 1476

Query: 281  VEVLMRQ 287
            + +  + 
Sbjct: 1477 LPLTFKN 1483



 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/288 (13%), Positives = 77/288 (26%), Gaps = 35/288 (12%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
              +  +     +     SG  + +F   +      + T    G     +L   +YL+  +
Sbjct: 822  GNLHIKKYDEADKEKKLSGAVFTLF-DRTGTNVIRTITTDEKGIAQFNNLKRDEYLLRET 880

Query: 97   FGHVGVVK----------KITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFS 146
                G V           K+     E     +      G  + +     S    +   FS
Sbjct: 881  EAPDGYVISKELRDGIIVKLDTEVNETKTYPLPNKKFVGKVILTKIDRYSKEKLEHAVFS 940

Query: 147  IYSNP----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV-VKVEPGKIID 201
            +             L T+     T+  L    Y +       +  +    ++V+  K   
Sbjct: 941  LLDQNKQVIPEHKELTTNDKGQITVDNLKPGTYYLKETKAPEHYQLDDQLIEVKIAKDQT 1000

Query: 202  VTIQ------NRAAKITFKLVSEMGGEAVADTAWSILTAS-------GDTVGESANASPS 248
              I+                V    GE +A   +S+   +       G           +
Sbjct: 1001 AVIEKEAKNNLITGSAILTKVD-KNGETLAGAVFSVRDRNNKIIPGYGKLTTNDQGQIEA 1059

Query: 249  MVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
              L  GDY  +      +Y  +     F+++  +   V V      + 
Sbjct: 1060 KDLRPGDYQFVEEKAPEHYDIDKKPIEFTIVKSQKKAVTVTATNHLIK 1107



 Score = 98.1 bits (242), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/246 (13%), Positives = 65/246 (26%), Gaps = 30/246 (12%)

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKEKNQKQVFILN---A 123
              T    G     +L PG Y +  +             ++ ++  +    +    N    
Sbjct: 954  ELTTNDKGQITVDNLKPGTYYLKETKAPEHYQLDDQLIEVKIAKDQTAVIEKEAKNNLIT 1013

Query: 124  GGIRLYSIYKPGSPIVDDELTFSIYSNP--NHKALLITDKVRSGTLVRLGTNNYQITSHY 181
            G   L  + K G  +     +    +N        L T+         L   +YQ     
Sbjct: 1014 GSAILTKVDKNGETLAGAVFSVRDRNNKIIPGYGKLTTNDQGQIEAKDLRPGDYQFVEEK 1073

Query: 182  GKYNA-----IVSTVVKVEPGKIIDVTIQNR---AAKITFKLVSEMGGEAVADTAWSILT 233
               +       +   +     K + VT  N       I  K         +A   + I+ 
Sbjct: 1074 APEHYDIDKKPIEFTIVKSQKKAVTVTATNHLIKGGVILTKTDDIDNKTTLAGAIFKIVD 1133

Query: 234  ASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIV 281
            A+        +    +        L  G Y  I     ++Y       EF++   + +  
Sbjct: 1134 ANDEKKVIRENVKTGADGKVTVKDLEPGTYKFIETEAPKDYVLNANPIEFTIDKSQQSFA 1193

Query: 282  EVLMRQ 287
             V    
Sbjct: 1194 TVTATN 1199


>gi|196036530|ref|ZP_03103925.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus W]
 gi|195990863|gb|EDX54836.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus W]
          Length = 3497

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 46/326 (14%), Positives = 92/326 (28%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +N  + K          K  +    +        + T+   G  
Sbjct: 3097 FIETKAPKHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGTT-LEGAI 3155

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I DS +        T    G     DL PGDY    +     +         TV   +
Sbjct: 3156 FKIVDS-NGHDVRTDLTTNKDGKISVSDLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQ 3214

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                 V   N    G    +          +   F I  +  H     L TDK    ++ 
Sbjct: 3215 TATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDSNGHDVRTDLTTDKDGKISVS 3274

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         +    V     
Sbjct: 3275 DLRPEDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 3334

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 3335 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 3394

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   +++ +++ +  K+++ +   +
Sbjct: 3395 TIEKAQASPLQITVSNKKIESSSGGD 3420



 Score =  130 bits (325), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 47/315 (14%), Positives = 89/315 (28%), Gaps = 33/315 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F       +     T +   + KG+ K        +        +++ +   S   G  +
Sbjct: 2818 FIETKAPTHYKLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSALKGAVF 2877

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 2878 KIV-DMNGNDVRTDLTTNKDGKISVSDLRPGDYQFIETKAPKHYDLNQTPINFTVEKSQT 2936

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVR 169
                V   N    G    +          +   F I  +  H     L T+K    ++  
Sbjct: 2937 ATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDSNGHDVRTDLTTNKDGKISVSD 2996

Query: 170  LGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 2997 LRPGDYQFIETKAPTHYDLNQNPINFTVEKSQTATASVTATNSLTKGAVELSKVDDIDGS 3056

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             + D  + I+  +G+ V                L  GDY  I     ++Y        F+
Sbjct: 3057 TLKDAVFKIVDMNGNDVRTDLTTNKDGKISVSDLRPGDYQFIETKAPKHYDLNQTPINFT 3116

Query: 273  VLTGKSTIVEVLMRQ 287
            V   ++    V  + 
Sbjct: 3117 VEKSQTATASVTAKN 3131



 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/310 (14%), Positives = 89/310 (28%), Gaps = 37/310 (11%)

Query: 15   HTTSTLLNNNISKGKGKRVVDA------QRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
            +T         S+G     V A        I        +      G  + I +  +N+ 
Sbjct: 1701 NTKPIEFTIKESQGTSPITVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1760

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
               +      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1761 ARTNLVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNS 1820

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S I      F++      +    L TD+     +  L   +YQ  
Sbjct: 1821 LTKGKVKLIKEDDVESSIALAGAVFTLQDANGTEIAKDLKTDEHGVLVIPDLAPGDYQFI 1880

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + VT       +T   V ++ G  +    +
Sbjct: 1881 ETAAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGTTLEGAEF 1940

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1941 IIVDAHDTEKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYTLGNDPIPFTIGKSQ 2000

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 2001 KENITVTATN 2010



 Score =  125 bits (313), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 42/314 (13%), Positives = 84/314 (26%), Gaps = 35/314 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F       +       +N  + K +           +    +        + +++     
Sbjct: 3004 FIETKAPTHYDLNQNPINFTVEKSQTATASVTATNSLTKGAVELSKVDDIDGSTLKD-AV 3062

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +     +         TV   +
Sbjct: 3063 FKIV-DMNGNDVRTDLTTNKDGKISVSDLRPGDYQFIETKAPKHYDLNQTPINFTVEKSQ 3121

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                 V   N    G    +          +   F I  +  H     L T+K    ++ 
Sbjct: 3122 TATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDSNGHDVRTDLTTNKDGKISVS 3181

Query: 169  RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       VE  +    ++          +    V ++ G
Sbjct: 3182 DLRPGDYQFIETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDG 3241

Query: 222  EAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSR-----EF 271
              +    + I+ ++G     D   +         L   DY  I       Y        F
Sbjct: 3242 TTLEGAIFKIVDSNGHDVRTDLTTDKDGKISVSDLRPEDYQFIETKAPTGYDLNAKPIPF 3301

Query: 272  SVLTGKSTIVEVLM 285
            ++  G+S +  V  
Sbjct: 3302 TITKGQSQVTSVTA 3315



 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 98/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2256 FIETKAPKHYVLDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2315

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2316 FNLLDQ-NGKVIKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQ 2374

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKAL--LITDKVRSGTLV 168
            KN   V + N    G    S          +   F+I           L T+     ++ 
Sbjct: 2375 KNIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMNGTVIRKSLTTNSQGKISVP 2434

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    V ++ G
Sbjct: 2435 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDG 2494

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G  V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2495 TALEGAIFKIVDMNGHDVRTGITTDAKGKVSISDLHPGDYQFIETTAPKHYKLDATPIKF 2554

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2555 TIEKSQAEKLQVTAKN 2570



 Score =  122 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 41/286 (14%), Positives = 85/286 (29%), Gaps = 29/286 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
                 +    +T   ++ +   ++  G  + I D     +   +      G     DL P
Sbjct: 2007 TATNSLKKGAVTLT-KIDDIDRTMLKGAIFKIVDMD-GNEVRTNLVTNKNGKIYVPDLRP 2064

Query: 89   GDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY    +     +         T+   +  +  V   N    G + L  I    +    
Sbjct: 2065 GDYEFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDIDTDTKL 2124

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVK 193
                F++           L T+      +  L    YQ        +       +   +K
Sbjct: 2125 ANAVFNLLDADGEIVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIK 2184

Query: 194  VEPGKIIDVTIQN--RAAKITFKLVSEMGGEAVADTAWSILTASGDT-----VGESANAS 246
                + + VT +N      +    V ++ G  +    ++I+  +G       V  S    
Sbjct: 2185 KSQTETLHVTAKNALTKGAVELSKVDDIDGTKLEGAVFNIVDMNGTVIHKNLVTNSKGKI 2244

Query: 247  PSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
                L  GDY  I     ++Y       +F++  G+   + +  + 
Sbjct: 2245 EIDDLRPGDYQFIETKAPKHYVLDETPIDFTIEKGQKKTISLTAKN 2290



 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 43/287 (14%), Positives = 76/287 (26%), Gaps = 29/287 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    +           +  S   ++I      K    + T    G   + +L P
Sbjct: 2567 TAKNSLIEGAVELIKVDDITPDTKLSDAVFNII-DAKGKVVRTNLTTDKDGKISASNLRP 2625

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY                    T+   +     V   N    GG+ L  I    +    
Sbjct: 2626 GDYQFVEMKAPKDYDLNETPIPFTIEKSQSTHVSVTAKNGLTKGGVELTKIDSLDTKETL 2685

Query: 141  DELTFSIYS--NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
            +   F I      + +  L+T+K        L   +YQ        +  ++       +E
Sbjct: 2686 EGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNETPIKFTIE 2745

Query: 196  PGKIIDVTIQ----NRAAKITF-KLVSEMGGEAVADTAWSILTASG-----DTVGESANA 245
              +   V +          +   K+        +    + I+   G     D   +    
Sbjct: 2746 RSQTKHVFVTAINSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHDIRTDLTTDKNGR 2805

Query: 246  SPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                 L  GDY  I      +Y        F+V  G+  I  V    
Sbjct: 2806 LVVDELPPGDYEFIETKAPTHYKLNETPIKFTVKKGQEKIASVTATN 2852



 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 86/298 (28%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++ D+   +         
Sbjct: 2088 TIERSQTKEINVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLKTN 2146

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +       + T+   +     V   NA   G    
Sbjct: 2147 AEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIKKSQTETLHVTAKNALTKGAVEL 2206

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S          +   F+I           L+T+      +  L   +YQ        + +
Sbjct: 2207 SKVDDIDGTKLEGAVFNIVDMNGTVIHKNLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2266

Query: 188  VST---VVKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2267 LDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVI 2326

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2327 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKNIATVTMKN 2384



 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/287 (11%), Positives = 79/287 (27%), Gaps = 34/287 (11%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
              +       +N     SG  + ++   + K      T    G     +L    YL+  +
Sbjct: 1159 GNLEIIKVDNDNKKVPLSGAEFTLY-DRTGKTVIRKITTDKDGIAKFNNLKRDKYLLKET 1217

Query: 97   FGHVGVVKK--------ITVSSKEKNQKQVFILN-AGGIRLYSIYKPGSPIVDDELTFSI 147
                G V          + + S+E    ++      G + L         +      F++
Sbjct: 1218 KAPEGYVISWDLKQGKIVELGSQETTTYKLANKKFVGKVVLTKSDDLNKNVTLQGAVFTL 1277

Query: 148  YSNP----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKII 200
                    +    L T+     T+  L    Y +       +  + +      ++  +  
Sbjct: 1278 LDKDKKIISEHEKLTTNDQGQITVDNLKPGTYYLQETTAPEHYKLDSTPIQFTIKEDQTT 1337

Query: 201  ----DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV-------GESANASPSM 249
                  T            V +  G+ +A   +S+     + +               + 
Sbjct: 1338 VINRTATNSLIPGSAILTKVDKD-GKTLAGAEFSVRDRHNNVIRGYEKLSTNDQGQIEAK 1396

Query: 250  VLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
             L  GDY  +     ++Y  +     F+++  +   V V      + 
Sbjct: 1397 DLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIK 1443



 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/306 (12%), Positives = 84/306 (27%), Gaps = 31/306 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
            E +  T       +     K  +   ++         S+   +G  + +    +  +   
Sbjct: 1799 EPIEFTIEKGQQTLLPLTFKNSLTKGKVKLIKEDDVESSIALAGAVFTL-QDANGTEIAK 1857

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEKNQKQVFILNA--- 123
                   G  V  DL PGDY    +             K T+    K+   V +      
Sbjct: 1858 DLKTDEHGVLVIPDLAPGDYQFIETAAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVTNSL 1917

Query: 124  -GGIRLYSIYKPGSPIVDDELTFSIYSNPN----HKALLITDKVRSGTLVRLGTNNYQIT 178
              G    +          +   F I    +     +  L TD+    +   L   +YQ  
Sbjct: 1918 LTGGVTLTKVDDVDGTTLEGAEFIIVDAHDTEKVVRKGLTTDEHGKVSASDLRPGDYQFI 1977

Query: 179  SHYGKYNAIV---STVVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +        +   +  ++T+      +   +T   + ++    +    + I
Sbjct: 1978 EVKAPKDYTLGNDPIPFTIGKSQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAIFKI 2037

Query: 232  LTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIV 281
            +   G+ V                L  GDY  I      +Y        F++   ++  +
Sbjct: 2038 VDMDGNEVRTNLVTNKNGKIYVPDLRPGDYEFIETKAPEHYVLDETPIPFTIERSQTKEI 2097

Query: 282  EVLMRQ 287
             V  + 
Sbjct: 2098 NVTGKN 2103



 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 46/320 (14%), Positives = 98/320 (30%), Gaps = 37/320 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++     T +   I K + K V                 T++   +  +G  +
Sbjct: 1405 FVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAVF 1464

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    + T    G     DL PG Y    +             + T+   +
Sbjct: 1465 KIVDANDEKKVIRKNVTTGADGKVTVKDLEPGTYKFIETEAPKDYVLNTNPIEFTIDKSQ 1524

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1525 QSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIVDVNNNDVRTDLTTDADGKTKA 1584

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1585 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1644

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1645 GTALEGALFKIVDANDEKKVIRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKP 1704

Query: 270  -EFSVLTGK-STIVEVLMRQ 287
             EF++   + ++ + V  + 
Sbjct: 1705 IEFTIKESQGTSPITVTAKN 1724



 Score = 79.2 bits (193), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 38/264 (14%), Positives = 72/264 (27%), Gaps = 27/264 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +N  + K          K  +    +        + T+   G  
Sbjct: 3190 FIETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGTT-LEGAI 3248

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I DS +        T    G     DL P DY    +    G          T++  +
Sbjct: 3249 FKIVDS-NGHDVRTDLTTDKDGKISVSDLRPEDYQFIETKAPTGYDLNAKPIPFTITKGQ 3307

Query: 113  KNQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V  LN    G + L  +       +               +  L TD      + 
Sbjct: 3308 SQVTSVTALNSLTTGSMELTKVDIDHNGTLEGAIFNILDQDGKVVREGLKTDGHGKLIVN 3367

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITF----KLVSEM 219
             L   NYQ+               +S  ++      + +T+ N+  + +     K ++  
Sbjct: 3368 DLKPGNYQLVETKAPEGYQLDASPISFTIEKAQASPLQITVSNKKIESSSGGDNKPITPP 3427

Query: 220  GGEAVADTAWSILTASGDTVGESA 243
              E       S    +G+   ++ 
Sbjct: 3428 NKEEKPGKETSEELENGNPKTQTN 3451


>gi|218900484|ref|YP_002448895.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus G9842]
 gi|218541655|gb|ACK94049.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus G9842]
          Length = 3190

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 47/325 (14%), Positives = 99/325 (30%), Gaps = 33/325 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+     T +   + KG+ K        +         ++ +   +   G  +
Sbjct: 2786 FIETKAPEHYDLNKTPIKFTVKKGQEKIASVTATNSLTKGAVELTKVDDIDGTTLEGAIF 2845

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I D    K      T    G     DL PGDY    +     +       K T+   + 
Sbjct: 2846 KIIDMD-GKDVRSDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPIKFTIEKSQT 2904

Query: 114  NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
             +  V   N    G + L  +    G+ + +        +  +  + L TDK    ++  
Sbjct: 2905 AKASVTATNSLTKGAVELTKVDDIDGTTLAEAIFKIVDMNGKDVHSDLTTDKDGKISVSD 2964

Query: 170  LGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGGE 222
            L   +YQ                +   +     +I  VT         I    V      
Sbjct: 2965 LRPGDYQFIETKAPTGYDLNIKPIPFTITKGQSQITSVTALNSLTTGSIELTKVDIDHHG 3024

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FS 272
             +    ++IL   G  +      +         L  G+Y ++     + Y  +     F+
Sbjct: 3025 TLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETQAPKGYQLDASPINFT 3084

Query: 273  VLTGKSTIVEVLMRQKRMDKNGQHN 297
            +   ++T +++ +  K+++ +   +
Sbjct: 3085 IDKAQATPLQITVSNKKIESSSGGD 3109



 Score =  129 bits (323), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 54/320 (16%), Positives = 104/320 (32%), Gaps = 37/320 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVV-------DAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I KG+   +V           +    +L +   +   G  
Sbjct: 1566 FIETKAPEHYELRSTPIEFTIEKGQKTPIVITAENGLLPGDVELT-KLDDTDGTALIGAV 1624

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +   N+           G  ++  L PG+Y          +       + T+   +
Sbjct: 1625 FKIVN-NKNEDVRTELVTNQEGKIIATGLRPGNYKFIEMKAPEHYALNKTPIEFTIKESQ 1683

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
                 V   N    GGI L  +    +    +   F I ++        L TDK     +
Sbjct: 1684 ATAINVTATNSLTKGGIELTKVDSVNAKETLEGAVFKIVNDKGEDVRTELTTDKDGKLVV 1743

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV-----VKVEPGKIIDVTIQNRAAKITFKLV---SEM 219
              L   NY++          V+       ++    K+I +T +N   K   KL+      
Sbjct: 1744 QDLRPGNYKLIETKAPTYYDVNEEPIEFIIEKSQQKLIPITFKNSLTKGKVKLIKEDDVE 1803

Query: 220  GGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE---- 270
              +A+A   +++  A+G  +      ++        L+ GDY  I      +Y  +    
Sbjct: 1804 SAKALAGAVFTLQDATGKEIMKDLITDAHGVLVIPDLAPGDYQFIEVKAPEHYKLDQTPI 1863

Query: 271  -FSVLTGKSTIVEVLMRQKR 289
             F++  G    + + +  K 
Sbjct: 1864 KFTIKKGSKEDLPIPVTVKN 1883



 Score =  118 bits (295), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 48/318 (15%), Positives = 88/318 (27%), Gaps = 36/318 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I K + +++       +    +        N  +  S   
Sbjct: 2504 FVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTTTNSLTEGAVELIKVDDINPDTKLSDAV 2563

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            ++I      K      T    G   + +L PGDY          +         T+   +
Sbjct: 2564 FNII-DAKGKIVRTDLTTDKDGKITATNLRPGDYQFIEMKAPKHYDLNKTPISFTIEKSQ 2622

Query: 113  KNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                 V   N    GG+ L  +       + +   F I      + +  L+T+K      
Sbjct: 2623 LTHASVTAKNGLTKGGVELTKVDSIDKKEMLEGAVFKITDLNGNDIRTNLVTNKDGKIIA 2682

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITF-KLVSEM 219
              L   +YQ        +  ++       +E  +   V +          +   K+    
Sbjct: 2683 KDLQPGDYQFIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTKGSVELIKVDDAK 2742

Query: 220  GGEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE---- 270
                +    + I+   G     D   +         L  GDY  I      +Y       
Sbjct: 2743 QNTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPI 2802

Query: 271  -FSVLTGKSTIVEVLMRQ 287
             F+V  G+  I  V    
Sbjct: 2803 KFTVKKGQEKIASVTATN 2820



 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/319 (15%), Positives = 94/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1847 FIEVKAPEHYKLDQTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKIDDVDGTTLEGA 1906

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1907 EFIIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFVEVKAPKDYTLSKEPIPFTIEK 1966

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1967 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2026

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2027 VSDLRPGDYQFIETKAPEHYVLEETQIPFTIERSQTKEINVTGKNALKKGSVELTKIDDI 2086

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2087 DINTKLANAVFNLLDADGELVEEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYVLDKKP 2146

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2147 IVFTIKKSQTEALHVTATN 2165



 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 89/319 (27%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K + + +               +++ +   ++   
Sbjct: 2128 TYQFVETIAPEHYVLDKKPIVFTIKKSQTEALHVTATNALTKGAVKLSKVDDVDATVLKD 2187

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSS 110
              + I + ++             G     DL PGDY    +             K T+  
Sbjct: 2188 AVFKIVN-MNGDVVHKDLVTNEQGLIEINDLRPGDYQFIETKAPKDYVLDETPIKFTIEK 2246

Query: 111  KEK---NQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNH--KALLITDKVRSG 165
             +K   +      L  G I L  +          +  F++        K  L T+     
Sbjct: 2247 GQKKSISLTATNSLKQGSIELLKVDDLNDQTKLADAVFNLLDQNGKVLKTDLKTNSEGKI 2306

Query: 166  TLVRLGTNNYQITSHYGKYNAIVS-----TVVKVEPGKIIDVTIQN--RAAKITFKLVSE 218
             +  L    YQ        +  +        ++     I  VT++N      +    V +
Sbjct: 2307 VVENLRPGTYQFVETTAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDD 2366

Query: 219  MGGEAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            + G  +    + I   +G       V           L  GDY  I     ++Y+     
Sbjct: 2367 VDGTTLEGAVFKIADMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYNLNKEP 2426

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   ++  V V    
Sbjct: 2427 IPFTITQSQAEPVSVTATN 2445



 Score =  115 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 46/319 (14%), Positives = 95/319 (29%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K +        + +        +++ +   +   G
Sbjct: 2315 TYQFVETTAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDDVDGTTLEG 2374

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSS 110
              + I   ++             G     DL PGDY    +               T++ 
Sbjct: 2375 AVFKI-ADMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYNLNKEPIPFTITQ 2433

Query: 111  KEKNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             +     V   N    G + L  +    G+ + D     +  +  + +  L TD     +
Sbjct: 2434 SQAEPVSVTATNSLTKGTVELSKVDDVDGTALKDAIFKITDMNGNDIRTELTTDVHGKIS 2493

Query: 167  LVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG- 220
            +  L   +YQ        +       +   +K    + + VT  N   +   +L+     
Sbjct: 2494 VSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTTTNSLTEGAVELIKVDDI 2553

Query: 221  --GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 ++D  ++I+ A G  V      +      +  L  GDY  I     ++Y      
Sbjct: 2554 NPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITATNLRPGDYQFIEMKAPKHYDLNKTP 2613

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   + T   V  + 
Sbjct: 2614 ISFTIEKSQLTHASVTAKN 2632



 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/312 (10%), Positives = 81/312 (25%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N   + +G  + ++   + K    
Sbjct: 1108 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNILLAGAEFTLY-DRTGKTVIR 1166

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1167 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1226

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L                F++             L T+      + +L    Y + 
Sbjct: 1227 VGKVVLTKSDDLNKNATLQGAIFTLLDKDKKVIPEHKELTTNNNGQIIIDKLKPGTYYLQ 1286

Query: 179  SHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  + +      +   +        T            V     + +A   +++
Sbjct: 1287 ETKAPEHYQLDSKLIPFTISIDQTTVVNLTATNSLTKGSALLTKVDNY-NKTLAGAEFTV 1345

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
               +G  +               +  L  G Y  +      +Y  +     F +   ++T
Sbjct: 1346 QDRNGKNIPGYEKLTTNEHGQIEAKDLRPGKYQFVETKAPEHYELDKTPILFEIEKSQTT 1405

Query: 280  IVEVLMRQKRMD 291
            +  V  +   + 
Sbjct: 1406 VASVTAKNALIK 1417



 Score =  112 bits (280), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 47/314 (14%), Positives = 87/314 (27%), Gaps = 33/314 (10%)

Query: 7    SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA-----RLTENSTSIDSGVSWHIF 61
                 E+    S L+   IS  +   V      +           +N     +G  + + 
Sbjct: 1287 ETKAPEHYQLDSKLIPFTISIDQTTVVNLTATNSLTKGSALLTKVDNYNKTLAGAEFTVQ 1346

Query: 62   DSIS-NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK-----ITVSSKEKNQ 115
            D    N       T    G   + DL PG Y    +                +   +   
Sbjct: 1347 DRNGKNIPGYEKLTTNEHGQIEAKDLRPGKYQFVETKAPEHYELDKTPILFEIEKSQTTV 1406

Query: 116  KQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLG 171
              V   NA   G    +          +   F I ++ N      L T+K  + T+  L 
Sbjct: 1407 ASVTAKNALIKGGITLTKVDDTDGTTLEGAVFKIVNDKNEDVCTNLKTEKDGTLTVKDLD 1466

Query: 172  TNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE-MGGEA 223
              +YQ           ++       +E  +   ++I          +    V E      
Sbjct: 1467 PGDYQFIETTPPKYYDLNKEPIPFTIEKSQTSIISITAKNSLTTGAVELLKVDEFDKKTP 1526

Query: 224  VADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFSV 273
            +A   + I+    + V      ++     +  L  G Y  I      +Y       EF++
Sbjct: 1527 LAGAMFKIVNDKNEDVRTELTTDTNGTVKASDLRPGKYKFIETKAPEHYELRSTPIEFTI 1586

Query: 274  LTGKSTIVEVLMRQ 287
              G+ T + +    
Sbjct: 1587 EKGQKTPIVITAEN 1600



 Score = 78.0 bits (190), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/218 (12%), Positives = 59/218 (27%), Gaps = 23/218 (10%)

Query: 100  VGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LL 157
                + I V     +         G + +  +      I+     F++Y          +
Sbjct: 1109 TETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNILLAGAEFTLYDRTGKTVIRKI 1168

Query: 158  ITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITF 213
             TDK        L  + Y +         ++S  +K    VE G     T +    K   
Sbjct: 1169 TTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKFVG 1228

Query: 214  KLV-----SEMGGEAVADTAWSILTASGDTV-------GESANASPSMVLSEGDYTVIAR 261
            K+V            +    +++L      +         +        L  G Y +   
Sbjct: 1229 KVVLTKSDDLNKNATLQGAIFTLLDKDKKVIPEHKELTTNNNGQIIIDKLKPGTYYLQET 1288

Query: 262  NKERNYSR-----EFSVLTGKSTIVEVLMRQKRMDKNG 294
                +Y        F++   ++T+V +         + 
Sbjct: 1289 KAPEHYQLDSKLIPFTISIDQTTVVNLTATNSLTKGSA 1326


>gi|228931398|ref|ZP_04094323.1| hypothetical protein bthur0010_60380 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228828204|gb|EEM73914.1| hypothetical protein bthur0010_60380 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 1077

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 41/279 (14%), Positives = 90/279 (32%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    S  I +G  + +F++ +
Sbjct: 232 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGESGEILAGAVFEVFNANN 291

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 292 ESVGK--ITTGADGTAELNNLPIGTYTVKEIKAPTGYVLGDKPQTIEVKTGETGAVQIVN 349

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
             A G            ++ + + F++++    +    +T++     +  L    Y    
Sbjct: 350 NKARGNIEIKKLSDSGKVLPN-VEFTVFTEDGKEVKKAVTNENGIAKIEGLTFGKYYFLE 408

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 409 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDTEDISKKLEGAVFELK 468

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 469 DASGKVIGEYKTDKNGEINVKDLAYGKYSFVEKTSPNGY 507



 Score = 71.9 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/296 (11%), Positives = 83/296 (28%), Gaps = 26/296 (8%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDS----GVSWHIFDSISNKKNTLST 73
           + L     +   G   V A+      ++   +  +      G  + I    + K    + 
Sbjct: 160 TNLYTVQTNAKSGSYKVVAKNAPNGVKIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNL 219

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYK 133
           +      KV    + G   +            +  + ++ +        A G        
Sbjct: 220 SVAANLTKVQAIAYRGTDTVQ------NATVLLERNEEKLSSDLAVNWEAAGSLKIKKVG 273

Query: 134 PGSPIVDDELTFSIYSNPNHKALLITDK-VRSGTLVRLGTNNYQITSHYGKYNAIV---S 189
               I      F +++  N     IT     +  L  L    Y +         ++    
Sbjct: 274 ESGEI-LAGAVFEVFNANNESVGKITTGADGTAELNNLPIGTYTVKEIKAPTGYVLGDKP 332

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASGDT----VGESAN 244
             ++V+ G+   V I N  A+   ++      G+ + +  +++ T  G      V     
Sbjct: 333 QTIEVKTGETGAVQIVNNKARGNIEIKKLSDSGKVLPNVEFTVFTEDGKEVKKAVTNENG 392

Query: 245 ASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            +    L+ G Y  +       Y        F +    +  +   +    +  + +
Sbjct: 393 IAKIEGLTFGKYYFLETKTPNGYIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 447



 Score = 62.6 bits (150), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 44/285 (15%), Positives = 84/285 (29%), Gaps = 30/285 (10%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +            TE+ +    G  + + D+    
Sbjct: 424 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDTEDISKKLEGAVFELKDASGKV 474

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISA---SFGHVGVVKKITVSSKEKNQKQ----VFI 120
                      G     DL  G Y         G+V V ++I    KE  +      V  
Sbjct: 475 IGEYK--TDKNGEINVKDLAYGKYSFVEKTSPNGYVLVKEQIVFEIKEHGKIIELLAVNH 532

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 533 LIKGDLEITKVDVADGNNKLPNAQFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 592

Query: 180 HYGKYNAIVSTV---VKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASG 236
                  I++      ++     I   I       + K  +        D    + T+  
Sbjct: 593 TIAPNGYILNEETFSFEITENSQIIKHIVKDEKIPSIKTTASDKK----DGTKEMHTSKS 648

Query: 237 DTVGESANASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
            T+ +         L  G +YT+  +  ++  ++   V   + T 
Sbjct: 649 VTIQD---KVEYKDLQVGKEYTLKGKLMDKKTNKPLVVNGKEVTA 690


>gi|196048077|ref|ZP_03115255.1| collagen adhesion protein [Bacillus cereus 03BB108]
 gi|196021333|gb|EDX60062.1| collagen adhesion protein [Bacillus cereus 03BB108]
          Length = 910

 Score =  139 bits (350), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 40/296 (13%), Positives = 91/296 (30%), Gaps = 24/296 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 253 AYRGTDTVQDATVLLERNEEKLSSDLAVNWEAAGSMKIKKVGENGEVLAGAVFEVFNANN 312

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 313 ESVGK--ITTGADGMAELNNLPIGTYTVKEIKAPTGYVSGDKPQTIEVKTGETGTVQIVN 370

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR-LGTNNYQITS 179
               G            ++   + F++++    +   +  K      V  L    Y    
Sbjct: 371 NKVKGNIEIKKLSDSGKVLPK-VEFTVFTEDGKEVKKVVTKENGIANVDGLTYGKYYFLE 429

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVS---EMGGEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+    E   + +    + + 
Sbjct: 430 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVKNTEVKGSVKLLKVDNEDTSKKLEGAVFELK 489

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKSTIV 281
            ASG  +     +         L+ G Y+ + +     Y   +   +    +   +
Sbjct: 490 DASGKVIGEYKTDKNGEVNVKDLAYGKYSFVEKASPNGYVLVTEPITFEIKEHGKI 545



 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/268 (12%), Positives = 68/268 (25%), Gaps = 24/268 (8%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +        +  +      + I++    +           G      L  G Y    
Sbjct: 556 KGNLEITKVDVADGNNKLPNAEFTIYNEAGKEVIKGK--TDDKGIAKFEKLPFGKYTYKE 613

Query: 96  SFGHVGVVK-----KITVSSKEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIY 148
           +    G V         ++      K +       G + +  +             F+IY
Sbjct: 614 TVAPNGYVISEETFPFEITKDGDIIKHIVENKKITGSLEITKVDVADGNNKLPGAEFTIY 673

Query: 149 SNPNHKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVE-PGKIIDVT 203
           +    + +   TDK       +L    Y           +V+      ++   G I+   
Sbjct: 674 NEAGKEVVKGKTDKNGIAKFEKLPFGKYTYKETLAPNGYVVNEETFPFEITKDGDILKHI 733

Query: 204 IQNRAAKITF---KLVSEMGGEAVADTAWSILTASGDTV----GESANASPSMVLSEGDY 256
           ++N+    T    K+    G   +    ++I   +G  V     +    +    L  G Y
Sbjct: 734 VENKKITGTLEITKVDVADGNNKLPGAEFTIYNEAGKEVVKGKTDENGIAKFEKLPFGKY 793

Query: 257 TVIARNKERNY---SREFSVLTGKSTIV 281
                     Y      F     K   +
Sbjct: 794 KYKETIAPNGYLLNEETFEFEIKKDGDI 821



 Score = 99.2 bits (245), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 48/296 (16%), Positives = 86/296 (29%), Gaps = 33/296 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+++    G  + + D+    
Sbjct: 445 FEIKEHNKTLTFTVKNTEVKGSVKLLK---------VDNEDTSKKLEGAVFELKDASGKV 495

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISA---SFGHVGVVKKITVSSKEKNQKQ----VFI 120
                      G     DL  G Y         G+V V + IT   KE  +      V  
Sbjct: 496 IGEYK--TDKNGEVNVKDLAYGKYSFVEKASPNGYVLVTEPITFEIKEHGKIIELLAVNH 553

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 554 LIKGNLEITKVDVADGNNKLPNAEFTIYNEAGKEVIKGKTDDKGIAKFEKLPFGKYTYKE 613

Query: 180 HYGKYNAIVST---VVKVE-PGKIIDVTIQNRAAKITF---KLVSEMGGEAVADTAWSIL 232
                  ++S      ++   G II   ++N+    +    K+    G   +    ++I 
Sbjct: 614 TVAPNGYVISEETFPFEITKDGDIIKHIVENKKITGSLEITKVDVADGNNKLPGAEFTIY 673

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKSTIV 281
             +G  V     +    +    L  G YT         Y      F     K   +
Sbjct: 674 NEAGKEVVKGKTDKNGIAKFEKLPFGKYTYKETLAPNGYVVNEETFPFEITKDGDI 729



 Score = 75.7 bits (184), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 25/210 (11%), Positives = 58/210 (27%), Gaps = 11/210 (5%)

Query: 2   TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
           T++ + Y  +E         + +I K   +       +        +  +   G  + I+
Sbjct: 614 TVAPNGYVISEETFPFEITKDGDIIKHIVENKKITGSLEITKVDVADGNNKLPGAEFTIY 673

Query: 62  DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK-----KITVSSKEKNQK 116
           +    +           G      L  G Y    +    G V         ++      K
Sbjct: 674 NEAGKEVVKGK--TDKNGIAKFEKLPFGKYTYKETLAPNGYVVNEETFPFEITKDGDILK 731

Query: 117 QVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTN 173
            +       G + +  +             F+IY+    + +   TD+       +L   
Sbjct: 732 HIVENKKITGTLEITKVDVADGNNKLPGAEFTIYNEAGKEVVKGKTDENGIAKFEKLPFG 791

Query: 174 NYQITSHYGKYNAIVS-TVVKVEPGKIIDV 202
            Y+          +++    + E  K  D+
Sbjct: 792 KYKYKETIAPNGYLLNEETFEFEIKKDGDI 821



 Score = 72.3 bits (175), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 37/292 (12%), Positives = 85/292 (29%), Gaps = 26/292 (8%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDS----GVSWHIFDSISNKKNTLST 73
           + L     +   G   V A+      ++   +  +      G  + I    + K    + 
Sbjct: 181 TNLYTVQTNAKSGSYKVVAKNAPNGVKIVSENGEVKEQLSVGEKFRIQIPKNTKTGEFNL 240

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYK 133
           +      KV    + G   +  +   +          K  +   V    AG +++  + +
Sbjct: 241 SVAANLTKVQAIAYRGTDTVQDATVLLERN-----EEKLSSDLAVNWEAAGSMKIKKVGE 295

Query: 134 PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIV---S 189
            G   V     F +++  N     IT        +  L    Y +         +     
Sbjct: 296 NGE--VLAGAVFEVFNANNESVGKITTGADGMAELNNLPIGTYTVKEIKAPTGYVSGDKP 353

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASG----DTVGESAN 244
             ++V+ G+   V I N   K   ++      G+ +    +++ T  G      V +   
Sbjct: 354 QTIEVKTGETGTVQIVNNKVKGNIEIKKLSDSGKVLPKVEFTVFTEDGKEVKKVVTKENG 413

Query: 245 ASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMD 291
            +    L+ G Y  +       Y        F +    +  +   ++   + 
Sbjct: 414 IANVDGLTYGKYYFLETKTPNGYIGNKTKYPFEIKE-HNKTLTFTVKNTEVK 464


>gi|218906535|ref|YP_002454369.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus AH820]
 gi|218536584|gb|ACK88982.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus AH820]
          Length = 3486

 Score =  139 bits (350), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 41/326 (12%), Positives = 89/326 (27%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++       +N  + K +           +    +        +  +   G  
Sbjct: 3070 FIETKAPKHYDLNQNPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGAT-LEGAV 3128

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +     +         TV   +
Sbjct: 3129 FKIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFTVEKSQ 3187

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                 V   N    G    +          +   F I  +  H     L TDK    ++ 
Sbjct: 3188 TATASVTATNSLTKGAVELTKVDDIDGTTLEGAIFKIVDSNGHDVRADLTTDKDGKISVS 3247

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ           ++       +  G+    ++          +    V     
Sbjct: 3248 DLRPGDYQFIETKAPTGYDLNAKPIPFTIPKGQSQVTSVTALNSLTTGSMELTKVDIDHN 3307

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 3308 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 3367

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   +++ +++ +  K++D +    
Sbjct: 3368 TIEKAQASPLQITVSNKKIDSSSGGE 3393



 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 47/315 (14%), Positives = 87/315 (27%), Gaps = 33/315 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F       +     T +   + KG+ K        +        +++ +   S   G  +
Sbjct: 2791 FIETKAPTHYKLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSALKGAVF 2850

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 2851 KIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFTVEKSQT 2909

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVR 169
                V   N    G    +          +   F I  +  H     L TDK    ++  
Sbjct: 2910 ATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDSNGHDVRTDLTTDKDGKISVSD 2969

Query: 170  LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 2970 LRPGDYQFIETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGT 3029

Query: 223  AVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             +    + I+ ++G     D             L  GDY  I     ++Y        F+
Sbjct: 3030 TLEGAIFKIVDSNGHDVRTDLTTNKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFT 3089

Query: 273  VLTGKSTIVEVLMRQ 287
            V   ++    V    
Sbjct: 3090 VEKSQTATASVTATN 3104



 Score =  132 bits (331), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 49/314 (15%), Positives = 86/314 (27%), Gaps = 35/314 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F       +     T +N  + K          K  +    +        + T+   G  
Sbjct: 2977 FIETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGTT-LEGAI 3035

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I DS +        T    G     DL PGDY    +     +         TV   +
Sbjct: 3036 FKIVDS-NGHDVRTDLTTNKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFTVEKSQ 3094

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                 V   N    G    +          +   F I     +     L TDK    ++ 
Sbjct: 3095 TATASVTATNSLTKGAVELTKVDDIDGATLEGAVFKIVDMNGNDVRTDLTTDKDGKISVS 3154

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       VE  +    ++          +    V ++ G
Sbjct: 3155 DLRPGDYQFIETKAPKHYDLNQNPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDG 3214

Query: 222  EAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSR-----EF 271
              +    + I+ ++G     D   +         L  GDY  I       Y        F
Sbjct: 3215 TTLEGAIFKIVDSNGHDVRADLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPF 3274

Query: 272  SVLTGKSTIVEVLM 285
            ++  G+S +  V  
Sbjct: 3275 TIPKGQSQVTSVTA 3288



 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/310 (13%), Positives = 87/310 (28%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
                 +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1674 KNTNPIKFTITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1733

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
               +      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1734 VHTNLVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1793

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S I      F++      +    L TD      +  L   +YQ  
Sbjct: 1794 LTKGKVKLIKEDDVESSIALAGAVFTLQDATGKEIAKDLKTDDYGVLVIPDLAPGDYQFI 1853

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + VT       +T   V ++ G  +    +
Sbjct: 1854 ETSAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGVTLEGAEF 1913

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A   T         +      +  L  G+Y  I     ++Y        F++   +
Sbjct: 1914 IIVDAHDTTKVVRKGLTTDEHGKVSASDLRPGNYQFIEVKAPKDYDLRKDPIPFTIGKSQ 1973

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1974 KENINVTATN 1983



 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 48/316 (15%), Positives = 98/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2229 FIETKAPKHYVLDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2288

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2289 FNLLDQ-NGKVIKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQ 2347

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKAL--LITDKVRSGTLV 168
            KN   V + N    G    S          +   F+I           L T+     ++ 
Sbjct: 2348 KNIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMNGTVIRKSLTTNSQGKISVP 2407

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    V ++ G
Sbjct: 2408 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDG 2467

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G  V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2468 TALEGAIFKIVDMNGHDVRTGITTDAKGKVSISDLHPGDYQFIETTAPKHYKLDATPIKF 2527

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2528 TIEKSQAEKLQVTAKN 2543



 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 43/287 (14%), Positives = 76/287 (26%), Gaps = 29/287 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    +           +  S   ++I      K    + T    G   + +L P
Sbjct: 2540 TAKNSLIEGAVELIKVDDITPDTKLSDAVFNII-DAKGKVVRTNLTTDKDGKISASNLRP 2598

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY                    T+   +     V   N    GG+ L  I    +    
Sbjct: 2599 GDYQFVEMKAPKDYDLNETPIPFTIEKSQSTHVSVTAKNGLTKGGVELTKIDSLDTKETL 2658

Query: 141  DELTFSIYS--NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
            +   F I      + +  L+T+K        L   +YQ        +  ++       +E
Sbjct: 2659 EGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIKFTIE 2718

Query: 196  PGKIIDVTIQ----NRAAKITF-KLVSEMGGEAVADTAWSILTASG-----DTVGESANA 245
              +   V +          +   K+        +    + I+   G     D   +    
Sbjct: 2719 RSQTKHVFVTAINSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHDIRTDLTTDKNGR 2778

Query: 246  SPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                 L  GDY  I      +Y        F+V  G+  I  V    
Sbjct: 2779 LVVDELPPGDYEFIETKAPTHYKLNETPIKFTVKKGQEKIASVTATN 2825



 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/310 (17%), Positives = 101/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1580 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1638

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +     V   N 
Sbjct: 1639 IRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNPIKFTITESQTTSATVTAKNS 1698

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N +    L+T+      +  L   NY++
Sbjct: 1699 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVHTNLVTNSEGKLVVDDLRPGNYKL 1758

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGE---AVADTAW 229
                           +   ++    K++ +T +N   K   KL+ E   E   A+A   +
Sbjct: 1759 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSIALAGAVF 1818

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I  +   +Y  +     F++  G   
Sbjct: 1819 TLQDATGKEIAKDLKTDDYGVLVIPDLAPGDYQFIETSAPEHYKLDQTPIKFTIKKGSKD 1878

Query: 280  IVEVLMRQKR 289
             + V +    
Sbjct: 1879 DLPVPVTVTN 1888



 Score =  114 bits (285), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   +  E+     T +   I KG    +     V    +T    LT   +       G 
Sbjct: 1852 FIETSAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGVTLEGA 1911

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSS 110
             + I D+  + K      T    G   + DL PG+Y                    T+  
Sbjct: 1912 EFIIVDAHDTTKVVRKGLTTDEHGKVSASDLRPGNYQFIEVKAPKDYDLRKDPIPFTIGK 1971

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +  +  F I     ++    L TDK    +
Sbjct: 1972 SQKENINVTATNSLKKGAVTLTKIDDIDRTMLKDAIFKIVDMNGNEVRTNLGTDKNGKIS 2031

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITF-KLVSE 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +   K+   
Sbjct: 2032 VSDLRPGDYQFIETKAPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELIKIDDI 2091

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L A G+ V                L  G Y  +      +Y      
Sbjct: 2092 DTDTKLANAVFNLLDADGEIVEEGLKTNDEGKIIVENLRPGTYQFVETIAPEHYDLNKKP 2151

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + +  + 
Sbjct: 2152 IEFTIKKSQTETLHITAKN 2170



 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 46/319 (14%), Positives = 96/319 (30%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++     T +   I K + K V                 T++   +  +G  +
Sbjct: 1379 FVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAVF 1438

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    + T    G     DL PG Y    +             + T+   +
Sbjct: 1439 KIVDANDEKKVIRENVTTGADGKVTVKDLEPGTYKFIETEAPKDYVLNANPIEFTIDKSQ 1498

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1499 QSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIVDVNNNDVRTDLTTDADGKTKA 1558

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1559 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1618

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
            G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1619 GTALEGAVFKIVDANDEKKVIRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNP 1678

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++T   V  + 
Sbjct: 1679 IKFTITESQTTSATVTAKN 1697



 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/287 (11%), Positives = 79/287 (27%), Gaps = 34/287 (11%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
              +       +N     SG  + ++   + K      T    G     +L    YL+  +
Sbjct: 1133 GNLEIIKVDNDNKKVPLSGAEFTLY-DRTGKTVIRKITTDKDGIAKFNNLKRDKYLLKET 1191

Query: 97   FGHVGVVKK--------ITVSSKEKNQKQVFILN-AGGIRLYSIYKPGSPIVDDELTFSI 147
                G V          + + S+E    ++      G + L         +      F++
Sbjct: 1192 KAPEGYVISWDLKQGKIVELGSQETTTYKLANKKFVGKVVLTKSDDLNKNVTLQGAVFTL 1251

Query: 148  YSNP----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKII 200
                    +    L T+     T+  L    Y +       +  + +      ++  +  
Sbjct: 1252 LDKDKKIISEHEKLTTNDHGQITVDNLKPGTYYLQETTAPEHYKLDSTPIQFTIKEDQTT 1311

Query: 201  ----DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV-------GESANASPSM 249
                  T            V +  G+ +A   +S+     + +               + 
Sbjct: 1312 VINRTATNSLIPGSAILTKVDKD-GKTLAGAEFSVRDRHNNVIRGYEKLSTNDQGQIEAK 1370

Query: 250  VLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
             L  GDY  +     ++Y  +     F+++  +   V V      + 
Sbjct: 1371 DLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIK 1417



 Score =  108 bits (270), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 36/298 (12%), Positives = 86/298 (28%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++ D+   +         
Sbjct: 2061 TIERSQTKEINVTGKNTLKKGSVELIKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLKTN 2119

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  +  +L PG Y    +     +       + T+   +     +   NA   G    
Sbjct: 2120 DEGKIIVENLRPGTYQFVETIAPEHYDLNKKPIEFTIKKSQTETLHITAKNALTKGAVEL 2179

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S          +   F+I           L+T+      +  L   +YQ        + +
Sbjct: 2180 SKVDDIDGTKLEGAVFNIVDMNGTVIHKNLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2239

Query: 188  VST---VVKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2240 LDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVI 2299

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2300 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKNIATVTMKN 2357



 Score = 81.1 bits (198), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 41/275 (14%), Positives = 75/275 (27%), Gaps = 27/275 (9%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++       +N  + K +          +         ++ +   +   G  +
Sbjct: 3163 FIETKAPKHYDLNQNPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGTTLEGAIF 3222

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEK 113
             I DS +        T    G     DL PGDY    +    G          T+   + 
Sbjct: 3223 KIVDS-NGHDVRADLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFTIPKGQS 3281

Query: 114  NQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
                V  LN    G + L  +       +               +  L TD      +  
Sbjct: 3282 QVTSVTALNSLTTGSMELTKVDIDHNGTLEGAIFNILDQDGKVVREGLKTDGHGKLIVND 3341

Query: 170  LGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRA----AKITFKLVSEMG 220
            L   NYQ+               +S  ++      + +T+ N+     +    K V+   
Sbjct: 3342 LKPGNYQLVETKAPEGYQLDASPISFTIEKAQASPLQITVSNKKIDSSSGGEEKPVTPPN 3401

Query: 221  GEAVADTAWSILTASGDTVGESANASPSMVLSEGD 255
             E       S     G+   E+     S  L +G+
Sbjct: 3402 KEEETGKETSEELEKGNP--EAHGKGTSEELEKGN 3434


>gi|300117873|ref|ZP_07055640.1| collagen adhesion protein [Bacillus cereus SJ1]
 gi|298724737|gb|EFI65412.1| collagen adhesion protein [Bacillus cereus SJ1]
          Length = 3298

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 89/326 (27%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +N  I K +           +    +        +  +   G  
Sbjct: 2898 FIETKAPKHYDLNQTPINFTIEKSQTATASVTATNSLTKGAVELTKVDDIDGAT-LEGAV 2956

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +               TV   +
Sbjct: 2957 FKIV-DMNGNDVRADLTTDKGGKISVSDLRPGDYQFVETKAPTHYDLNQNPINFTVEKSQ 3015

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                 V   N    G    +          +   F I  +  H     L TDK    ++ 
Sbjct: 3016 TATASVTATNSLTKGAVELTKVDDIDGTTLEGAIFKIVDSNGHDVRTDLTTDKDGKISVS 3075

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ           ++       +  G+    ++          +    V     
Sbjct: 3076 NLRPGDYQFIETKAPTGYDLNAKPIPFTIPKGQSQVTSVTALNSLTTGSMELTKVDIDHN 3135

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 3136 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 3195

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   + + +++ +  K+++ +   +
Sbjct: 3196 TIEKAQVSPLQITVSNKKVESSSGGD 3221



 Score =  131 bits (329), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 47/317 (14%), Positives = 92/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I K          K  +    +      + ++     G  
Sbjct: 2617 FVETKAPKDYDLNETPIPFTIEKSQSTHVSVTAKNGLTKGGVELTKIDSLDTKETLEGAV 2676

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I   ++      +      G  ++ DL PGDY    +             K T+   +
Sbjct: 2677 FKI-TDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEIPIKFTIERSQ 2735

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
                 V   N    G + L  +         +   F I +   H     L TDK     +
Sbjct: 2736 TKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVV 2795

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGK----IIDVTIQNRAAKITFKLVSEMG 220
              L   +Y+        +  ++       V+ G+     +  T       +    V ++ 
Sbjct: 2796 DELPPGDYEFIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDID 2855

Query: 221  GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----E 270
            G A+ D  + I+  +G+ V      +         L  GDY  I     ++Y        
Sbjct: 2856 GSALKDAVFKIVDMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQTPIN 2915

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F++   ++    V    
Sbjct: 2916 FTIEKSQTATASVTATN 2932



 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/313 (14%), Positives = 86/313 (27%), Gaps = 33/313 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F       +     T +   + KG+ K        +        +++ +   S      +
Sbjct: 2805 FIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSALKDAVF 2864

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +     +         T+   + 
Sbjct: 2865 KIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQTPINFTIEKSQT 2923

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVR 169
                V   N    G    +          +   F I     +     L TDK    ++  
Sbjct: 2924 ATASVTATNSLTKGAVELTKVDDIDGATLEGAVFKIVDMNGNDVRADLTTDKGGKISVSD 2983

Query: 170  LGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 2984 LRPGDYQFVETKAPTHYDLNQNPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGT 3043

Query: 223  AVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
             +    + I+ ++G     D   +         L  GDY  I       Y        F+
Sbjct: 3044 TLEGAIFKIVDSNGHDVRTDLTTDKDGKISVSNLRPGDYQFIETKAPTGYDLNAKPIPFT 3103

Query: 273  VLTGKSTIVEVLM 285
            +  G+S +  V  
Sbjct: 3104 IPKGQSQVTSVTA 3116



 Score =  124 bits (311), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/290 (13%), Positives = 83/290 (28%), Gaps = 31/290 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    I        +      G  + I +  +N+    +      G  V  DL P
Sbjct: 1708 TAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDARTNLVTNSEGKLVVDDLRP 1767

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIVD 140
            G+Y +  +             + T+   ++    +   N    G ++L       S I  
Sbjct: 1768 GNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNSLTKGKVKLIKEDDVESSIAL 1827

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
                F++      +    L TD+     +  L   +YQ        +  +        ++
Sbjct: 1828 AGAVFTLQDANGTEIAKDLKTDEHGVLVIPDLAPGDYQFIETAAPEHYKLDQTPIKFTIK 1887

Query: 196  PGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDT-------VGES 242
             G        + V        +T   V ++ G  +    + I+ A             + 
Sbjct: 1888 KGSKDDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEFIIVDAHDTKKVVRKGLTTDE 1947

Query: 243  ANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
                 +  L  GDY  I     ++Y+       F++   +   + V    
Sbjct: 1948 HGKVSASDLRPGDYQFIEVKAPKDYTLGNNPIPFTIGKSQKENITVTATN 1997



 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 94/319 (29%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+     T +   I K + + +    +          +++ +   +   G
Sbjct: 2147 TYQFVETIAPEHYDLNKTPIEFTIKKSQTETLHVTAKNALTKGAVELSKVDDIDGTKLEG 2206

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              ++I   ++      +      G     DL PGDY    +     +         T+  
Sbjct: 2207 AVFNIV-DMNGTVIHKNLVTNSKGKIEIDDLRPGDYQFIETKAPKHYVLDETPIDFTIEK 2265

Query: 111  KEKNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSG 165
             +K    +   N    G I L  +      +   +  F++           L T+     
Sbjct: 2266 GQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVIKTDLKTNNEGKI 2325

Query: 166  TLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    YQ        +  +      V VE  +    T+          +    V +
Sbjct: 2326 VVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKDIATVTMKNSLTKGGVELSKVDD 2385

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            + G  +    ++I+  +G  +       S        L  GDY  I     ++Y      
Sbjct: 2386 VDGTTLEGAVFNIVDMNGTVIRKSLTTNSQGKISVPDLRPGDYKFIETKAPKHYDLNKEP 2445

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++  G++  + V  + 
Sbjct: 2446 IPFTIEKGQAEPISVTAKN 2464



 Score =  123 bits (307), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 98/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2243 FIETKAPKHYVLDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2302

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2303 FNLLDQ-NGKVIKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQ 2361

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKAL--LITDKVRSGTLV 168
            K+   V + N    G    S          +   F+I           L T+     ++ 
Sbjct: 2362 KDIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMNGTVIRKSLTTNSQGKISVP 2421

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +Y+        +  ++       +E G+   +++          +    V ++ G
Sbjct: 2422 DLRPGDYKFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDG 2481

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G  V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2482 TALEGAIFKIVDMNGHDVRTGITTDAKGKVSISDLHPGDYQFIETTAPKHYKLDATPIKF 2541

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2542 TIEKSQAEKLQVTAKN 2557



 Score =  118 bits (296), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 45/317 (14%), Positives = 93/317 (29%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I KG+ + +    + +        +++ +   +   G  +
Sbjct: 2430 FIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDGTALEGAIF 2489

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +             K T+   + 
Sbjct: 2490 KIV-DMNGHDVRTGITTDAKGKVSISDLHPGDYQFIETTAPKHYKLDATPIKFTIEKSQA 2548

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    +  
Sbjct: 2549 EKLQVTAKNSLIEGAVELIKVDDITPDTKLSDAVFNIIDAKGKVVRTNLTTDKDGKISAS 2608

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  +   V++          +    +     
Sbjct: 2609 NLRPGDYQFVETKAPKDYDLNETPIPFTIEKSQSTHVSVTAKNGLTKGGVELTKIDSLDT 2668

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2669 KETLEGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEIPIK 2728

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F++   ++  V V    
Sbjct: 2729 FTIERSQTKHVFVTATN 2745



 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 50/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   A  E+     T +   I KG    +     V    +T    LT   +   +   G 
Sbjct: 1866 FIETAAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1925

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1926 EFIIVDAHDTKKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYTLGNNPIPFTIGK 1985

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGT 166
             +K    V   N    G    +        +     F I      +    L+TDK     
Sbjct: 1986 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLKGAVFKIVDMKGTEVRTNLVTDKNGKIY 2045

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2046 VPDLRPGDYQFIETKTPEHYVLDETPIPFTIERSQTKEINVTGKNTLKKGSVELTKIDDI 2105

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L A G+ V       +        L  G Y  +      +Y      
Sbjct: 2106 DTDTKLANAVFNLLDADGEIVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLNKTP 2165

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++  + V  + 
Sbjct: 2166 IEFTIKKSQTETLHVTAKN 2184



 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 86/298 (28%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++ D+   +         
Sbjct: 2075 TIERSQTKEINVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLKTN 2133

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +       + T+   +     V   NA   G    
Sbjct: 2134 AEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIKKSQTETLHVTAKNALTKGAVEL 2193

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S          +   F+I           L+T+      +  L   +YQ        + +
Sbjct: 2194 SKVDDIDGTKLEGAVFNIVDMNGTVIHKNLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2253

Query: 188  VST---VVKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2254 LDETPIDFTIEKGQKKTISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVI 2313

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2314 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKDIATVTMKN 2371



 Score =  110 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/308 (12%), Positives = 76/308 (24%), Gaps = 32/308 (10%)

Query: 11   AENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNT 70
             + +  T      + +       +    +               G  + I   ++N    
Sbjct: 1500 TKPIEFTIDKSQQSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIV-DVNNNDVR 1558

Query: 71   LSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA-- 123
               T    G   +  L PG Y    +             + T+   +K    V   NA  
Sbjct: 1559 TDLTTDADGKTKADKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALK 1618

Query: 124  GGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSGTLVRLGTNNYQITS 179
             G    +              F I    +     +  + T          L   +Y+   
Sbjct: 1619 PGDVELTKVDDIDGTALAGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIE 1678

Query: 180  HYGKYNAIVST---VVKVEPGK-----IIDVTIQNRAAKITFKLVS-EMGGEAVADTAWS 230
                     +T      ++  +      +          I    V+     E +    + 
Sbjct: 1679 VTAPKYYDKNTKPIEFTIKESQGISPITVTAKNSLTKGGIELTKVNAADEKETLEGAVFK 1738

Query: 231  ILTASGDT------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKST 279
            I+    +       V  S        L  G+Y +I       Y       EF++  G+ T
Sbjct: 1739 IVNRDTNEDARTNLVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQT 1798

Query: 280  IVEVLMRQ 287
            ++ +  + 
Sbjct: 1799 LLPLTFKN 1806



 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 38/312 (12%), Positives = 86/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1121 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNTLLTGAEFTLY-DRTGKTVIR 1179

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1180 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1239

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1240 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNKGQITVEHLKPGTYYLK 1299

Query: 179  SHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +      VK+   +        T            V +  G+ +A   +S+
Sbjct: 1300 ETTAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIPGSAILTKVDKD-GKTLAGAEFSV 1358

Query: 232  LTAS-------GDTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                       G           +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1359 RDRKNKIIPGYGKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKK 1418

Query: 280  IVEVLMRQKRMD 291
             V V      + 
Sbjct: 1419 AVTVTATNHLIK 1430



 Score =  105 bits (262), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 47/320 (14%), Positives = 97/320 (30%), Gaps = 37/320 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++     T +   I K + K V                 T++   +  +G  +
Sbjct: 1392 FVEEKAPKDYDIDKTPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAIF 1451

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV---VKKITVSSKEK- 113
             I D+   KK    +      G     DL PG Y    +          K I  +  +  
Sbjct: 1452 KIVDANDEKKVIRENVKTGADGKVTVKDLEPGTYKFIETEAPKDYVLNTKPIEFTIDKSQ 1511

Query: 114  ----NQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1512 QSFATVTATNSLKTGEVELLKVDEFGDKKPLKGAVFKIVDVNNNDVRTDLTTDADGKTKA 1571

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1572 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1631

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            G A+A   + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1632 GTALAGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKP 1691

Query: 270  -EFSVLTGK-STIVEVLMRQ 287
             EF++   +  + + V  + 
Sbjct: 1692 IEFTIKESQGISPITVTAKN 1711



 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/281 (13%), Positives = 76/281 (27%), Gaps = 30/281 (10%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNK-KNTLSTTKKIIGGKVSFDLFPGDYLISA 95
             ++        N      G  + + D            T    G      L PG Y +  
Sbjct: 1241 GKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNKGQITVEHLKPGTYYLKE 1300

Query: 96   SFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSI 147
            +           + ++ ++  +         N+   G   L  + K G  +   E +   
Sbjct: 1301 TTAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIPGSAILTKVDKDGKTLAGAEFSVRD 1360

Query: 148  YSNP--NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKII 200
              N        L T+         L   +YQ        +       +   +     K +
Sbjct: 1361 RKNKIIPGYGKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQKKAV 1420

Query: 201  DVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASG-------DTVGESANASPSMVL 251
             VT  N      +T     ++ G A+A   + I+ A+        +    +        L
Sbjct: 1421 TVTATNHLIKGGVTLTKTDDIDGTALAGAIFKIVDANDEKKVIRENVKTGADGKVTVKDL 1480

Query: 252  SEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
              G Y  I     ++Y       EF++   + +   V    
Sbjct: 1481 EPGTYKFIETEAPKDYVLNTKPIEFTIDKSQQSFATVTATN 1521


>gi|229112771|ref|ZP_04242303.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
            Rock1-15]
 gi|228670605|gb|EEL25917.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
            Rock1-15]
          Length = 3123

 Score =  139 bits (349), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 43/326 (13%), Positives = 94/326 (28%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGK-------RVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++       +   I + + K         +    +           +   G  
Sbjct: 2718 FIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINTLTEGSVELIKVDDAKQNTTLEGAV 2777

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +           T    G  V  +L PGDY    +     +       K TV   +
Sbjct: 2778 FKIVNKD-GHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPIKFTVKKGQ 2836

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            +    V   N    G + L  +    G+ +             + ++ L TDK    ++ 
Sbjct: 2837 EKIASVTATNSLTKGAVELTKVDDIDGTTLEGAIFKIVDMDGKDVRSDLTTDKDGKISVS 2896

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     +I  VT         I    V     
Sbjct: 2897 DLRPGDYQFIETKAPTGYDLNIKPIPFTITKGQSQITSVTALNSLTTGSIELTKVDIDHH 2956

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 2957 GTLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETQAPKGYQLDASPINF 3016

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++T +++ +  K+++ +   +
Sbjct: 3017 TIDKAQATPLQITVSNKKIESSSGGD 3042



 Score =  126 bits (317), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1695 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1754

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1755 VRTDLVTNSKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1814

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1815 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFI 1874

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1875 ETKAPEHYKLDKTPIKFTIKKGSKEDLPVPVTVKNSLLTGGVTLTKVDDVDGTILEGAEF 1934

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1935 IIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 1994

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1995 KENITVTATN 2004



 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 45/316 (14%), Positives = 93/316 (29%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++   +   +   I K + + +      + +       ++ +   ++  G  +
Sbjct: 1970 FIEVKAPKDYTLSKDPIPFTIEKSQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIF 2029

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++ K+   +      G     DL PGDY    +     +         T+   + 
Sbjct: 2030 KIV-DMNGKEVHTNLVTDKNGKISVSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQT 2088

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
             +  V   NA   G + L  I             F++           L T+      + 
Sbjct: 2089 KEINVTGKNALKNGSVELTKIDDIDINTKLANAVFNLLDADGELVKEDLKTNDEGKIVVE 2148

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQN--RAAKITFKLVSEMGG 221
             L    YQ        +       +   +K    + + VT  N      +    V +  G
Sbjct: 2149 NLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHVTATNALTKGAVKLSKVDDFDG 2208

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              + D  + I+  +GD V                L  GDY  I     ++Y  +     F
Sbjct: 2209 TVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKF 2268

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++  G+   + +    
Sbjct: 2269 TIEKGQKKAISLTATN 2284



 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 96/316 (30%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I KG+ K +       +    I        N+ +  +   
Sbjct: 2250 FIETKAPKHYVLDETPIKFTIEKGQKKAISLTATNSLKQGSIELLKVDDLNTQTKLADAV 2309

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA-----SFGHVGVVKKITVSSKE 112
            +++ D    K           G  V  +L PG Y          +         T+   +
Sbjct: 2310 FNLLDQD-GKVLKTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQ 2368

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K+   V + N    GG+ L  +    G+ +          +    +  L+T++    ++ 
Sbjct: 2369 KDIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFKIVDMNGTVIRKNLVTNQQGKISVS 2428

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  +S       +   +   +++          +    V ++ G
Sbjct: 2429 DLRPGDYQFIETTAPKHYDLSKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDG 2488

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+ D  + I   +G  +      +         L  GDY  +      +Y  +     F
Sbjct: 2489 TALKDAVFKITDLNGKDIRTELTTDVHGKISVSDLRPGDYQFVETKAPEHYKLDSTPIKF 2548

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   +   ++V    
Sbjct: 2549 TIKKSQKEKLQVTATN 2564



 Score =  120 bits (300), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/310 (17%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1601 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1659

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1660 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1719

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1720 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYKL 1779

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1780 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1839

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1840 TLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1899

Query: 280  IVEVLMRQKR 289
             + V +  K 
Sbjct: 1900 DLPVPVTVKN 1909



 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +I  G 
Sbjct: 1873 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPVPVTVKNSLLTGGVTLTKVDDVDGTILEGA 1932

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1933 EFIIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 1992

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1993 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2052

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2053 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKNGSVELTKIDDI 2112

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2113 DINTKLANAVFNLLDADGELVKEDLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2172

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2173 IVFTIKKSQTETLHVTATN 2191



 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 46/315 (14%), Positives = 94/315 (29%), Gaps = 35/315 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++   +   +   I+K +   +      +        +++ +   +      +
Sbjct: 2437 FIETTAPKHYDLSKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDGTALKDAVF 2496

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++ K      T  + G     DL PGDY    +             K T+   +K
Sbjct: 2497 KI-TDLNGKDIRTELTTDVHGKISVSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQK 2555

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    T  
Sbjct: 2556 EKLQVTATNSLTEGAVELVKVDDINPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITAT 2615

Query: 169  RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  ++   ++          +    V     
Sbjct: 2616 NLRPGDYQFIETKAPKDYDLNKTPISFTIERSQLTHASVTAKNGLTKGGVELTKVDSIDK 2675

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2676 KEMLEGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEEPIK 2735

Query: 271  FSVLTGKSTIVEVLM 285
            F++   ++  V V  
Sbjct: 2736 FTIERSQTKHVFVTA 2750



 Score =  111 bits (276), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/312 (10%), Positives = 85/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1127 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1185

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1186 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1245

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1246 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNQGQITVDNLKPGTYYLQ 1305

Query: 179  SHYGKYNAIVSTV---VKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  + +      ++  +        T              +  G+ +A   +S+
Sbjct: 1306 ETTAPEHYKLDSTPIQFTIKEDQTTVINRTATNSLIPGSAILTKFDKD-GKTLAGAEFSV 1364

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                   +               +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1365 RDRYNKVIRGYEKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKKPIEFTIIKSQKK 1424

Query: 280  IVEVLMRQKRMD 291
             + V      + 
Sbjct: 1425 ALTVTATNHLIK 1436



 Score =  110 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++       +   I K + K +                ++ +   +   G  +
Sbjct: 1398 FVEEKAPKDYDIDKKPIEFTIIKSQKKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1457

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1458 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGAYKFIETEAPKDYTLSTNPIEFTIDKSQ 1517

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1518 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1577

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1578 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1637

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1638 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1697

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1698 KPIKFTITESQTTQATVTAKN 1718


>gi|228942505|ref|ZP_04105040.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            serovar berliner ATCC 10792]
 gi|228817098|gb|EEM63188.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            serovar berliner ATCC 10792]
          Length = 2912

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 48/326 (14%), Positives = 98/326 (30%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+     T +   + KG+ K         +    +        + T+   G  
Sbjct: 2508 FIETKAPEHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELTKVDNIDGTT-LEGAI 2566

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I D    K      T    G     DL PGDY    +     +       K TV   +
Sbjct: 2567 FKIVDMD-GKDIRSDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPIKFTVEKSQ 2625

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
              +  V   N    G + L  +    G+ +          +  +  + L TDK    ++ 
Sbjct: 2626 TAKASVTATNSLTKGAVELTKVDDIDGTTLAGAIFKIVDMNGKDVHSDLTTDKDGKISVS 2685

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         I    V     
Sbjct: 2686 DLRPGDYQFIETKAPTGYDLNIKPIPFTITKGQSQVTSVTALNSLTTGAIELTKVDIDHH 2745

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 2746 GTLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETQAPKGYQLDASPINF 2805

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++T +++ +  K+++ +   +
Sbjct: 2806 TIDKAQATPLQITVSNKKIESSSGGD 2831



 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 42/298 (14%), Positives = 83/298 (27%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T        +    K  +    +      + +   +  G  + I   ++      +    
Sbjct: 2339 TIERSQLTHASVTAKNGLTKGGVELTKVDSIDKKEMLEGAVFKI-TDLNGNDIRTNLVTN 2397

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRL 128
              G  ++ DL PGDY    +             K T+   +     V  +N    G + L
Sbjct: 2398 KDGKIIAKDLQPGDYQFIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTKGSVEL 2457

Query: 129  YSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
              +         +   F I +   H     L TDK     +  L   +Y+        + 
Sbjct: 2458 IKVDDAKQNTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHY 2517

Query: 187  IVSTV---VKVEPGK----IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
             ++       V+ G+     +  T       +    V  + G  +    + I+   G  +
Sbjct: 2518 DLNETPIKFTVKKGQEKIASVTATNSLTKGAVELTKVDNIDGTTLEGAIFKIVDMDGKDI 2577

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                  +         L  GDY  I     ++Y        F+V   ++    V    
Sbjct: 2578 RSDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPIKFTVEKSQTAKASVTATN 2635



 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1391 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1450

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1451 VRTDLVTNSKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1510

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1511 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFI 1570

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1571 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1630

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1631 IIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 1690

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1691 KENITVTATN 1700



 Score =  124 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 44/316 (13%), Positives = 94/316 (29%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++   +   +   I K + + +      + +       ++ +   ++  G  +
Sbjct: 1666 FIEVKAPKDYTLSKDPIPFTIEKSQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIF 1725

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++ K+   +      G     DL PGDY    +     +         T+   + 
Sbjct: 1726 KIV-DMNGKEVHTNLVTDKNGKISVSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQT 1784

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
             +  V   NA   G + L  I             F++           L T+      + 
Sbjct: 1785 KEINVTGKNALKKGSVELTKIDDIDITTKLANAVFNLLDADGELVKEGLKTNDEGKIVVE 1844

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQN--RAAKITFKLVSEMGG 221
             L    YQ        +       +   +K    + + +T  N      +    V ++ G
Sbjct: 1845 NLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHITATNALTKGAVKLSKVDDVDG 1904

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              + D  + I+  +GD V                L  GDY  I     ++Y  +     F
Sbjct: 1905 TVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKF 1964

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++  G+   + +    
Sbjct: 1965 TIEKGQKKAISLTATN 1980



 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 93/316 (29%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I KG+ K +       +    I        N+ +  +   
Sbjct: 1946 FIETKAPKHYVLDETPIKFTIEKGQKKAISLTATNSLKQGSIELLKVDDLNTQTKLADAV 2005

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA-----SFGHVGVVKKITVSSKE 112
            +++ D    K           G  V  +L PG Y          +         T+   +
Sbjct: 2006 FNLLDQD-GKVLKTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIKKSQ 2064

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
            K+   V + N    G    S          +   F I +         L+T++    ++ 
Sbjct: 2065 KDIATVTMKNSLTKGGVELSKVNDVDGTTLEGAVFKIVNMNGTVIRKNLVTNQQGKISVS 2124

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  +S       +   +   +++          +    V ++ G
Sbjct: 2125 DLRPGDYQFIETTAPKHYDLSKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDG 2184

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+ D  + I   +G+ +      +         L  GDY  +      +Y  +     F
Sbjct: 2185 TALKDAVFKITDLNGNEIRTELTTDVHGKISVSDLRPGDYQFVETKAPEHYKLDSTPIKF 2244

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   +   ++V    
Sbjct: 2245 TIKKSQKEKLQVTATN 2260



 Score =  119 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 51/310 (16%), Positives = 101/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            + E +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1297 REEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1355

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1356 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1415

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1416 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYKL 1475

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1476 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1535

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1536 TLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1595

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1596 DLPIPVTVKN 1605



 Score =  116 bits (290), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 45/315 (14%), Positives = 94/315 (29%), Gaps = 35/315 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++   +   +   I+K +   +      +        +++ +   +      +
Sbjct: 2133 FIETTAPKHYDLSKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDGTALKDAVF 2192

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++  +     T  + G     DL PGDY    +             K T+   +K
Sbjct: 2193 KI-TDLNGNEIRTELTTDVHGKISVSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQK 2251

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    T  
Sbjct: 2252 EKLQVTATNSLTEGAVELIKVDDINPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITAT 2311

Query: 169  RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  ++   ++          +    V     
Sbjct: 2312 NLRPGDYQFIETKAPKHYDLNKTPISFTIERSQLTHASVTAKNGLTKGGVELTKVDSIDK 2371

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2372 KEMLEGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEEPIK 2431

Query: 271  FSVLTGKSTIVEVLM 285
            F++   ++  V V  
Sbjct: 2432 FTIERSQTKHVFVTA 2446



 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 94/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1569 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1628

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1629 EFIIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 1688

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1689 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 1748

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 1749 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKKGSVELTKIDDI 1808

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 1809 DITTKLANAVFNLLDADGELVKEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 1868

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + +    
Sbjct: 1869 IVFTIKKSQTETLHITATN 1887



 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/312 (10%), Positives = 85/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 823  NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 881

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 882  KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 941

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 942  VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNDQGQITVDNLKPGTYYLQ 1001

Query: 179  SHYGKYNAIVSTV---VKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  + +      ++  +        T              +  G+ +A   +S+
Sbjct: 1002 ETTAPEHYKLDSTPIQFTIKEDQTTVINRTATNSLIPGSAILTKFDKD-GKTLAGAEFSV 1060

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                   +               +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1061 RDRYNKVIRGYEKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKKPIEFTIIKSQKK 1120

Query: 280  IVEVLMRQKRMD 291
             + V      + 
Sbjct: 1121 ALTVTATNHLIK 1132



 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++       +   I K + K +                ++ +   +   G  +
Sbjct: 1094 FVEEKAPKDYDIDKKPIEFTIIKSQKKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1153

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1154 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGAYKFIETEAPKDYTLSTNPIEFTIDKSQ 1213

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1214 QTLATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1273

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1274 KVSNLRPGTYKFIEIAAPEHYVLREEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1333

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1334 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1393

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1394 KPIKFTITESQTTQATVTAKN 1414


>gi|229168153|ref|ZP_04295881.1| hypothetical protein bcere0007_31120 [Bacillus cereus AH621]
 gi|228615397|gb|EEK72494.1| hypothetical protein bcere0007_31120 [Bacillus cereus AH621]
          Length = 1093

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 41/279 (14%), Positives = 87/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  I +G  + +F++ +
Sbjct: 253 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEILAGAVFEVFNANN 312

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    QV  
Sbjct: 313 ESVGK--ITTGADGTAELNNLPIGTYTVKEIKAPTGYVSGDKPQTIEVKTGEIGAVQVVN 370

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR-LGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 371 NKVKGNIEIKKLSDSGKMLPN-VEFTVFTEDGKEVKKVVTKENGIANVDGLTYGKYYFLE 429

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 430 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 489

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 490 DASGKVIGEYKTDKNGEVNVKDLAYGKYSFVEKASPNGY 528



 Score = 70.3 bits (170), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 35/296 (11%), Positives = 82/296 (27%), Gaps = 26/296 (8%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDS----GVSWHIFDSISNKKNTLST 73
           + L     +   G   V A+      ++   +  +      G  + I      K    + 
Sbjct: 181 TNLYTVQTNAKSGSYKVVAKNAPNGVKIVSENGEVKDQLSLGEKFRIQIPKDTKTGEFNL 240

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYK 133
           +      KV    + G   +            +  + ++ +        A G        
Sbjct: 241 SVAANLTKVQAIAYRGTDTVQ------NATVLLERNEEKLSSDLAVNWEAAGSLKIKKVG 294

Query: 134 PGSPIVDDELTFSIYSNPNHKALLITDK-VRSGTLVRLGTNNYQITSHYGKYNAIV---S 189
               I      F +++  N     IT     +  L  L    Y +         +     
Sbjct: 295 ENGEI-LAGAVFEVFNANNESVGKITTGADGTAELNNLPIGTYTVKEIKAPTGYVSGDKP 353

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASG----DTVGESAN 244
             ++V+ G+I  V + N   K   ++      G+ + +  +++ T  G      V +   
Sbjct: 354 QTIEVKTGEIGAVQVVNNKVKGNIEIKKLSDSGKMLPNVEFTVFTEDGKEVKKVVTKENG 413

Query: 245 ASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            +    L+ G Y  +       Y        F +    +  +   +    +  + +
Sbjct: 414 IANVDGLTYGKYYFLETKTPNGYIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 468



 Score = 64.9 bits (156), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 41/287 (14%), Positives = 81/287 (28%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 445 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAVFELKDASGKV 495

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV---VKKITVSSKEKNQKQ----VFI 120
                      G     DL  G Y         G     + I    KE  +      V  
Sbjct: 496 IGEYK--TDKNGEVNVKDLAYGKYSFVEKASPNGYVLITEPIVFEIKEHGKIIELLAVNH 553

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 554 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 613

Query: 180 HYGKYNAIVSTVV----KVEPGKIIDVTIQNRA-AKITFKLVSEMGGEAVADTAWSILTA 234
                  +++  +      E G+II   +++     +      +  G     T+ S+   
Sbjct: 614 TVAPKGYVLNEEIFSFEIKENGQIIKHIVKDEKIPSVKTTATDKTDGTKEMHTSKSVTIQ 673

Query: 235 SGDTVGESANASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
                           L  G +YT+  +  ++  ++   V   + T 
Sbjct: 674 D---------KVEYKDLQVGKEYTLKGKLMDKETNKPLVVNGKEVTA 711


>gi|296504033|ref|YP_003665733.1| collagen adhesion protein [Bacillus thuringiensis BMB171]
 gi|296325085|gb|ADH08013.1| collagen adhesion protein [Bacillus thuringiensis BMB171]
          Length = 916

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 39/279 (13%), Positives = 86/279 (30%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 199 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNANN 258

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 259 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKTQTIEVKTGETGAVQIVN 316

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 317 NKVKGNIEIKKLSDSGKVLPN-VEFTVFTEDGKEVQKVVTKENGIANVEGLTYGKYYFLE 375

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 376 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 435

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
             SG  V     +         L+ G Y+ + +     Y
Sbjct: 436 DESGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPHGY 474



 Score = 94.2 bits (232), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/301 (12%), Positives = 81/301 (26%), Gaps = 25/301 (8%)

Query: 15  HTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTT 74
             T T+       G  + V +  +   E +   +S  +   V + +F     +       
Sbjct: 297 DKTQTIEVKTGETGAVQIVNNKVKGNIEIKKLSDSGKVLPNVEFTVFTEDGKEV--QKVV 354

Query: 75  KKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKEKNQKQVFILN--AGGIR 127
            K  G      L  G Y    +    G +         +    K            G ++
Sbjct: 355 TKENGIANVEGLTYGKYYFLETKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVK 414

Query: 128 LYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
           L  +         +   F +            TDK     +  L    Y        +  
Sbjct: 415 LLKVDNEDISKKLEGAVFELKDESGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPHGY 474

Query: 187 I-VSTVVKVEPGKIIDV-----TIQNRAAKITFKLVS-EMGGEAVADTAWSILTASGDTV 239
           + V   +  E  +   +             +    V    G   + +  ++I   +G  V
Sbjct: 475 VLVKEPIMFEIKEHGKIIELLAVNHLIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEV 534

Query: 240 ----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKS-TIVEVLMRQKRMD 291
                +    +    L  G YT       + Y      FS    ++  I++ +++ +++ 
Sbjct: 535 VKGKTDDKGIAKFEKLPFGKYTYKETVAPKGYVLNEETFSFEIKENGQIIKHIVKDEKIP 594

Query: 292 K 292
            
Sbjct: 595 S 595



 Score = 48.4 bits (113), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/86 (19%), Positives = 32/86 (37%), Gaps = 10/86 (11%)

Query: 208 AAKITFKLVSEMGGEAVADTAWSILTAS----GDTVGESANASPSMVLSEGDYTVIARNK 263
           A  +  K V    GE +A   + +  A+    G     +   +    L  G YT+     
Sbjct: 231 AGSLKIKKV-GENGEVLAGAVFEVFNANNESVGKITTGADGMAELNNLPIGTYTLKEIKA 289

Query: 264 ERNY-----SREFSVLTGKSTIVEVL 284
              Y     ++   V TG++  V+++
Sbjct: 290 PTGYVSDDKTQTIEVKTGETGAVQIV 315


>gi|229047189|ref|ZP_04192803.1| hypothetical protein bcere0027_31910 [Bacillus cereus AH676]
 gi|228724150|gb|EEL75493.1| hypothetical protein bcere0027_31910 [Bacillus cereus AH676]
          Length = 916

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 87/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F+  +
Sbjct: 199 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNVNN 258

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 259 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 316

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 317 NKVKGSIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLE 375

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +   A+ + 
Sbjct: 376 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAAFELK 435

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  V     +         L+ G Y+ + +     Y
Sbjct: 436 DASGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 474



 Score = 70.0 bits (169), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 34/274 (12%), Positives = 81/274 (29%), Gaps = 22/274 (8%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +   +   E    +  G  + I    + K    + +      KV    + G   +  
Sbjct: 149 PNGVRIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNLSVAANLIKVQAIAYRGTDTVQN 208

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA 155
           +   +          K  +   V    AG +++  + + G   V     F +++  N   
Sbjct: 209 ATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGENGE--VLAGAVFEVFNVNNESV 261

Query: 156 LLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIVS---TVVKVEPGKIIDVTIQNRAAKI 211
             IT        +  L    Y +         +       ++V+ G+   V I N   K 
Sbjct: 262 GKITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVNNKVKG 321

Query: 212 TFKLVS-EMGGEAVADTAWSILTASG----DTVGESANASPSMVLSEGDYTVIARNKERN 266
           + ++      G+ + +  +++ T  G      V +    +    L+ G Y  +       
Sbjct: 322 SIEIKKLSDSGKILPNVEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLETKTPNG 381

Query: 267 Y-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
           Y        F +    +  +   +    +  + +
Sbjct: 382 YIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 414



 Score = 60.7 bits (145), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 43/287 (14%), Positives = 80/287 (27%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G ++ + D+    
Sbjct: 391 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAAFELKDASGKV 441

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK-------KITVSSKEKNQKQVFI 120
                      G     DL  G Y         G V        +I    K      V  
Sbjct: 442 VGEYK--TDKNGEINVKDLAYGKYSFVEKASPNGYVLVKEPIMFEIKEHGKIIELLAVNH 499

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 500 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 559

Query: 180 HYGKYNAIVSTV----VKVEPGKIIDVTIQNRA-AKITFKLVSEMGGEAVADTAWSILTA 234
                  +++         E G+II   +++     I  K   +  G     T+ S+   
Sbjct: 560 TVAPKGYVLNEETFSFEIKENGQIIKHIVKDEKIPSIETKATDKTDGTKEMHTSKSVTIQ 619

Query: 235 SGDTVGESANASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
                           L  G +YT+  +   +  ++   V   + T 
Sbjct: 620 D---------KVEYKDLQVGKEYTLKGKLMNKETNKPLVVNGKEVTA 657


>gi|228953791|ref|ZP_04115830.1| hypothetical protein bthur0006_31670 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228805759|gb|EEM52339.1| hypothetical protein bthur0006_31670 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
          Length = 1062

 Score =  139 bits (349), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 88/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 222 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNANN 281

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 282 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 339

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 340 NKVKGNIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIANVEDLTYGKYYFLE 398

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +   A+ + 
Sbjct: 399 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAAFELK 458

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  V     +         L+ G Y+ + +     Y
Sbjct: 459 DASGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 497



 Score = 69.2 bits (167), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 33/270 (12%), Positives = 78/270 (28%), Gaps = 22/270 (8%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +   +   E    +  G  + I    + K    + +      +V    + G   +  
Sbjct: 172 PNGVRIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNLSVAANLTQVQAIAYRGTDTVQN 231

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA 155
           +   +          K  +   V    AG +++  + + G   V     F +++  N   
Sbjct: 232 ATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGENGE--VLAGAVFEVFNANNESV 284

Query: 156 LLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIVS---TVVKVEPGKIIDVTIQNRAAKI 211
             IT        +  L    Y +         +       ++V+ G+   V I N   K 
Sbjct: 285 GKITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVNNKVKG 344

Query: 212 TFKLVS-EMGGEAVADTAWSILTASG----DTVGESANASPSMVLSEGDYTVIARNKERN 266
             ++      G+ + +  +++ T  G      V +    +    L+ G Y  +       
Sbjct: 345 NIEIKKLSDSGKILPNVEFTVFTEDGKEVKKVVTKENGIANVEDLTYGKYYFLETKTPNG 404

Query: 267 Y-----SREFSVLTGKSTIVEVLMRQKRMD 291
           Y        F +    +  +   +    + 
Sbjct: 405 YIGNKTKYPFEIKE-HNKTLTFTVENTEVK 433



 Score = 63.4 bits (152), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 40/289 (13%), Positives = 79/289 (27%), Gaps = 35/289 (12%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G ++ + D+    
Sbjct: 414 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAAFELKDASGKV 464

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQ--VFI 120
                      G     DL  G Y         G           +    K  +   V  
Sbjct: 465 VGEYK--TDKNGEINVKDLAYGKYSFVEKASPNGYVLVKEPIMFEIKEHGKVIELLAVNH 522

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 523 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 582

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
                  +++             + + +      K + +        T  +  T     +
Sbjct: 583 TVAPNGYVLNEE---------TFSFEIKENDQIIKHIVKDEKIPSIKTTATDKTDGTKEM 633

Query: 240 GESAN-----ASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTIVE 282
             S +           L  G +YT+  +   +  ++ F V+ GK   VE
Sbjct: 634 HTSKSVTIQDKVEYKDLQVGKEYTLKGKLMNKETNKPF-VVNGKEVTVE 681


>gi|228940602|ref|ZP_04103168.1| hypothetical protein bthur0008_32470 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228973522|ref|ZP_04134106.1| hypothetical protein bthur0003_32790 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228980080|ref|ZP_04140396.1| hypothetical protein bthur0002_32510 [Bacillus thuringiensis Bt407]
 gi|228779666|gb|EEM27917.1| hypothetical protein bthur0002_32510 [Bacillus thuringiensis Bt407]
 gi|228786217|gb|EEM34212.1| hypothetical protein bthur0003_32790 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228819108|gb|EEM65167.1| hypothetical protein bthur0008_32470 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|326941236|gb|AEA17132.1| collagen adhesion protein [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 1062

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 39/279 (13%), Positives = 86/279 (30%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 222 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNANN 281

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 282 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 339

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 340 NKVKGNIEIKKLSDSGKVLPN-VEFTVFTEDGKEVQKVVTKENGIANVEGLTYGKYYFLE 398

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 399 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 458

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
             SG  V     +         L+ G Y+ + +     Y
Sbjct: 459 DESGKVVGEYKTDKNGEINVKDLAYGKYSFVEKTSPHGY 497



 Score = 93.8 bits (231), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 38/310 (12%), Positives = 83/310 (26%), Gaps = 28/310 (9%)

Query: 6   SSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSIS 65
           + Y   +   T           G  + V +  +   E +   +S  +   V + +F    
Sbjct: 314 TGYVSDDKPQTIEVK---TGETGAVQIVNNKVKGNIEIKKLSDSGKVLPNVEFTVFTEDG 370

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKEKNQKQVFI 120
            +        K  G      L  G Y    +    G +         +    K       
Sbjct: 371 KEV--QKVVTKENGIANVEGLTYGKYYFLETKTPNGYIGNKTKYPFEIKEHNKTLTFTVE 428

Query: 121 LN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQI 177
                G ++L  +         +   F +            TDK     +  L    Y  
Sbjct: 429 NTEVKGSVKLLKVDNEDISKKLEGAVFELKDESGKVVGEYKTDKNGEINVKDLAYGKYSF 488

Query: 178 TSHYGKYNAI-VSTVVKVEPGKIIDV-----TIQNRAAKITFKLVS-EMGGEAVADTAWS 230
                 +  + V   +  E  +   +        +    +    V    G   + +  ++
Sbjct: 489 VEKTSPHGYVLVKEPIMFEIKEHGKIIELLAVNHHIKGDLEITKVDVADGNNKLPNAEFT 548

Query: 231 ILTASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKS-TIVE 282
           I   +G  V     +    +    L  G YT       + Y      FS    ++  I++
Sbjct: 549 IYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKETVAPKGYVLNEETFSFEIKENGQIIK 608

Query: 283 VLMRQKRMDK 292
            +++ +++  
Sbjct: 609 HIVKDEKIPS 618



 Score = 70.0 bits (169), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 34/274 (12%), Positives = 80/274 (29%), Gaps = 22/274 (8%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +   +   E    +  G  + I    + K    + +      KV    + G   +  
Sbjct: 172 PNGVRIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNLSVAANLTKVQAIAYRGTDTVQN 231

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA 155
           +   +          K  +   V    AG +++  + + G   V     F +++  N   
Sbjct: 232 ATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGENGE--VLAGAVFEVFNANNESV 284

Query: 156 LLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIVS---TVVKVEPGKIIDVTIQNRAAKI 211
             IT        +  L    Y +         +       ++V+ G+   V I N   K 
Sbjct: 285 GKITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVNNKVKG 344

Query: 212 TFKLVS-EMGGEAVADTAWSILTASG----DTVGESANASPSMVLSEGDYTVIARNKERN 266
             ++      G+ + +  +++ T  G      V +    +    L+ G Y  +       
Sbjct: 345 NIEIKKLSDSGKVLPNVEFTVFTEDGKEVQKVVTKENGIANVEGLTYGKYYFLETKTPNG 404

Query: 267 Y-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
           Y        F +    +  +   +    +  + +
Sbjct: 405 YIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 437


>gi|229153520|ref|ZP_04281698.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus m1550]
 gi|228630124|gb|EEK86775.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus m1550]
          Length = 3216

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 46/325 (14%), Positives = 98/325 (30%), Gaps = 33/325 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+     T +   + KG+ K        +         ++ +   +   G  +
Sbjct: 2812 FIETKAPEHYDLNDTPIKFTVKKGQEKIASVTATNSLTKGAVELTKVDDIDCTTLEGAIF 2871

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I D +  K      T    G     DL PGDY    +     +       K T+   + 
Sbjct: 2872 KIVDMV-GKDVRSDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPIKFTIEKSQT 2930

Query: 114  NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
             +  V   N    G + L  +    G+ +          +  + +  L TDK    ++  
Sbjct: 2931 AKASVTATNSLTKGAVELIKVDDIDGTTLKGAIFKIVDMNGKDVRTDLTTDKDGKISVSN 2990

Query: 170  LGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGGE 222
            L   +YQ                +   +     ++  VT         I    V      
Sbjct: 2991 LRPGDYQFIETKAPTGYDLNVKPIPFTITKGQSQVTSVTALNSLTTGSIELTKVDIDHHG 3050

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FS 272
             +    ++IL   G  +      +         L  G Y ++     + Y  +     F+
Sbjct: 3051 TLEGAIFNILDQDGKVIREGLKTDQHGKVIVNDLKPGTYQLVETKAPKGYQLDASPINFT 3110

Query: 273  VLTGKSTIVEVLMRQKRMDKNGQHN 297
            +   ++T +++ +  K+++ +   +
Sbjct: 3111 IDKAQATPLQITVSNKKIESSSGGD 3135



 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 40/310 (12%), Positives = 84/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1695 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1754

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1755 VRTDLVTNSKGILVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1814

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1815 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDHGVLVIPDLAPGDYQFI 1874

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++    +    +
Sbjct: 1875 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDIDSTTLEGAEF 1934

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1935 IIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 1994

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1995 KENITVTATN 2004



 Score =  119 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 50/318 (15%), Positives = 86/318 (27%), Gaps = 36/318 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I K + +++       +    +        N  +  S   
Sbjct: 2530 FVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELIKVDDINPDTKLSDAV 2589

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            ++I      K      T    G     DL PGDY    +               T+   +
Sbjct: 2590 FNII-DAKGKIVRSDLTTDKDGKISVSDLRPGDYQFIETKAPKDYDLNKTPIDFTIERSQ 2648

Query: 113  KNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
                 V   N    GG+ L  I       + +   F I     +     L+T+K      
Sbjct: 2649 LTHVSVTAKNGLTKGGVELTKIDSVDKKEMLEGAVFKITDMNGNDIRTNLVTNKDGKIIA 2708

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITF-KLVSEM 219
              L   +YQ        +  ++       +E  +   V +          +   K+    
Sbjct: 2709 KDLQPGDYQFIETKAPKHYDLNKEPIKFTIERSQTKHVFVTAINSLTKGSVELIKVDDTK 2768

Query: 220  GGEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE---- 270
                +    + I+   G     D   +         L  GDY  I      +Y       
Sbjct: 2769 QNTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNDTPI 2828

Query: 271  -FSVLTGKSTIVEVLMRQ 287
             F+V  G+  I  V    
Sbjct: 2829 KFTVKKGQEKIASVTATN 2846



 Score =  119 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 52/310 (16%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1601 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1659

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1660 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1719

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1720 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGILVVDDLRPGNYKL 1779

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1780 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1839

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1840 TLQDATGKEIMKDLTTDDHGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1899

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1900 DLPIPVTVKN 1909



 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 48/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +  ++   G 
Sbjct: 1873 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDIDSTTLEGA 1932

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1933 EFIIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 1992

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1993 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2052

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2053 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTSKNALKNGSVELTKIDDI 2112

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2113 DMNTKLANAVFNLLDADGELVEEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2172

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2173 IVFTIKKSQTETLHVTATN 2191



 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 98/319 (30%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K +        + +        +++ +   +   G
Sbjct: 2341 TYQFVEITAPEHYDLDKKPIIFAIEKSQKDIATVTMKNSLTKGGVELSKVDDVDGTTLEG 2400

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              + I   ++             G     DL PGDY    +     +         T++ 
Sbjct: 2401 AVFKIV-DMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYDLNKEPIPFTITK 2459

Query: 111  KEKNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             + +   V   N    G + L  +    G+ + D     +  +  + +  L TD     +
Sbjct: 2460 SQADPISVTATNSLTKGAVELSKVDDVDGTALKDAIFKITDMNGNDIRTELTTDVHGKIS 2519

Query: 167  LVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG- 220
            +  L   +YQ        +       +   +K    + + VT  N   +   +L+     
Sbjct: 2520 VSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELIKVDDI 2579

Query: 221  --GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 ++D  ++I+ A G  V      +         L  GDY  I     ++Y      
Sbjct: 2580 NPDTKLSDAVFNIIDAKGKIVRSDLTTDKDGKISVSDLRPGDYQFIETKAPKDYDLNKTP 2639

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             +F++   + T V V  + 
Sbjct: 2640 IDFTIERSQLTHVSVTAKN 2658



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/312 (10%), Positives = 85/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1127 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1185

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1186 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1245

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1246 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNDQGQITVDNLKPGTYYLQ 1305

Query: 179  SHYGKYNAIVSTV---VKVEPGKIIDVT----IQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  + +      ++  +   +                   +  G+ +A   +S+
Sbjct: 1306 ETTAPEHYKLDSTPIQFTIKEDQTTVINRTAINSLIPGSAILTKFDKD-GKTLAGAEFSV 1364

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                   +               +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1365 RDRYNKVIRGYEKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKKPIEFTIIKSQKK 1424

Query: 280  IVEVLMRQKRMD 291
             V V      + 
Sbjct: 1425 AVTVTATNHLIK 1436



 Score =  109 bits (272), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 43/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++       +   I K + K V                ++ +   +   G  +
Sbjct: 1398 FVEEKAPKDYDIDKKPIEFTIIKSQKKAVTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1457

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1458 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGVYKFIETEAPKDYTLSTNPIEFTIDKSQ 1517

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1518 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1577

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1578 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1637

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1638 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1697

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1698 KPIKFTITESQTTQATVTAKN 1718



 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 42/298 (14%), Positives = 84/298 (28%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T             K  +    +        +  +  +   +++ D+   +         
Sbjct: 2082 TIERSQTKEINVTSKNALKNGSVELTKIDDIDMNTKLANAVFNLLDAD-GELVEEGLKTN 2140

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +         T+   +     V   NA   G    
Sbjct: 2141 DEGKIVVENLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHVTATNALTKGAVKL 2200

Query: 130  SIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S        V  +  F I +         L+T++     +  L   +YQ        + +
Sbjct: 2201 SKVDDVDGTVLKDAVFKIVNMNGDVVHKNLVTNEQGIIEINDLRPGDYQFIETKAPKHYV 2260

Query: 188  VSTV---VKVEPGKIIDV----TIQNRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+  D+    T   +   I   K+        +AD  +++L   G  +
Sbjct: 2261 LDETPIKFTIEKGQKKDISLTATNSLKQGSIELLKVDDLNTQTKLADAVFNLLDQDGKVL 2320

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   S        L  G Y  +      +Y  +     F++   +  I  V M+ 
Sbjct: 2321 KTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFAIEKSQKDIATVTMKN 2378


>gi|163941049|ref|YP_001645933.1| cell wall anchor domain-containing protein [Bacillus
           weihenstephanensis KBAB4]
 gi|163863246|gb|ABY44305.1| LPXTG-motif cell wall anchor domain [Bacillus weihenstephanensis
           KBAB4]
          Length = 1093

 Score =  138 bits (348), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 41/279 (14%), Positives = 87/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  I +G  + +F++ +
Sbjct: 253 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEILAGAVFEVFNANN 312

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    QV  
Sbjct: 313 ESVGK--ITTGADGTAELNNLPIGTYTVKEIKAPTGYVSGDKPQTIEVKTGEIGAVQVVN 370

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR-LGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 371 NKVKGNIEIKKLSDSGKMLPN-VEFTVFTEDGKEVKKVVTKENGIANVDGLTYGKYYFLE 429

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 430 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 489

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 490 DASGKVIGEYKTDKNGEVNVKDLAYGKYSFVEKASPNGY 528



 Score = 70.3 bits (170), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 35/296 (11%), Positives = 82/296 (27%), Gaps = 26/296 (8%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDS----GVSWHIFDSISNKKNTLST 73
           + L     +   G   V A+      ++   +  +      G  + I      K    + 
Sbjct: 181 TNLYTVQTNAKSGSYKVVAKNAPNGVKIVSENGEVKDQLSLGEKFRIQIPKDTKTGEFNL 240

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYK 133
           +      KV    + G   +            +  + ++ +        A G        
Sbjct: 241 SVAANLTKVQAIAYRGTDTVQ------NATVLLERNEEKLSSDLAVNWEAAGSLKIKKVG 294

Query: 134 PGSPIVDDELTFSIYSNPNHKALLITDK-VRSGTLVRLGTNNYQITSHYGKYNAIV---S 189
               I      F +++  N     IT     +  L  L    Y +         +     
Sbjct: 295 ENGEI-LAGAVFEVFNANNESVGKITTGADGTAELNNLPIGTYTVKEIKAPTGYVSGDKP 353

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASG----DTVGESAN 244
             ++V+ G+I  V + N   K   ++      G+ + +  +++ T  G      V +   
Sbjct: 354 QTIEVKTGEIGAVQVVNNKVKGNIEIKKLSDSGKMLPNVEFTVFTEDGKEVKKVVTKENG 413

Query: 245 ASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            +    L+ G Y  +       Y        F +    +  +   +    +  + +
Sbjct: 414 IANVDGLTYGKYYFLETKTPNGYIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 468



 Score = 64.6 bits (155), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 41/287 (14%), Positives = 81/287 (28%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 445 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAVFELKDASGKV 495

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV---VKKITVSSKEKNQKQ----VFI 120
                      G     DL  G Y         G     + I    KE  +      V  
Sbjct: 496 IGEYK--TDKNGEVNVKDLAYGKYSFVEKASPNGYVLITEPIVFEIKEHGKIIELLAVNH 553

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 554 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 613

Query: 180 HYGKYNAIVSTVV----KVEPGKIIDVTIQNRA-AKITFKLVSEMGGEAVADTAWSILTA 234
                  +++  +      E G+II   +++     +      +  G     T+ S+   
Sbjct: 614 TVAPKGYVLNEEIFSFEIKENGQIIKHIVKDEKIPSVKTTATDKTDGTKEMHTSKSVTIQ 673

Query: 235 SGDTVGESANASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
                           L  G +YT+  +  ++  ++   V   + T 
Sbjct: 674 D---------KVEYKDLQVGKEYTLKGKLMDKETNKPLVVNGKEVTA 711


>gi|228975438|ref|ZP_04135993.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            serovar thuringiensis str. T01001]
 gi|228982071|ref|ZP_04142363.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            Bt407]
 gi|228777609|gb|EEM25884.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            Bt407]
 gi|228784232|gb|EEM32256.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            serovar thuringiensis str. T01001]
          Length = 3242

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 48/326 (14%), Positives = 93/326 (28%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+     T +   + KG+ K         +    +        + T+   G  
Sbjct: 2838 FIETKAPEHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELTKVDNIDGTT-LEGAI 2896

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I D    K      T    G     DL PGDY    +     +       K TV   +
Sbjct: 2897 FKIVDMD-GKDIRSDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPIKFTVEKSQ 2955

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
              +  V   N    G    +              F I         + L TDK    ++ 
Sbjct: 2956 TAKASVTATNSLTKGAVELTKVDDIDGTTLAGAIFKIVDMNGKDVHSDLTTDKDGKISVS 3015

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         I    V     
Sbjct: 3016 DLRPGDYQFIETKAPTGYDLNIKPIPFTITKGQSQVTSVTALNSLTTGAIELTKVDIDHH 3075

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 3076 GTLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETQAPKGYQLDASPINF 3135

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++T +++ +  K+++ +   +
Sbjct: 3136 TIDKAQATPLQITVSNKKIESSSGGD 3161



 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/298 (14%), Positives = 83/298 (27%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T        +    K  +    +      + +   +  G  + I   ++      +    
Sbjct: 2669 TIERSQLTHASVTAKNGLTKGGVELTKVDSIDKKEMLEGAVFKI-TDLNGNDIRTNLVTN 2727

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRL 128
              G  ++ DL PGDY    +             K T+   +     V  +N    G + L
Sbjct: 2728 KDGKIIAKDLQPGDYQFIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTKGSVEL 2787

Query: 129  YSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
              +         +   F I +   H     L TDK     +  L   +Y+        + 
Sbjct: 2788 IKVDDAKQNTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHY 2847

Query: 187  IVSTV---VKVEPGK----IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
             ++       V+ G+     +  T       +    V  + G  +    + I+   G  +
Sbjct: 2848 DLNETPIKFTVKKGQEKIASVTATNSLTKGAVELTKVDNIDGTTLEGAIFKIVDMDGKDI 2907

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                  +         L  GDY  I     ++Y        F+V   ++    V    
Sbjct: 2908 RSDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPIKFTVEKSQTAKASVTATN 2965



 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1721 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1780

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1781 VRTDLVTNSKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1840

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1841 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFI 1900

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1901 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1960

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1961 IIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 2020

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 2021 KENITVTATN 2030



 Score =  123 bits (309), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 44/316 (13%), Positives = 94/316 (29%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++   +   +   I K + + +      + +       ++ +   ++  G  +
Sbjct: 1996 FIEVKAPKDYTLSKDPIPFTIEKSQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIF 2055

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++ K+   +      G     DL PGDY    +     +         T+   + 
Sbjct: 2056 KIV-DMNGKEVHTNLVTDKNGKISVSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQT 2114

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
             +  V   NA   G + L  I             F++           L T+      + 
Sbjct: 2115 KEINVTGKNALKKGSVELTKIDDIDITTKLANAVFNLLDADGELVKEGLKTNDEGKIVVE 2174

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQN--RAAKITFKLVSEMGG 221
             L    YQ        +       +   +K    + + +T  N      +    V ++ G
Sbjct: 2175 NLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHITATNALTKGAVKLSKVDDVDG 2234

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              + D  + I+  +GD V                L  GDY  I     ++Y  +     F
Sbjct: 2235 TVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKF 2294

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++  G+   + +    
Sbjct: 2295 TIEKGQKKAISLTATN 2310



 Score =  119 bits (297), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 93/316 (29%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I KG+ K +       +    I        N+ +  +   
Sbjct: 2276 FIETKAPKHYVLDETPIKFTIEKGQKKAISLTATNSLKQGSIELLKVDDLNTQTKLADAV 2335

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA-----SFGHVGVVKKITVSSKE 112
            +++ D    K           G  V  +L PG Y          +         T+   +
Sbjct: 2336 FNLLDQD-GKVLKTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIKKSQ 2394

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
            K+   V + N    G    S          +   F I +         L+T++    ++ 
Sbjct: 2395 KDIATVTMKNSLTKGGVELSKVNDVDGTTLEGAVFKIVNMNGTVIRKNLVTNQQGKISVS 2454

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  +S       +   +   +++          +    V ++ G
Sbjct: 2455 DLRPGDYQFIETTAPKHYDLSKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDG 2514

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+ D  + I   +G+ +      +         L  GDY  +      +Y  +     F
Sbjct: 2515 TALKDAVFKITDLNGNEIRTELTTDVHGKISVSDLRPGDYQFVETKAPEHYKLDSTPIKF 2574

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   +   ++V    
Sbjct: 2575 TIKKSQKEKLQVTATN 2590



 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 51/310 (16%), Positives = 101/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            + E +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1627 REEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1685

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1686 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1745

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1746 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYKL 1805

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1806 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1865

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1866 TLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1925

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1926 DLPIPVTVKN 1935



 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 45/315 (14%), Positives = 94/315 (29%), Gaps = 35/315 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++   +   +   I+K +   +      +        +++ +   +      +
Sbjct: 2463 FIETTAPKHYDLSKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDGTALKDAVF 2522

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++  +     T  + G     DL PGDY    +             K T+   +K
Sbjct: 2523 KI-TDLNGNEIRTELTTDVHGKISVSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQK 2581

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    T  
Sbjct: 2582 EKLQVTATNSLTEGAVELIKVDDINPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITAT 2641

Query: 169  RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  ++   ++          +    V     
Sbjct: 2642 NLRPGDYQFIETKAPKHYDLNKTPISFTIERSQLTHASVTAKNGLTKGGVELTKVDSIDK 2701

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2702 KEMLEGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEEPIK 2761

Query: 271  FSVLTGKSTIVEVLM 285
            F++   ++  V V  
Sbjct: 2762 FTIERSQTKHVFVTA 2776



 Score =  116 bits (289), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 94/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1899 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1958

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1959 EFIIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 2018

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 2019 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2078

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2079 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKKGSVELTKIDDI 2138

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2139 DITTKLANAVFNLLDADGELVKEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2198

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + +    
Sbjct: 2199 IVFTIKKSQTETLHITATN 2217



 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/312 (10%), Positives = 85/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1153 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1211

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1212 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1271

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1272 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNDQGQITVDNLKPGTYYLQ 1331

Query: 179  SHYGKYNAIVSTV---VKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  + +      ++  +        T              +  G+ +A   +S+
Sbjct: 1332 ETTAPEHYKLDSTPIQFTIKEDQTTVINRTATNSLIPGSAILTKFDKD-GKTLAGAEFSV 1390

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                   +               +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1391 RDRYNKVIRGYEKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKKPIEFTIIKSQKK 1450

Query: 280  IVEVLMRQKRMD 291
             + V      + 
Sbjct: 1451 ALTVTATNHLIK 1462



 Score =  110 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++       +   I K + K +                ++ +   +   G  +
Sbjct: 1424 FVEEKAPKDYDIDKKPIEFTIIKSQKKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1483

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1484 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGAYKFIETEAPKDYTLSTNPIEFTIDKSQ 1543

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1544 QTLATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1603

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1604 KVSNLRPGTYKFIEIAAPEHYVLREEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1663

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1664 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1723

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1724 KPIKFTITESQTTQATVTAKN 1744


>gi|229170066|ref|ZP_04297757.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus AH621]
 gi|228613413|gb|EEK70547.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus AH621]
          Length = 3049

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 44/326 (13%), Positives = 90/326 (27%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVV-------DAQRITCEARLTENSTSIDSGVS 57
            F      ++       +   I + + K V            +           +   G  
Sbjct: 2615 FVETKAPKHYDLNEEPIKFTIERSQTKHVYVTATNSLTKGSVELIKVDDVEENTTLEGAV 2674

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +           T    G  V  +L PGDY    +     +       K TV   +
Sbjct: 2675 FKIVNKD-GHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPNHYDLNETPIKFTVKKGQ 2733

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
            +    V   N    G    S        V     F I     H     L T+K    ++ 
Sbjct: 2734 EKIASVTAKNSLTKGAVELSKVDDVDGSVLKGAVFKIVDMNGHDVRSDLTTNKDGKISVS 2793

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ           +S       +  G+    +++         I    V     
Sbjct: 2794 DLRPGDYQFVETKAPTGYDLSAKPIPFTITKGQSGVTSVKALNSLTTGSIELTKVDIDHR 2853

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++       Y  +     F
Sbjct: 2854 GTLEGAIFNILDHDGKIIREGLKTDQHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 2913

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++  +++ +  K+++ +   +
Sbjct: 2914 TIEKAQAAPLQITVSNKKIESSPGED 2939



 Score =  130 bits (326), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 45/316 (14%), Positives = 96/316 (30%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +N  I KG+ K +       +    I        N  +  +   
Sbjct: 2241 FIETEAPKHYVLDETPINFTIEKGQKKTISLTAKNSLKQGSIELIKVDDLNDQTKLADAV 2300

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  +  +L PG Y    +     +        +TV   +
Sbjct: 2301 FNLLDQ-NGKVLKTDLKTNSEGKIIVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQ 2359

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
            K+   V + N    G    +          +   F+I           L T+     ++ 
Sbjct: 2360 KDIATVTMKNSLTKGGVELTKVDDVDGTTLEGAVFNIVDMNGTVIRKNLTTNSQGKISVS 2419

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    V ++ G
Sbjct: 2420 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDG 2479

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    + I+  +G+ V      ++        L  GDY  I      +Y        F
Sbjct: 2480 TVLKGAVFKIVDMNGNDVRTDLTTDAYGKVAVPDLRPGDYQFIETKAPEHYKLNDTPIKF 2539

Query: 272  SVLTGKSTIVEVLMRQ 287
            +V   ++  ++V    
Sbjct: 2540 TVKKSQTEQLQVTATN 2555



 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 48/317 (15%), Positives = 91/317 (28%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I KG+ + +    + +        +++ +   ++  G  +
Sbjct: 2428 FIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKVDDIDGTVLKGAVF 2487

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +             K TV   + 
Sbjct: 2488 KIV-DMNGNDVRTDLTTDAYGKVAVPDLRPGDYQFIETKAPEHYKLNDTPIKFTVKKSQT 2546

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             Q QV   N+   G + L  +             F+I        +  L T++    +  
Sbjct: 2547 EQLQVTATNSLTEGAVELIKVDDVNPDTKLSGAVFNIVDANGKIVRTDLTTNQEGKISFS 2606

Query: 169  RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDV----TIQNRAAKITF-KLVSEMG 220
             L   +YQ        +  ++       +E  +   V    T       +   K+     
Sbjct: 2607 NLRPGDYQFVETKAPKHYDLNEEPIKFTIERSQTKHVYVTATNSLTKGSVELIKVDDVEE 2666

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
               +    + I+   G     D   +         L  GDY  I      +Y        
Sbjct: 2667 NTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPNHYDLNETPIK 2726

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F+V  G+  I  V  + 
Sbjct: 2727 FTVKKGQEKIASVTAKN 2743



 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/310 (14%), Positives = 87/310 (28%), Gaps = 37/310 (11%)

Query: 15   HTTSTLLNNNISKGKGKRVVDA------QRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
            +TT        S+G     V A        I        +      G  + I +  +N+ 
Sbjct: 1686 NTTPIEFTIKESQGTSPITVTAKNGLTKGGIELTKVNAADEKETLEGAVFKIVNMDTNED 1745

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1746 VRADLVTNSKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1805

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S I      F +      +    L TD      +  L   +YQ  
Sbjct: 1806 LTKGKVKLIKEDDVDSKIALAGAVFKLQDANGTEIAKDLKTDDYGVLVIPDLAPGDYQFI 1865

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1866 ETEAPAHYKLDQTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1925

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y        F+++  +
Sbjct: 1926 IIVDAHDTKKVIRKGLTTDENGIVTASDLRPGDYQFIEIKAPKDYDLSKDPIPFTIVKSQ 1985

Query: 278  STIVEVLMRQ 287
               + V  + 
Sbjct: 1986 KENITVTAKN 1995



 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 94/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F       +     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1864 FIETEAPAHYKLDQTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1923

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA-----SFGHVGVVKKITVSS 110
             + I D+  + K      T    G   + DL PGDY          +         T+  
Sbjct: 1924 EFIIVDAHDTKKVIRKGLTTDENGIVTASDLRPGDYQFIEIKAPKDYDLSKDPIPFTIVK 1983

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        +     F I           L+TD     +
Sbjct: 1984 SQKENITVTAKNSLTKGAVTLTKIDDIDRTMLKGAIFKIVDMDGKEVHTNLVTDDNGEIS 2043

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++T+          +    + + 
Sbjct: 2044 VSDLRPGDYQFIETKAPEHYVLDETPIPFTIERSQTKEITVTGKNTLTKGSVELTKIDDI 2103

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 +A+  +++L A G+ V                L  G Y  +      +Y      
Sbjct: 2104 DIDTKLANAVFNLLDADGELVEEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLNKTP 2163

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
             EF++   ++ I+ V  + 
Sbjct: 2164 IEFTIKKSQTEILHVTAKN 2182



 Score =  113 bits (283), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/298 (13%), Positives = 86/298 (28%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        +  +  +   +++ D+   +         
Sbjct: 2073 TIERSQTKEITVTGKNTLTKGSVELTKIDDIDIDTKLANAVFNLLDAD-GELVEEGLKTN 2131

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +       + T+   +     V   NA   G    
Sbjct: 2132 DEGKIVVENLRPGTYQFVETIAPEHYDLNKTPIEFTIKKSQTEILHVTAKNALTKGAVEL 2191

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA- 186
            S          +   F+I           L+T+      +  L   +YQ        +  
Sbjct: 2192 SKVDNIDDTTLEGAVFNIVDMNGTVIHKDLVTNGKGKIEINDLRPGDYQFIETEAPKHYV 2251

Query: 187  ----IVSTVVKVEPGKIIDVTIQNRAAKIT---FKLVSEMGGEAVADTAWSILTASGDTV 239
                 ++  ++    K I +T +N   + +    K+        +AD  +++L  +G  +
Sbjct: 2252 LDETPINFTIEKGQKKTISLTAKNSLKQGSIELIKVDDLNDQTKLADAVFNLLDQNGKVL 2311

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   S        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2312 KTDLKTNSEGKIIVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKDIATVTMKN 2369



 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 44/294 (14%), Positives = 89/294 (30%), Gaps = 32/294 (10%)

Query: 25   ISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN-TLSTTKKIIGGKVS 83
             +       +    +T       + ++   G  + I D+  +KK    +      G    
Sbjct: 1417 AATVTATNHLIKGGVTLTKVDDIDGSA-LEGAVFKIVDANDDKKVIRENLKTSSDGKVTV 1475

Query: 84   FDLFPGDYLISASFGHVGV---VKKITVSSKEKNQKQVFIL-----NAGGIRLYSIYKPG 135
             DL PG Y    +            I  +  +     V +        G + L  + + G
Sbjct: 1476 KDLEPGTYKFIETSAPKDYVLNTTPIEFTIDKSQSAFVTVTAKNSLKTGEVELLKVDEFG 1535

Query: 136  SPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST--- 190
                     F I    N++    L TD        +L    YQ        +  + T   
Sbjct: 1536 EKKPLKGAVFKIVDANNNEVRTDLTTDANGKLKADKLRPGTYQFIETQAPEHYNLRTKSI 1595

Query: 191  VVKVEPGKIIDVTI----QNRAAKITFKLVSEMGGEAVADTAWSILTASGDT-------V 239
              K++  +   + +      +   +    V ++ G A+    + I+ A+ D         
Sbjct: 1596 EFKIDRSQKEPILVTAENTLKPGDVELTKVDDIDGTALEGAVFKIVDANDDKKVIRTDLK 1655

Query: 240  GESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK-STIVEVLMRQ 287
              S     +  L  GDY  I     + Y +     EF++   + ++ + V  + 
Sbjct: 1656 TGSDGKVVATGLRPGDYKFIEVTAPKYYDKNTTPIEFTIKESQGTSPITVTAKN 1709



 Score =  106 bits (264), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 33/284 (11%), Positives = 73/284 (25%), Gaps = 33/284 (11%)

Query: 39   ITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFG 98
            +       ++     +G  + ++D           T    G     +L    YLI  +  
Sbjct: 1147 LQIIKVDDKDKKVPLAGAEFTLYDQT-GTTAIRPITTGDDGVAKFNNLRRDKYLIKETKA 1205

Query: 99   HVGVVKK--------ITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSN 150
              G V          + + SKE     +      G  + +     S    +   FS+   
Sbjct: 1206 PKGYVISKELKEGILVELGSKEITTYTLTNKKFVGKVVLTKTDAHSREKLEHAVFSLLDQ 1265

Query: 151  P----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKII--- 200
                      L T+     T+  L    Y +       +  + +      ++  +     
Sbjct: 1266 NKQVIPEHKKLTTNDKGQITVDNLKPGTYYLQETTAPEHYTLDSKPITFTIKEDQTTVVN 1325

Query: 201  -DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV-------GESANASPSMVLS 252
               T            V +  G+ +A   +S+   +   +               +  L 
Sbjct: 1326 RTATNSLIPGSAILTKVDKD-GKTLAGAEFSVRDRNNTKIPGYEKLTTNDQGQIEAKDLR 1384

Query: 253  EGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
             G Y  +      +Y+ +     F +   +     V      + 
Sbjct: 1385 PGKYQFVEEKAPEHYTLDKTPILFEIEKSQKKAATVTATNHLIK 1428


>gi|30023388|ref|NP_835019.1| collagen adhesion protein [Bacillus cereus ATCC 14579]
 gi|29898949|gb|AAP12220.1| Collagen adhesion protein [Bacillus cereus ATCC 14579]
          Length = 2000

 Score =  138 bits (348), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 43/326 (13%), Positives = 94/326 (28%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGK-------RVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++       +   I + + K         +    +           +   G  
Sbjct: 1595 FIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTEGSVELIKVDDAKQNTTLEGAV 1654

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +           T    G  V  +L PGDY    +     +       K TV   +
Sbjct: 1655 FKIVNKD-GHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPIKFTVKKGQ 1713

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            +    V   N    G + L  +    G+ +             + ++ L TDK    ++ 
Sbjct: 1714 EKIASVTATNSLTKGAVELTKVDDIDGTTLEGAIFKIVDMDGKDVRSDLTTDKDGKISVS 1773

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     +I  VT         I    V     
Sbjct: 1774 DLRPGDYQFIETKAPTGYDLNIKPIPFTITKGQSQITSVTALNSLTTGSIELTKVDIDHH 1833

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 1834 GTLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETQAPKGYQLDASPINF 1893

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++T +++ +  K+++ +   +
Sbjct: 1894 TIDKAQATPLQITVSNKKIESSSGGD 1919



 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9   AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
              + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 572 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 631

Query: 69  NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                     G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 632 VRTDLVTNSKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 691

Query: 123 --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
              G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 692 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFI 751

Query: 179 SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                 +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 752 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTILEGAEF 811

Query: 230 SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
            I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 812 IIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 871

Query: 278 STIVEVLMRQ 287
              + V    
Sbjct: 872 KENITVTATN 881



 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +I  G 
Sbjct: 750  FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTILEGA 809

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 810  EFIIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 869

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 870  SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 929

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 930  VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKNGSVELTKIDDI 989

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 990  DINTKLANAVFNLLDADGELVKEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKRP 1049

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 1050 IVFTIKKSQTETLHVTATN 1068



 Score =  120 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 48/318 (15%), Positives = 88/318 (27%), Gaps = 36/318 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I K + +++       +    +        N  +  S   
Sbjct: 1407 FVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELVKVDDINPDTKLSDAV 1466

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            ++I      K      T    G   + +L PGDY    +               T+   +
Sbjct: 1467 FNII-DAKGKIVRTDLTTDKDGKITATNLRPGDYQFIETKAPKDYDLNKTPISFTIERSQ 1525

Query: 113  KNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                 V   N    GG+ L  +       + +   F I      + +  L+T+K      
Sbjct: 1526 LTHASVTAKNGLTKGGVELTKVDSIDKKEMLEGAVFKITDLNGNDIRTNLVTNKDGKIIA 1585

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ-----NRAAKITFKLVSEM 219
              L   +YQ        +  ++       +E  +   V +         +    K+    
Sbjct: 1586 KDLQPGDYQFIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTEGSVELIKVDDAK 1645

Query: 220  GGEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE---- 270
                +    + I+   G     D   +         L  GDY  I      +Y       
Sbjct: 1646 QNTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPI 1705

Query: 271  -FSVLTGKSTIVEVLMRQ 287
             F+V  G+  I  V    
Sbjct: 1706 KFTVKKGQEKIASVTATN 1723



 Score =  120 bits (299), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 52/310 (16%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10  KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
           +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 478 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 536

Query: 70  -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
              +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 537 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 596

Query: 123 --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
              GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 597 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYKL 656

Query: 178 TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                          +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 657 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 716

Query: 230 SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
           ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 717 TLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 776

Query: 280 IVEVLMRQKR 289
            + + +  K 
Sbjct: 777 DLPIPVTVKN 786



 Score =  115 bits (287), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 98/319 (30%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K +        + +        +++ +   +   G
Sbjct: 1218 TYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDDVDGTTLEG 1277

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              + I   ++      +      G     DL PGDY    +     +         T++ 
Sbjct: 1278 AVFKIV-DMNGTVIRKNLVTNQQGKISVSDLRPGDYQFIETTAPKHYDLNKEPIPFTITK 1336

Query: 111  KEKNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             + +   V   N    G + L  +    G+ + D     +  +  + +  L TD     +
Sbjct: 1337 SQADPISVTATNSLTKGAVELSKVDDVDGTALKDAVFKITDLNGNDIRTELTTDVHGKIS 1396

Query: 167  LVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG- 220
            +  L   +YQ        +       +   +K    + + VT  N   +   +LV     
Sbjct: 1397 VSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELVKVDDI 1456

Query: 221  --GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 ++D  ++I+ A G  V      +      +  L  GDY  I     ++Y      
Sbjct: 1457 NPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITATNLRPGDYQFIETKAPKDYDLNKTP 1516

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   + T   V  + 
Sbjct: 1517 ISFTIERSQLTHASVTAKN 1535



 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/314 (11%), Positives = 84/314 (26%), Gaps = 33/314 (10%)

Query: 9   AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
              E       ++  +   G G        +  +     +   I SGV + +F   +   
Sbjct: 2   KLTETEKIEEIVVKVSSGSGGGSATKGRGNLQIKKVDNADPNKILSGVVFTLF-DRTGTT 60

Query: 69  NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFI 120
              + T    G     +L   +YL+       G V          + + ++E     +  
Sbjct: 61  AIRTITTDKNGIAQFNNLKRDEYLLREMKTLDGYVISKELKAGKLVKLGAEETTTYTLKN 120

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA----LLITDKVRSGTLVRLGTNNYQ 176
               G  + +     +        FS+    ++       LIT+     T+  L    Y 
Sbjct: 121 EKFVGKVVLTKTDAHNKEKLKNAVFSLLDQNHNVIPEHKELITNDKGQITVDNLKPGTYY 180

Query: 177 ITSHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAW 229
           +       +  +        +E  +      +         +    V +  G  +    +
Sbjct: 181 LKEIKAPEHYQLDDRLIEFTIEEDQTTVINKEAQNNLIRGSVILTKVDKE-GNTLEGAVF 239

Query: 230 SILTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGK 277
           S+   +   +               +  L  G+Y  +      +Y  +     F+V   +
Sbjct: 240 SVRDRNNKRIPGYTKLTTNGNGQIEAKNLLPGEYQFVEEKAPEHYEIDKKPLKFTVEKSQ 299

Query: 278 STIVEVLMRQKRMD 291
              + V      + 
Sbjct: 300 QKALTVTATNHLIK 313



 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/298 (13%), Positives = 83/298 (27%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        +  +  +   +++ D+   +         
Sbjct: 959  TIERSQTKEINVTGKNALKNGSVELTKIDDIDINTKLANAVFNLLDAD-GELVKEGLKTN 1017

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +         T+   +     V   N    G    
Sbjct: 1018 DEGKIVVENLRPGTYQFVETIAPEHYDLDKRPIVFTIKKSQTETLHVTATNTLTKGAVKL 1077

Query: 130  SIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S        V  +  F I +         L+T++     +  L   +YQ        + +
Sbjct: 1078 SKVDDVDGTVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYV 1137

Query: 188  VSTV---VKVEPGK----IIDVTIQNRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+     +  T   +   I   K+        +AD  +++L   G  +
Sbjct: 1138 LDETPIKFTIEKGQKKAISLTATNSLKQGSIELLKVDDLNTQTKLADAVFNLLDQDGKVL 1197

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   S        L  G Y  +      +Y  +     F++   +  I  V M+ 
Sbjct: 1198 KTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKN 1255



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
           F      E+       L   + K + K +                ++ +   +   G  +
Sbjct: 275 FVEEKAPEHYEIDKKPLKFTVEKSQQKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 334

Query: 59  HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
            I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 335 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGAYKFIETEAPKDYTLSTNPIEFTIDKSQ 394

Query: 113 KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
           +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 395 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 454

Query: 166 TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
            +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 455 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 514

Query: 219 MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
           + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 515 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 574

Query: 271 ----FSVLTGKSTIVEVLMRQ 287
               F++   ++T   V  + 
Sbjct: 575 KPIKFTITESQTTQATVTAKN 595


>gi|229071021|ref|ZP_04204247.1| hypothetical protein bcere0025_31940 [Bacillus cereus F65185]
 gi|229080728|ref|ZP_04213246.1| hypothetical protein bcere0023_33720 [Bacillus cereus Rock4-2]
 gi|228702462|gb|EEL54930.1| hypothetical protein bcere0023_33720 [Bacillus cereus Rock4-2]
 gi|228711961|gb|EEL63910.1| hypothetical protein bcere0025_31940 [Bacillus cereus F65185]
          Length = 1062

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 89/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 222 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNANN 281

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 282 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPPGYVSDDKPQTIEVKTGETGAVQIVN 339

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 340 NKVKGNIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIANVEDLTYGKYYFLE 398

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K ++ T++N   K + KL+        + +   A+ + 
Sbjct: 399 TKTPNGYIGNKTKYPFEIKEHNKTLNFTVENTEVKGSVKLLKVDNEDISKKLEGAAFELK 458

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  V     +         L+ G Y+ + +     Y
Sbjct: 459 DASGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 497



 Score = 71.1 bits (172), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 34/274 (12%), Positives = 80/274 (29%), Gaps = 22/274 (8%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +   +   E    +  G  + I    + K    + +      KV    + G   +  
Sbjct: 172 PNGVRIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNLSVAANLTKVQAIAYRGTDTVQN 231

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA 155
           +   +          K  +   V    AG +++  + + G   V     F +++  N   
Sbjct: 232 ATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGENGE--VLAGAVFEVFNANNESV 284

Query: 156 LLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIVS---TVVKVEPGKIIDVTIQNRAAKI 211
             IT        +  L    Y +         +       ++V+ G+   V I N   K 
Sbjct: 285 GKITTGADGMAELNNLPIGTYTLKEIKAPPGYVSDDKPQTIEVKTGETGAVQIVNNKVKG 344

Query: 212 TFKLVS-EMGGEAVADTAWSILTASG----DTVGESANASPSMVLSEGDYTVIARNKERN 266
             ++      G+ + +  +++ T  G      V +    +    L+ G Y  +       
Sbjct: 345 NIEIKKLSDSGKILPNVEFTVFTEDGKEVKKVVTKENGIANVEDLTYGKYYFLETKTPNG 404

Query: 267 Y-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
           Y        F +    +  +   +    +  + +
Sbjct: 405 YIGNKTKYPFEIKE-HNKTLNFTVENTEVKGSVK 437



 Score = 62.3 bits (149), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 33/264 (12%), Positives = 71/264 (26%), Gaps = 21/264 (7%)

Query: 29  KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
             +       +       E+ +    G ++ + D+               G     DL  
Sbjct: 426 TVENTEVKGSVKLLKVDNEDISKKLEGAAFELKDASGKVVGEYK--TDKNGEINVKDLAY 483

Query: 89  GDYLISASFGHVGV-----VKKITVSSKEKNQKQ--VFILNAGGIRLYSIYKPGSPIVDD 141
           G Y         G           +    K  +   V  L  G + +  +          
Sbjct: 484 GKYSFVEKASPNGYVLVKEPILFEIKEHGKVIELLAVNHLIKGDLEITKVDVADGNNKLP 543

Query: 142 ELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPG 197
              F+IY+    + +   TD        +L    Y           +++      +++  
Sbjct: 544 NAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKETVAPKGYVLNEETFSFEIKEN 603

Query: 198 KIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSMVLSEG-DY 256
             I   I       + K  +        D    + T+   T+ +         L  G +Y
Sbjct: 604 GQIIKHIVKDEKIPSIKTTASDKK----DGTKEMHTSKSVTIQD---KVEFKDLQVGKEY 656

Query: 257 TVIARNKERNYSREFSVLTGKSTI 280
           T+  +  ++  ++ F V   + T 
Sbjct: 657 TLKGKLMDKKTNKPFVVNGKEVTA 680


>gi|229110947|ref|ZP_04240508.1| hypothetical protein bcere0018_31950 [Bacillus cereus Rock1-15]
 gi|228672528|gb|EEL27811.1| hypothetical protein bcere0018_31950 [Bacillus cereus Rock1-15]
          Length = 939

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 41/279 (14%), Positives = 86/279 (30%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F+  +
Sbjct: 222 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNVNN 281

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 282 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 339

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 340 NKVKGNIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLE 398

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 399 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 458

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  V     +         L+ G Y+ + +     Y
Sbjct: 459 DASGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 497



 Score = 68.8 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/274 (12%), Positives = 80/274 (29%), Gaps = 22/274 (8%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +   +   E    +  G  + I    + K    + +      KV    + G   +  
Sbjct: 172 PNGVRIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNLSVAANLTKVQAIAYRGTDTVQN 231

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA 155
           +   +          K  +   V    AG +++  + + G   V     F +++  N   
Sbjct: 232 ATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGENGE--VLAGAVFEVFNVNNESV 284

Query: 156 LLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIVS---TVVKVEPGKIIDVTIQNRAAKI 211
             IT        +  L    Y +         +       ++V+ G+   V I N   K 
Sbjct: 285 GKITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVNNKVKG 344

Query: 212 TFKLVS-EMGGEAVADTAWSILTASG----DTVGESANASPSMVLSEGDYTVIARNKERN 266
             ++      G+ + +  +++ T  G      V +    +    L+ G Y  +       
Sbjct: 345 NIEIKKLSDSGKILPNVEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLETKTPNG 404

Query: 267 Y-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
           Y        F +    +  +   +    +  + +
Sbjct: 405 YIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 437



 Score = 61.9 bits (148), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 43/287 (14%), Positives = 79/287 (27%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 414 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAVFELKDASGKV 464

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK-------KITVSSKEKNQKQVFI 120
                      G     DL  G Y         G V        +I    K      V  
Sbjct: 465 VGEYK--TDKNGEINVKDLAYGKYSFVEKASPNGYVLVKEPIMFEIKEHGKIIELLAVNH 522

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 523 LIKGDLEITKVDVADGNNKLQNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 582

Query: 180 HYGKYNAIVSTV----VKVEPGKIIDVTIQNRA-AKITFKLVSEMGGEAVADTAWSILTA 234
                  +++         E G+II   +++     I  K   +  G     T+ S+   
Sbjct: 583 TVAPKGYVLNEETFSFEIKENGQIIKHIVKDEKIPSIETKATDKTDGTKEMHTSKSVTIQ 642

Query: 235 SGDTVGESANASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
                           L  G +YT+  +   +  ++   V   + T 
Sbjct: 643 D---------KVEYKDLQVGKEYTLKGKLMNKETNKPLVVNGKEVTA 680


>gi|229147898|ref|ZP_04276239.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
            BDRD-ST24]
 gi|228635548|gb|EEK92037.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus
            BDRD-ST24]
          Length = 2216

 Score =  138 bits (348), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 43/326 (13%), Positives = 94/326 (28%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGK-------RVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++       +   I + + K         +    +           +   G  
Sbjct: 1811 FIETKAPKHYDLNEEPIKFTIERSQTKYVFVTAINSLTEGSVELIKVDDAKQNTTLEGAV 1870

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +           T    G  V  +L PGDY    +     +       K TV   +
Sbjct: 1871 FKIVNKD-GHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPIKFTVKKGQ 1929

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            +    V   N    G + L  +    G+ +             + ++ L TDK    ++ 
Sbjct: 1930 EKIASVTATNSLTKGAVELTKVDDIDGTTLEGAIFKIVDMDGKDVRSDLTTDKDGKISVS 1989

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     +I  VT         I    V     
Sbjct: 1990 DLRPGDYQFIETKAPTGYDLNIKPIPFTITKGQSQITSVTALNSLTTGSIELTKVDIDHH 2049

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 2050 GTLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETQAPKGYQLDASPINF 2109

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++T +++ +  K+++ +   +
Sbjct: 2110 TIDKAQATPLQITVSNKKIESSSGGD 2135



 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 42/310 (13%), Positives = 86/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 788  KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 847

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 848  VRTDLVTNSKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 907

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 908  LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFI 967

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 968  ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTILEGAEF 1027

Query: 230  SILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A         D   +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1028 IIVDAHDTKKVIRKDLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKEPIPFTIEKSQ 1087

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1088 KENITVTATN 1097



 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 97/316 (30%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I KG+ K +       +    I        N+ +  +   
Sbjct: 1343 FIETKAPKHYVLDETPIKFTIEKGQKKAISLTATNSLKQGSIELLKVDDLNTQTKLADAV 1402

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA-----SFGHVGVVKKITVSSKE 112
            +++ D    K           G  V  +L PG Y          +         T+   +
Sbjct: 1403 FNLLDQD-GKVLKTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQ 1461

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K+   V + N    GG+ L  +    G+ +          +    +  L+T++    ++ 
Sbjct: 1462 KDIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFKIVDMNGTVIRKNLVTNQQGKISVS 1521

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +   +   +++          +    V ++ G
Sbjct: 1522 DLRPGDYQFIETTAPKHYDLNKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDG 1581

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+ D  + I   +G+ +      +         L  GDY  I      +Y  +     F
Sbjct: 1582 TALKDAVFKITDLNGNDIRTELTTDVHGKISVSDLRPGDYQFIETKAPEHYKLDSTPIKF 1641

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   +   ++V    
Sbjct: 1642 TIKKSQKEKLQVTATN 1657



 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +I  G 
Sbjct: 966  FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTILEGA 1025

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1026 EFIIVDAHDTKKVIRKDLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKEPIPFTIEK 1085

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1086 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 1145

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 1146 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKNGSVELTKIDDI 1205

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 1206 DINTKLANAVFNLLDADGELVKEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKRP 1265

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 1266 IVFTIKKSQTETLHVTATN 1284



 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 52/310 (16%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 694  RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 752

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 753  IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 812

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 813  LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYKL 872

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 873  IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 932

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 933  TLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 992

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 993  DLPIPVTVKN 1002



 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 45/315 (14%), Positives = 92/315 (29%), Gaps = 35/315 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I+K +   +      +        +++ +   +      +
Sbjct: 1530 FIETTAPKHYDLNKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDGTALKDAVF 1589

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T  + G     DL PGDY    +             K T+   +K
Sbjct: 1590 KI-TDLNGNDIRTELTTDVHGKISVSDLRPGDYQFIETKAPEHYKLDSTPIKFTIKKSQK 1648

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    T  
Sbjct: 1649 EKLQVTATNSLTEGAVELVKVDDINPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITAT 1708

Query: 169  RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  ++   ++          +    V     
Sbjct: 1709 NLRPGDYQFIETKAPKDYDLNKTPISFTIERSQLTHASVTAKNGLTKGGVELTKVDSIDK 1768

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 1769 KEMLEGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEEPIK 1828

Query: 271  FSVLTGKSTIVEVLM 285
            F++   ++  V V  
Sbjct: 1829 FTIERSQTKYVFVTA 1843



 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 38/316 (12%), Positives = 87/316 (27%), Gaps = 33/316 (10%)

Query: 3   ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
           I+ +S    E       ++  +   G G        +  +     +   I SGV + +F 
Sbjct: 212 ITGNSLKLTETEKIEEIVVKVSSGSGGGSATKGRGNLQIKKVDNADPNKILSGVVFTLF- 270

Query: 63  SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKN 114
             +      + T    G     +L   +YL+       G V          + + ++E  
Sbjct: 271 DRTGTTAIRTITTDKNGIAQFNNLKRDEYLLREMKTLDGYVISKELKAGKLVKLGAEETT 330

Query: 115 QKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA----LLITDKVRSGTLVRL 170
              +      G  + +     +        FS+    ++       LIT+     T+  L
Sbjct: 331 TYTLKNEKFVGKVVLTKTDAHNKEKLKNAVFSLLDQNHNVIPEHKELITNDKGQITVDNL 390

Query: 171 GTNNYQITSHYGKYNAIVST---VVKVEPGKII----DVTIQNRAAKITFKLVSEMGGEA 223
               Y +       +  +        +E  +      +         +    V +  G  
Sbjct: 391 KPGTYYLKEIKAPEHYQLDDRLIEFTIEEDQTTVINKEAQNNLIRGSVILTKVDKE-GNT 449

Query: 224 VADTAWSILTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
           +    +S+   +   +               +  L  G+Y  +      +Y  +     F
Sbjct: 450 LEGAVFSVRDRNNKRIPGYTKLTTNGNGQIEAKNLLPGEYQFVEEKAPEHYEIDKKPLKF 509

Query: 272 SVLTGKSTIVEVLMRQ 287
           +V   +   + V    
Sbjct: 510 TVEKSQQKALTVTATN 525



 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/298 (13%), Positives = 83/298 (27%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        +  +  +   +++ D+   +         
Sbjct: 1175 TIERSQTKEINVTGKNALKNGSVELTKIDDIDINTKLANAVFNLLDAD-GELVKEGLKTN 1233

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +         T+   +     V   N    G    
Sbjct: 1234 DEGKIVVENLRPGTYQFVETIAPEHYDLDKRPIVFTIKKSQTETLHVTATNTLTKGAVTL 1293

Query: 130  SIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S        V  +  F I +         L+T++     +  L   +YQ        + +
Sbjct: 1294 SKVDDVDGTVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYV 1353

Query: 188  VSTV---VKVEPGK----IIDVTIQNRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+     +  T   +   I   K+        +AD  +++L   G  +
Sbjct: 1354 LDETPIKFTIEKGQKKAISLTATNSLKQGSIELLKVDDLNTQTKLADAVFNLLDQDGKVL 1413

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   S        L  G Y  +      +Y  +     F++   +  I  V M+ 
Sbjct: 1414 KTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKN 1471



 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/322 (13%), Positives = 98/322 (30%), Gaps = 40/322 (12%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRVVD-------AQRITCEARLTENSTSIDSGVS 57
           F      E+       L   + K + K +            +T   ++ +   +   G  
Sbjct: 491 FVEEKAPEHYEIDKKPLKFTVEKSQQKALTVTATNHFIKGGVTLT-KVDDVDGTALEGAV 549

Query: 58  WHIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSK 111
           + I D+   K+    +      G     DL PG Y    +             + T+   
Sbjct: 550 FKIVDANDEKQVIRENIKTGSNGKVTVKDLEPGAYKFIETEAPKDYTLSTNPIEFTIDKS 609

Query: 112 EKNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRS 164
           ++    V   N    G + L  + + G     +   F +    N+       L TDK   
Sbjct: 610 QQALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGK 669

Query: 165 GTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVS 217
             +  L    Y+        + ++        ++  +   + ++     +   +    V 
Sbjct: 670 VKVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVD 729

Query: 218 EMGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE 270
           ++ G A+    + I+ A+        +    +   + +  L  GDY  I     + Y + 
Sbjct: 730 DIDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKN 789

Query: 271 -----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 790 TKPIKFTITESQTTQATVTAKN 811


>gi|229128796|ref|ZP_04257773.1| hypothetical protein bcere0015_32420 [Bacillus cereus BDRD-Cer4]
 gi|228654684|gb|EEL10545.1| hypothetical protein bcere0015_32420 [Bacillus cereus BDRD-Cer4]
          Length = 1062

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 87/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F+  +
Sbjct: 222 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNVNN 281

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 282 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 339

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 340 NKVKGSIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLE 398

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +   A+ + 
Sbjct: 399 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAAFELK 458

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  V     +         L+ G Y+ + +     Y
Sbjct: 459 DASGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 497



 Score = 69.6 bits (168), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 34/274 (12%), Positives = 81/274 (29%), Gaps = 22/274 (8%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +   +   E    +  G  + I    + K    + +      KV    + G   +  
Sbjct: 172 PNGVRIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNLSVAANLIKVQAIAYRGTDTVQN 231

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA 155
           +   +          K  +   V    AG +++  + + G   V     F +++  N   
Sbjct: 232 ATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGENGE--VLAGAVFEVFNVNNESV 284

Query: 156 LLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIVS---TVVKVEPGKIIDVTIQNRAAKI 211
             IT        +  L    Y +         +       ++V+ G+   V I N   K 
Sbjct: 285 GKITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVNNKVKG 344

Query: 212 TFKLVS-EMGGEAVADTAWSILTASG----DTVGESANASPSMVLSEGDYTVIARNKERN 266
           + ++      G+ + +  +++ T  G      V +    +    L+ G Y  +       
Sbjct: 345 SIEIKKLSDSGKILPNVEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLETKTPNG 404

Query: 267 Y-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
           Y        F +    +  +   +    +  + +
Sbjct: 405 YIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 437



 Score = 60.3 bits (144), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 43/287 (14%), Positives = 80/287 (27%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G ++ + D+    
Sbjct: 414 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAAFELKDASGKV 464

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK-------KITVSSKEKNQKQVFI 120
                      G     DL  G Y         G V        +I    K      V  
Sbjct: 465 VGEYK--TDKNGEINVKDLAYGKYSFVEKASPNGYVLVKEPIMFEIKEHGKIIELLAVNH 522

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 523 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 582

Query: 180 HYGKYNAIVSTV----VKVEPGKIIDVTIQNRA-AKITFKLVSEMGGEAVADTAWSILTA 234
                  +++         E G+II   +++     I  K   +  G     T+ S+   
Sbjct: 583 TVAPKGYVLNEETFSFEIKENGQIIKHIVKDEKIPSIETKATDKTDGTKEMHTSKSVTIQ 642

Query: 235 SGDTVGESANASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
                           L  G +YT+  +   +  ++   V   + T 
Sbjct: 643 D---------KVEYKDLQVGKEYTLKGKLMNKETNKPLVVNGKEVTA 680


>gi|229113219|ref|ZP_04242714.1| hypothetical protein bcere0018_54280 [Bacillus cereus Rock1-15]
 gi|228670245|gb|EEL25593.1| hypothetical protein bcere0018_54280 [Bacillus cereus Rock1-15]
          Length = 1098

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 40/279 (14%), Positives = 86/279 (30%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    S  + +G  + +F++ +
Sbjct: 253 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGESGEVLAGAVFEVFNANN 312

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 313 ESVGK--ITTGADGTAELNNLPIGTYTVKEIKAPTGYVLGDKPQTIEVKTGETGAVQIVN 370

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
             A G            ++ + + F++++    +             V  L    Y    
Sbjct: 371 NKAKGNIEIKKLSDSGKVLPN-VEFTVFTEDGKEVKKAVTNENGIAKVEGLTFGKYYFLE 429

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 430 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDTEDISKKLEGAVFELK 489

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 490 DASGKVIGEYKTDKNGEINVKDLAYGKYSFVEKTSPNGY 528



 Score = 71.9 bits (174), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 39/296 (13%), Positives = 89/296 (30%), Gaps = 26/296 (8%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDS----GVSWHIFDSISNKKNTLST 73
           + L     +   G   V A+      ++   +  +      G  + I    + K    + 
Sbjct: 181 TNLYTVQTNAKSGSYKVVAKNAPNGVKIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNL 240

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYK 133
           +      KV    + G   +  +   +          K  +   V    AG +++  + +
Sbjct: 241 SVAANLTKVQAIAYRGTDTVQNATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGE 295

Query: 134 PGSPIVDDELTFSIYSNPNHKALLITDK-VRSGTLVRLGTNNYQITSHYGKYNAIV---S 189
            G   V     F +++  N     IT     +  L  L    Y +         ++    
Sbjct: 296 SGE--VLAGAVFEVFNANNESVGKITTGADGTAELNNLPIGTYTVKEIKAPTGYVLGDKP 353

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASGDT----VGESAN 244
             ++V+ G+   V I N  AK   ++      G+ + +  +++ T  G      V     
Sbjct: 354 QTIEVKTGETGAVQIVNNKAKGNIEIKKLSDSGKVLPNVEFTVFTEDGKEVKKAVTNENG 413

Query: 245 ASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            +    L+ G Y  +       Y        F +    +  +   +    +  + +
Sbjct: 414 IAKVEGLTFGKYYFLETKTPNGYIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 468



 Score = 64.9 bits (156), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 46/287 (16%), Positives = 84/287 (29%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +            TE+ +    G  + + D+    
Sbjct: 445 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDTEDISKKLEGAVFELKDASGKV 495

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISA---SFGHVGVVKKITVSSKEKNQKQ----VFI 120
                      G     DL  G Y         G+V V + I    KE  +      V  
Sbjct: 496 IGEYK--TDKNGEINVKDLAYGKYSFVEKTSPNGYVLVTEPIVFEIKEHGKIIELLAVNH 553

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 554 LIKGDLEITKVDIADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 613

Query: 180 HYGKYNAIVSTV----VKVEPGKIIDVTIQNRA-AKITFKLVSEMGGEAVADTAWSILTA 234
                  I++         E G+II   +++     I      +  G     T+ S+   
Sbjct: 614 TIAPNGYILNEETFSFEIKENGQIIKHIVKDEKIPSIKTTATDKKDGTKEMHTSKSVTIQ 673

Query: 235 SGDTVGESANASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
                           L  G +YT+  +  ++  ++   V   + T 
Sbjct: 674 D---------KVEYKDLQVGKEYTLKGKLMDKKTNKPLVVNGKEVTA 711


>gi|228922232|ref|ZP_04085539.1| hypothetical protein bthur0011_32220 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228837287|gb|EEM82621.1| hypothetical protein bthur0011_32220 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 1062

 Score =  138 bits (347), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 39/279 (13%), Positives = 86/279 (30%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 222 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNTNN 281

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 282 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 339

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 340 NKVKGNIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLE 398

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  + +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 399 TKTPNGYVGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 458

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
             SG  V     +         L+ G Y+ + +     Y
Sbjct: 459 DESGKVVGKYKTDKNGEINVKDLAYGKYSFVEKASPNGY 497



 Score = 68.8 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/270 (12%), Positives = 78/270 (28%), Gaps = 22/270 (8%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +   +   E    +  G  + I    + K    + +      KV    + G   +  
Sbjct: 172 PNGVRIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNLSVAANLTKVQAIAYRGTDTVQN 231

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA 155
           +   +          K  +   V    AG +++  + + G   V     F +++  N   
Sbjct: 232 ATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGENGE--VLAGAVFEVFNTNNESV 284

Query: 156 LLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIVS---TVVKVEPGKIIDVTIQNRAAKI 211
             IT        +  L    Y +         +       ++V+ G+   V I N   K 
Sbjct: 285 GKITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVNNKVKG 344

Query: 212 TFKLVS-EMGGEAVADTAWSILTASG----DTVGESANASPSMVLSEGDYTVIARNKERN 266
             ++      G+ + +  +++ T  G      V +    +    L+ G Y  +       
Sbjct: 345 NIEIKKLSDSGKILPNVEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLETKTPNG 404

Query: 267 Y-----SREFSVLTGKSTIVEVLMRQKRMD 291
           Y        F +    +  +   +    + 
Sbjct: 405 YVGNKTKYPFEIKE-HNKTLTFTVENTEVK 433



 Score = 61.5 bits (147), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 39/287 (13%), Positives = 77/287 (26%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D     
Sbjct: 414 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAVFELKDESGKV 464

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV---KKITVSSKEKNQKQ----VFI 120
                      G     DL  G Y         G V   ++I    KE  +      V  
Sbjct: 465 VGKYK--TDKNGEINVKDLAYGKYSFVEKASPNGYVLVKEQIVFEIKEHGKIIELLAVNH 522

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 523 LIKGDLEITKVDVADGNNKLPNAEFTIYNEVGKEVVKGKTDDKGIAKFEKLPFGKYTYNE 582

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
                  +++             + + +      K + +        T  +  T     +
Sbjct: 583 TIAPKGYVLNEE---------TFSFEIKENGQIIKHIVKDEKIPSIKTTATDKTDGTKEM 633

Query: 240 GESAN-----ASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
             S +           L  G +YT+  +   +  ++   V   + T 
Sbjct: 634 HTSKSVTIQDKVEYKDLQVGKEYTLKGKLMNKETNKPLVVNGKEVTA 680


>gi|229136594|ref|ZP_04265277.1| hypothetical protein bcere0014_54200 [Bacillus cereus BDRD-ST196]
 gi|228646867|gb|EEL03019.1| hypothetical protein bcere0014_54200 [Bacillus cereus BDRD-ST196]
          Length = 1093

 Score =  138 bits (347), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 41/279 (14%), Positives = 87/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  I +G  + +F++ +
Sbjct: 253 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEILAGAVFEVFNANN 312

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    QV  
Sbjct: 313 ESVGK--ITTGADGTAELNNLPIGTYTVKEIKAPTGYVSGDKPQTIEVKTGEIGAVQVVN 370

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR-LGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 371 NKVKGNIEIKKLSDSGKMLPN-VEFTVFTEDGKEVKKVVTKENGIANVDGLTYGKYYFLE 429

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 430 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 489

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 490 DASGKVIGEYKTDKNGEVNVKDLAYGKYSFVEKASPNGY 528



 Score = 68.8 bits (166), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 35/296 (11%), Positives = 82/296 (27%), Gaps = 26/296 (8%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDS----GVSWHIFDSISNKKNTLST 73
           + L     +   G   V A+      ++   +  +      G  + I      K    + 
Sbjct: 181 TNLYTVQTNAKSGSYKVVAKNAPNGVKIVSENGEVKDQLSLGEKFRIQIPKDTKTGEFNL 240

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYK 133
           +      KV    + G   +            +  + ++ +        A G        
Sbjct: 241 SVATNLTKVQAIAYRGTDTVQ------NATVLLERNEEKLSSDLAVNWEAAGSLKIKKVG 294

Query: 134 PGSPIVDDELTFSIYSNPNHKALLITDK-VRSGTLVRLGTNNYQITSHYGKYNAIV---S 189
               I      F +++  N     IT     +  L  L    Y +         +     
Sbjct: 295 ENGEI-LAGAVFEVFNANNESVGKITTGADGTAELNNLPIGTYTVKEIKAPTGYVSGDKP 353

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASG----DTVGESAN 244
             ++V+ G+I  V + N   K   ++      G+ + +  +++ T  G      V +   
Sbjct: 354 QTIEVKTGEIGAVQVVNNKVKGNIEIKKLSDSGKMLPNVEFTVFTEDGKEVKKVVTKENG 413

Query: 245 ASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            +    L+ G Y  +       Y        F +    +  +   +    +  + +
Sbjct: 414 IANVDGLTYGKYYFLETKTPNGYIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 468



 Score = 64.2 bits (154), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 41/287 (14%), Positives = 81/287 (28%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 445 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAVFELKDASGKV 495

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV---VKKITVSSKEKNQKQ----VFI 120
                      G     DL  G Y         G     + I    KE  +      V  
Sbjct: 496 IGEYK--TDKNGEVNVKDLAYGKYSFVEKASPNGYVLITEPIVFEIKEHGKIIELLAVNH 553

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 554 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 613

Query: 180 HYGKYNAIVSTVV----KVEPGKIIDVTIQNRA-AKITFKLVSEMGGEAVADTAWSILTA 234
                  +++  +      E G+II   +++     +      +  G     T+ S+   
Sbjct: 614 TVAPKGYVLNEEIFSFEIKENGQIIKHIVKDEKIPSVKTTATDKTDGTKEMHTSKSVTIQ 673

Query: 235 SGDTVGESANASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
                           L  G +YT+  +  ++  ++   V   + T 
Sbjct: 674 D---------KVEYKDLQVGKEYTLKGKLMDKETNKPLVVNGKEVTA 711


>gi|206968922|ref|ZP_03229877.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           AH1134]
 gi|206735963|gb|EDZ53121.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus
           AH1134]
          Length = 1055

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 88/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 215 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNANN 274

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 275 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 332

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 333 NKVKGNIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIANVEDLTYGKYYFLE 391

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +   A+ + 
Sbjct: 392 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAAFELK 451

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  V     +         L+ G Y+ + +     Y
Sbjct: 452 DASGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 490



 Score = 70.3 bits (170), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 39/287 (13%), Positives = 84/287 (29%), Gaps = 24/287 (8%)

Query: 21  LNNNISKGKGKRVVD--AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKII 78
           +  N   G  K VV      +   +   E    +  G  + I    + K    + +    
Sbjct: 148 VQTNAKSGSYKVVVKNAPNGVRIVSENGEVKDQLLVGEKFRIQIPKNTKTGEFNLSVAAN 207

Query: 79  GGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPI 138
             KV    + G   +  +   +          K  +   V    AG +++  + + G   
Sbjct: 208 LTKVQAIAYRGTDTVQNATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGENGE-- 260

Query: 139 VDDELTFSIYSNPNHKALLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIVS---TVVKV 194
           V     F +++  N     IT        +  L    Y +         +       ++V
Sbjct: 261 VLAGAVFEVFNANNESVGKITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEV 320

Query: 195 EPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASG----DTVGESANASPSM 249
           + G+   V I N   K   ++      G+ + +  +++ T  G      V +    +   
Sbjct: 321 KTGETGAVQIVNNKVKGNIEIKKLSDSGKILPNVEFTVFTEDGKEVKKVVTKENGIANVE 380

Query: 250 VLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMD 291
            L+ G Y  +       Y        F +    +  +   +    + 
Sbjct: 381 DLTYGKYYFLETKTPNGYIGNKTKYPFEIKE-HNKTLTFTVENTEVK 426



 Score = 63.0 bits (151), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 38/285 (13%), Positives = 80/285 (28%), Gaps = 30/285 (10%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G ++ + D+    
Sbjct: 407 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAAFELKDASGKV 457

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQ--VFI 120
                      G     DL  G Y         G           +    K  +   V  
Sbjct: 458 VGEYK--TDKNGEINVKDLAYGKYSFVEKASPNGYVLVKEPIMFEIKEHGKVIELLAVNH 515

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 516 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 575

Query: 180 HYGKYNAIVSTV---VKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASG 236
                  +++      +++    I   +       + K  +        D    + T+  
Sbjct: 576 TVAPNGYVLNEETFSFEIKENGQIIKHVVKDEKIPSIKTTASDKK----DGTKEMHTSKS 631

Query: 237 DTVGESANASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
            T+ +         L  G +YT+  +  ++  ++ F V   + T 
Sbjct: 632 VTIQD---KVEFKDLQVGKEYTLKGKLMDKKTNKPFVVNGKEVTA 673


>gi|229179807|ref|ZP_04307154.1| hypothetical protein bcere0005_31540 [Bacillus cereus 172560W]
 gi|228603636|gb|EEK61110.1| hypothetical protein bcere0005_31540 [Bacillus cereus 172560W]
          Length = 1062

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 42/279 (15%), Positives = 89/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 222 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNANN 281

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 282 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 339

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 340 NKVKGNIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIANVEDLTYGKYYFLE 398

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K ++ T++N   K + KL+        + +   A+ + 
Sbjct: 399 TKTPNGYIGNKTKYPFEIKEHNKTLNFTVENTEVKGSVKLLKVDNEDISKKLEGAAFELK 458

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  V     +         L+ G Y+ + +     Y
Sbjct: 459 DASGKVVGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 497



 Score = 70.0 bits (169), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 34/270 (12%), Positives = 78/270 (28%), Gaps = 22/270 (8%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +   +   E    +  G  + I    + K    + +      KV    + G   +  
Sbjct: 172 PNGVRIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNLSVAANLTKVQAIAYRGTDTVQN 231

Query: 96  SFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA 155
           +   +          K  +   V    AG +++  + + G   V     F +++  N   
Sbjct: 232 ATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGENGE--VLAGAVFEVFNANNESV 284

Query: 156 LLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIVS---TVVKVEPGKIIDVTIQNRAAKI 211
             IT        +  L    Y +         +       ++V+ G+   V I N   K 
Sbjct: 285 GKITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVNNKVKG 344

Query: 212 TFKLVS-EMGGEAVADTAWSILTASG----DTVGESANASPSMVLSEGDYTVIARNKERN 266
             ++      G+ + +  +++ T  G      V +    +    L+ G Y  +       
Sbjct: 345 NIEIKKLSDSGKILPNVEFTVFTEDGKEVKKVVTKENGIANVEDLTYGKYYFLETKTPNG 404

Query: 267 Y-----SREFSVLTGKSTIVEVLMRQKRMD 291
           Y        F +    +  +   +    + 
Sbjct: 405 YIGNKTKYPFEIKE-HNKTLNFTVENTEVK 433



 Score = 58.8 bits (140), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 32/268 (11%), Positives = 68/268 (25%), Gaps = 26/268 (9%)

Query: 29  KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
             +       +       E+ +    G ++ + D+               G     DL  
Sbjct: 426 TVENTEVKGSVKLLKVDNEDISKKLEGAAFELKDASGKVVGEYK--TDKNGEINVKDLAY 483

Query: 89  GDYLISASFGHVGV-----VKKITVSSKEKNQKQ--VFILNAGGIRLYSIYKPGSPIVDD 141
           G Y         G           +    K  +   V  L  G + +  +          
Sbjct: 484 GKYSFVEKASPNGYVLVKEPIMFEIKEHGKVIELLAVNHLIKGDLEITKVDVADGNNKLS 543

Query: 142 ELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVKVEPGKII 200
              F+IY+    + +   TD        +L    Y           +++           
Sbjct: 544 NAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKETVAPKGYVLNEE--------- 594

Query: 201 DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGESAN-----ASPSMVLSEG- 254
             + + +      K + +        T  +  T     +  S +           L  G 
Sbjct: 595 TFSFEIKENGQIIKHIVKDEKIPSIKTTATDKTDGTKEMHTSKSVTIQDKVEYKDLQVGK 654

Query: 255 DYTVIARNKERNYSREFSVLTGKSTIVE 282
           +Y +  +   +  ++   V+ GK   VE
Sbjct: 655 EYNLKGKLMNKETNKPL-VVNGKEVTVE 681


>gi|300118074|ref|ZP_07055822.1| cell wall anchor domain-containing protein [Bacillus cereus SJ1]
 gi|298724385|gb|EFI65079.1| cell wall anchor domain-containing protein [Bacillus cereus SJ1]
          Length = 1093

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 41/279 (14%), Positives = 88/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    S  + +G  + +F++ +
Sbjct: 253 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGESGEVLAGAVFEVFNANN 312

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 313 ESVGK--ITTGADGTAELNNLPIGTYTVKEIKAPTGYVLGDKPQTIEVKTGETGAVQIVN 370

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
             A G      +     ++ + + F++++    +             V  L    Y    
Sbjct: 371 NKAKGNIEIKKFSDSGKVLPN-VEFTVFTEDGKEVKKAVTNENGIAKVEGLTFGKYYFLE 429

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  KI+  T++N   K + KL+        + +    + + 
Sbjct: 430 TKTPNGYIGNKTKYPFEIKEHNKILTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 489

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 490 DASGKVIGEYKTDKNGEINVKDLAYGKYSFVEKTSPNGY 528



 Score = 72.7 bits (176), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 40/296 (13%), Positives = 90/296 (30%), Gaps = 26/296 (8%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDS----GVSWHIFDSISNKKNTLST 73
           + L     +   G   V A+      ++   +  +      G  + I    + K    + 
Sbjct: 181 TNLYTVQTNAKSGSYKVVAKNAPNGVKIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNL 240

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYK 133
           +      KV    + G   +  +   +          K  +   V    AG +++  + +
Sbjct: 241 SVAANLTKVQAIAYRGTDTVQNATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGE 295

Query: 134 PGSPIVDDELTFSIYSNPNHKALLITDK-VRSGTLVRLGTNNYQITSHYGKYNAIV---S 189
            G   V     F +++  N     IT     +  L  L    Y +         ++    
Sbjct: 296 SGE--VLAGAVFEVFNANNESVGKITTGADGTAELNNLPIGTYTVKEIKAPTGYVLGDKP 353

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASGDT----VGESAN 244
             ++V+ G+   V I N  AK   ++      G+ + +  +++ T  G      V     
Sbjct: 354 QTIEVKTGETGAVQIVNNKAKGNIEIKKFSDSGKVLPNVEFTVFTEDGKEVKKAVTNENG 413

Query: 245 ASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            +    L+ G Y  +       Y        F +    + I+   +    +  + +
Sbjct: 414 IAKVEGLTFGKYYFLETKTPNGYIGNKTKYPFEIKE-HNKILTFTVENTEVKGSVK 468



 Score = 63.4 bits (152), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 40/272 (14%), Positives = 76/272 (27%), Gaps = 25/272 (9%)

Query: 23  NNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKV 82
           N I     +       +       E+ +    G  + + D+               G   
Sbjct: 451 NKILTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELKDASGKVIGEYK--TDKNGEIN 508

Query: 83  SFDLFPGDYLISA---SFGHVGVVKKITVSSKEKNQKQ----VFILNAGGIRLYSIYKPG 135
             DL  G Y         G+V V + I    KE  +      V  L  G + +  +    
Sbjct: 509 VKDLAYGKYSFVEKTSPNGYVLVTEPIVFEIKEHGKIIELLAVNHLIKGDLEITKVDVAD 568

Query: 136 SPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVV-- 192
                    F+IY+    + +   TD        +L    Y            ++  +  
Sbjct: 569 GNNKLPNAEFTIYNEEGKEVVKGKTDDKGIAKFEKLPFGKYTYKETIAPNGYFLNEEMFS 628

Query: 193 --KVEPGKIIDVTIQNRA-AKITFKLVSEMGGEAVADTAWSILTASGDTVGESANASPSM 249
               E G+II   +++     I      +  G     T+ S+                  
Sbjct: 629 FEIKENGQIIKHIVKDEKIPSIKTTASDKKDGTKEMHTSKSVTIQD---------KVEYK 679

Query: 250 VLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
            L  G +YT+  +  ++  ++   V   + T 
Sbjct: 680 DLQVGKEYTLKGKLMDKKTNKPLVVNGKEITA 711


>gi|228961621|ref|ZP_04123230.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            serovar pakistani str. T13001]
 gi|228798103|gb|EEM45107.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            serovar pakistani str. T13001]
          Length = 3123

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 43/326 (13%), Positives = 94/326 (28%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGK-------RVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++       +   I + + K         +    +           +   G  
Sbjct: 2718 FIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTEGSVELIKVDDAKQNTTLEGAV 2777

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +           T    G  V  +L PGDY    +     +       K TV   +
Sbjct: 2778 FKIVNKD-GHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPIKFTVKKGQ 2836

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            +    V   N    G + L  +    G+ +             + ++ L TDK    ++ 
Sbjct: 2837 EKIASVTATNSLTKGAVELTKVDDIDGTTLEGAIFKIVDMDGKDVRSDLTTDKDGKISVS 2896

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     +I  VT         I    V     
Sbjct: 2897 DLRPGDYQFIETKAPTGYDLNIKPIPFTITKGQSQITSVTALNSLTTGSIELTKVDIDHH 2956

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 2957 GTLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETQAPKGYQLDASPINF 3016

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++T +++ +  K+++ +   +
Sbjct: 3017 TIDKAQATPLQITVSNKKIESSSGGD 3042



 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1695 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1754

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1755 VRTDLVTNSKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1814

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1815 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIIKDLTTDDYGVLVIPDLAPGDYQFI 1874

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1875 ETQAPEHYKLDKTPIKFTIKKGNKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTILEGAEF 1934

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1935 IIVDAHDTKKVIRKGLTTDKNGKISASNLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 1994

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1995 KENITVTATN 2004



 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 42/316 (13%), Positives = 95/316 (30%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I KG+ K +       +    I        N+ +      
Sbjct: 2250 FIETKAPKHYVLDETPIKFTIEKGQKKAISLTATNSLKQGSIELLKVDDLNTQTKLVDAV 2309

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA-----SFGHVGVVKKITVSSKE 112
            +++ D    K           G  V  +L PG Y          +         T+   +
Sbjct: 2310 FNLLDQD-GKVLKTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQ 2368

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K+   V + N    GG+ L  +    G+ +          +    +  L+T++    ++ 
Sbjct: 2369 KDIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFKIVDMNGTVIRKNLVTNQQGKISVS 2428

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +   +   +++          +    V ++ G
Sbjct: 2429 DLRPGDYQFIETTAPKHYDLNKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDG 2488

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+ D  + I   +G  +      +         L  GDY  +      +Y  +     F
Sbjct: 2489 TALKDAVFKITDLNGKDIRTELTTDVHGKISVSDLRPGDYQFVETKAPEHYKLDSTPIKF 2548

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   +   ++V    
Sbjct: 2549 TIKKSQKEKLQVTATN 2564



 Score =  118 bits (296), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 48/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +I  G 
Sbjct: 1873 FIETQAPEHYKLDKTPIKFTIKKGNKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTILEGA 1932

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + +L PGDY                    T+  
Sbjct: 1933 EFIIVDAHDTKKVIRKGLTTDKNGKISASNLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 1992

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1993 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2052

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2053 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKNGSVELTKIDDI 2112

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2113 DINTKLANAVFNLLDADGELVKEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2172

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2173 IVFTIKKSQTETLHVTATN 2191



 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 52/310 (16%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1601 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1659

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1660 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1719

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1720 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYKL 1779

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1780 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1839

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1840 TLQDATGKEIIKDLTTDDYGVLVIPDLAPGDYQFIETQAPEHYKLDKTPIKFTIKKGNKE 1899

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1900 DLPIPVTVKN 1909



 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 46/315 (14%), Positives = 93/315 (29%), Gaps = 35/315 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I+K +   +      +        +++ +   +      +
Sbjct: 2437 FIETTAPKHYDLNKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDGTALKDAVF 2496

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++ K      T  + G     DL PGDY    +             K T+   +K
Sbjct: 2497 KI-TDLNGKDIRTELTTDVHGKISVSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQK 2555

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    T  
Sbjct: 2556 EKLQVTATNSLTEGAVELVKVDDINPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITAT 2615

Query: 169  RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  ++   ++          +    V     
Sbjct: 2616 NLRPGDYQFIETKAPKDYDLNKTPISFTIERSQLTHASVTAKNGLTKGGVELTKVDSIDK 2675

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2676 KEMLEGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEEPIK 2735

Query: 271  FSVLTGKSTIVEVLM 285
            F++   ++  V V  
Sbjct: 2736 FTIERSQTKHVFVTA 2750



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/312 (10%), Positives = 85/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1127 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1185

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1186 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1245

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1246 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNQGQITVDNLKPGTYYLQ 1305

Query: 179  SHYGKYNAIVSTV---VKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  + +      ++  +        T              +  G+ +A   +S+
Sbjct: 1306 ETTAPEHYKLDSTPIQFTIKEDQTTVINRTATNSLIPGSAILTKFDKD-GKTLAGAEFSV 1364

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                   +               +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1365 RDRYNKVIRGYEKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKKPIEFTIIKSQKK 1424

Query: 280  IVEVLMRQKRMD 291
             + V      + 
Sbjct: 1425 ALTVTATNHLIK 1436



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/298 (13%), Positives = 83/298 (27%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        +  +  +   +++ D+   +         
Sbjct: 2082 TIERSQTKEINVTGKNALKNGSVELTKIDDIDINTKLANAVFNLLDAD-GELVKEGLKTN 2140

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +         T+   +     V   NA   G    
Sbjct: 2141 DEGKIVVENLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHVTATNALTKGAVKL 2200

Query: 130  SIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S        V  +  F I +         L+T++     +  L   +YQ        + +
Sbjct: 2201 SKVDDVDGTVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYV 2260

Query: 188  VSTV---VKVEPGK----IIDVTIQNRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+     +  T   +   I   K+        + D  +++L   G  +
Sbjct: 2261 LDETPIKFTIEKGQKKAISLTATNSLKQGSIELLKVDDLNTQTKLVDAVFNLLDQDGKVL 2320

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   S        L  G Y  +      +Y  +     F++   +  I  V M+ 
Sbjct: 2321 KTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKN 2378



 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++       +   I K + K +                ++ +   +   G  +
Sbjct: 1398 FVEEKAPKDYDIDKKPIEFTIIKSQKKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1457

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1458 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGAYKFIETEAPKDYTLSTNPIEFTIDKSQ 1517

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1518 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1577

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1578 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1637

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1638 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1697

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1698 KPIKFTITESQTTQATVTAKN 1718


>gi|228912165|ref|ZP_04075880.1| hypothetical protein bthur0013_62520 [Bacillus thuringiensis IBL
           200]
 gi|228847502|gb|EEM92441.1| hypothetical protein bthur0013_62520 [Bacillus thuringiensis IBL
           200]
          Length = 1062

 Score =  138 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 39/279 (13%), Positives = 87/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 222 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLAGAVFEVFNANN 281

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 282 ESVGK--ITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 339

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 340 NKVKGNIEIKKLSDSGKVLPN-VEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLE 398

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 399 TQTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAEFELK 458

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 459 DASGKVIGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 497



 Score = 70.0 bits (169), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 38/296 (12%), Positives = 87/296 (29%), Gaps = 26/296 (8%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDS----GVSWHIFDSISNKKNTLST 73
           + L     +   G   V A+      R+   +  +      G  + I    + K    + 
Sbjct: 150 TNLYTVQTNAKSGSYKVVAKNAPNGVRIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNL 209

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYK 133
           +      KV    + G   +  +   +          K  +   V    AG +++  + +
Sbjct: 210 SVAANLTKVQAIAYRGTDTVQNATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGE 264

Query: 134 PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR-LGTNNYQITSHYGKYNAIVS--- 189
            G   V     F +++  N     IT        +  L    Y +         +     
Sbjct: 265 NGE--VLAGAVFEVFNANNESVGKITTGADGMAELNNLPIGTYTLKEIKAPTGYVSDDKP 322

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASG----DTVGESAN 244
             ++V+ G+   V I N   K   ++      G+ + +  +++ T  G      V +   
Sbjct: 323 QTIEVKTGETGAVQIVNNKVKGNIEIKKLSDSGKVLPNVEFTVFTEDGKEVKKVVTKENG 382

Query: 245 ASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            +    L+ G Y  +       Y        F +    +  +   +    +  + +
Sbjct: 383 IANVEGLTYGKYYFLETQTPNGYIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 437



 Score = 60.3 bits (144), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 38/287 (13%), Positives = 75/287 (26%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 414 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAEFELKDASGKV 464

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK-------KITVSSKEKNQKQVFI 120
                      G     DL  G Y         G V        +I    K      V  
Sbjct: 465 IGEYK--TDKNGEINVKDLAYGKYSFVEKASPNGYVLVKEPIMFEIKEHGKIIELLAVNH 522

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 523 LIKGELEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 582

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
                  +++             + + +      K + +        T  +  T     +
Sbjct: 583 TVAPKGYVLNEE---------TFSFEIKENGQIIKHIVKDEKIPSIKTTATDKTDGTKEM 633

Query: 240 GESAN-----ASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
             S +           L  G +YT+  +   +  ++   V   + T 
Sbjct: 634 HTSKSVTIQDKVEYKDLQVGKEYTLKGKLMNKETNKPLVVNGKEVTA 680


>gi|229060994|ref|ZP_04198348.1| hypothetical protein bcere0026_30880 [Bacillus cereus AH603]
 gi|228718363|gb|EEL69997.1| hypothetical protein bcere0026_30880 [Bacillus cereus AH603]
          Length = 1089

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/279 (14%), Positives = 86/279 (30%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +       + +G  + +F++ +
Sbjct: 253 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGEDGEVLAGAVFEVFNANN 312

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    QV  
Sbjct: 313 ESVGK--ITTGADGTAELNNLPIGTYTVKEIKAPTGYVSGDKPQTIEVKTGEIGAVQVVN 370

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR-LGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 371 NKVKGNIEIKKLSDSGKMLPN-VEFTVFTEDGKEVKKVVTKENGIANVDGLTYGKYYFLE 429

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 430 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 489

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 490 DASGKVIGEYKTDKNGEVNVKDLAYGKYSFVEKASPNGY 528



 Score = 70.3 bits (170), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 38/296 (12%), Positives = 88/296 (29%), Gaps = 26/296 (8%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDS----GVSWHIFDSISNKKNTLST 73
           + L     +   G   V A+      ++   +  +      G  + I      K    + 
Sbjct: 181 TNLYTVQTNAKSGSYKVVAKNAPNGVKIISENGEVKDQLSVGEKFRIQIPKDTKTGEFNL 240

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYK 133
           +      KV    + G   +  +   +          K  +   V    AG +++  + +
Sbjct: 241 SVAANLTKVQAIAYRGTDTVQNATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGE 295

Query: 134 PGSPIVDDELTFSIYSNPNHKALLITDK-VRSGTLVRLGTNNYQITSHYGKYNAIV---S 189
            G   V     F +++  N     IT     +  L  L    Y +         +     
Sbjct: 296 DGE--VLAGAVFEVFNANNESVGKITTGADGTAELNNLPIGTYTVKEIKAPTGYVSGDKP 353

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASG----DTVGESAN 244
             ++V+ G+I  V + N   K   ++      G+ + +  +++ T  G      V +   
Sbjct: 354 QTIEVKTGEIGAVQVVNNKVKGNIEIKKLSDSGKMLPNVEFTVFTEDGKEVKKVVTKENG 413

Query: 245 ASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMDKNGQ 295
            +    L+ G Y  +       Y        F +    +  +   +    +  + +
Sbjct: 414 IANVDGLTYGKYYFLETKTPNGYIGNKTKYPFEIKE-HNKTLTFTVENTEVKGSVK 468



 Score = 64.9 bits (156), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 41/287 (14%), Positives = 81/287 (28%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 445 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAVFELKDASGKV 495

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV---VKKITVSSKEKNQKQ----VFI 120
                      G     DL  G Y         G     + I    KE  +      V  
Sbjct: 496 IGEYK--TDKNGEVNVKDLAYGKYSFVEKASPNGYVLITEPIVFEIKEHGKIIELLAVNH 553

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 554 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 613

Query: 180 HYGKYNAIVSTVV----KVEPGKIIDVTIQNRA-AKITFKLVSEMGGEAVADTAWSILTA 234
                  +++  +      E G+II   +++     +      +  G     T+ S+   
Sbjct: 614 TVAPKGYVLNEEIFSFEIKENGQIIKHIVKDEKIPSVKTTATDKTDGTKEMHTSKSVTIQ 673

Query: 235 SGDTVGESANASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
                           L  G +YT+  +  ++  ++   V   + T 
Sbjct: 674 D---------KVEYKDLQVGKEYTLKGKLMDKETNKPLVVNGKEVTA 711


>gi|75758830|ref|ZP_00738943.1| Collagen adhesion protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|74493671|gb|EAO56774.1| Collagen adhesion protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
          Length = 666

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/280 (15%), Positives = 84/280 (30%), Gaps = 21/280 (7%)

Query: 6   SSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSI 64
            +Y   + +   + LL  +  KG     V  + +   E         I  G  + +F+S 
Sbjct: 191 VAYKGTDKIQDATVLLERSEEKGSTDLNVSWKSVGQLEVIKVGEQKEILQGAVFDVFNST 250

Query: 65  SNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVF 119
           + K  T   T    G      L  G Y         G       ++I V + E  +  V 
Sbjct: 251 NEKVGT--ITTNEKGIASLSSLEIGTYTFKEVKSPTGYVMNEQPQQIEVKTGEIARVTVQ 308

Query: 120 ILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQIT 178
                G                ++ F++++    +        +    V  L    Y   
Sbjct: 309 NNKVKGSIEIKKLSDRGKT-LSKVEFTVFTAEGKEVTKTITNEQGIAQVKDLPYGKYYFV 367

Query: 179 SHYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSI 231
              G    +++         E GK +  T++N+  K   +L+   G    E +    + +
Sbjct: 368 ETKGVEGYLLNQTKYPFEIKEQGKTLTFTVENKEVKGNMQLLKVDGENPDEKLDGAVFVL 427

Query: 232 LTASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
             + G  +     +         L  G Y+ + +     Y
Sbjct: 428 QDSKGKKISEHKSDKNGLIEVKDLPFGAYSFVEKQAPTGY 467



 Score = 95.8 bits (236), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 40/264 (15%), Positives = 74/264 (28%), Gaps = 25/264 (9%)

Query: 40  TCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH 99
           + E +   +     S V + +F +   +     T     G     DL  G Y    + G 
Sbjct: 315 SIEIKKLSDRGKTLSKVEFTVFTAEGKEV--TKTITNEQGIAQVKDLPYGKYYFVETKGV 372

Query: 100 VGVV-----KKITVSSKEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN 152
            G +         +  + K            G ++L  +         D   F +  +  
Sbjct: 373 EGYLLNQTKYPFEIKEQGKTLTFTVENKEVKGNMQLLKVDGENPDEKLDGAVFVLQDSKG 432

Query: 153 HKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNAIV---STVVKV-EPGKIIDVTIQNR 207
            K     +DK     +  L    Y           ++   S    + E GK I +T +N+
Sbjct: 433 KKISEHKSDKNGLIEVKDLPFGAYSFVEKQAPTGYVLTKESIPFSISEQGKTIMLTAKNK 492

Query: 208 --AAKITFKLVSE-MGGEAVADTAWSILTASGDTV----GESANASPSMVLSEGDYTVIA 260
               ++    V    G   + +  ++I    G  V     +         L  G YT   
Sbjct: 493 HITGELEISKVDIADGNNKLPNAEFTIFNEQGKEVAKGKTDENG-IAKFKLPYGKYTYKE 551

Query: 261 RNKERNY---SREFSVLTGKSTIV 281
                 Y      F+    +   +
Sbjct: 552 TFAPDGYLLNEEIFNFEIKEDGQI 575



 Score = 40.3 bits (92), Expect = 0.30,   Method: Composition-based stats.
 Identities = 12/97 (12%), Positives = 21/97 (21%), Gaps = 3/97 (3%)

Query: 6   SSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSIS 65
           + Y   +     S            K       +        +  +      + IF+   
Sbjct: 465 TGYVLTKESIPFSISEQGKTIMLTAKNKHITGELEISKVDIADGNNKLPNAEFTIFNEQG 524

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV 102
            +            G   F L  G Y    +F   G 
Sbjct: 525 KEVAKGK---TDENGIAKFKLPYGKYTYKETFAPDGY 558


>gi|228905511|ref|ZP_04069463.1| Collagen adhesion protein [Bacillus thuringiensis IBL 4222]
 gi|228854147|gb|EEM98853.1| Collagen adhesion protein [Bacillus thuringiensis IBL 4222]
          Length = 663

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 43/280 (15%), Positives = 84/280 (30%), Gaps = 21/280 (7%)

Query: 6   SSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSI 64
            +Y   + +   + LL  +  KG     V  + +   E         I  G  + +F+S 
Sbjct: 188 VAYKGTDKIQDATVLLERSEEKGSTDLNVSWKSVGQLEVIKVGEQKEILQGAVFDVFNST 247

Query: 65  SNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVF 119
           + K  T   T    G      L  G Y         G       ++I V + E  +  V 
Sbjct: 248 NEKVGT--ITTNEKGIASLSSLEIGTYTFKEVKSPTGYVMNEQPQQIEVKTGEIARVTVQ 305

Query: 120 ILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQIT 178
                G                ++ F++++    +        +    V  L    Y   
Sbjct: 306 NNKVKGSIEIKKLSDRGKT-LSKVEFTVFTAEGKEVTKTITNEQGIAQVKDLPYGKYYFV 364

Query: 179 SHYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSI 231
              G    +++         E GK +  T++N+  K   +L+   G    E +    + +
Sbjct: 365 ETKGVEGYLLNQTKYPFEIKEQGKTLTFTVENKEVKGNMQLLKVDGENPDEKLDGAVFVL 424

Query: 232 LTASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
             + G  +     +         L  G Y+ + +     Y
Sbjct: 425 QDSKGKKISEHKSDKNGLIEVKDLPFGAYSFVEKQAPTGY 464



 Score = 95.8 bits (236), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 40/264 (15%), Positives = 74/264 (28%), Gaps = 25/264 (9%)

Query: 40  TCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH 99
           + E +   +     S V + +F +   +     T     G     DL  G Y    + G 
Sbjct: 312 SIEIKKLSDRGKTLSKVEFTVFTAEGKEV--TKTITNEQGIAQVKDLPYGKYYFVETKGV 369

Query: 100 VGVV-----KKITVSSKEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN 152
            G +         +  + K            G ++L  +         D   F +  +  
Sbjct: 370 EGYLLNQTKYPFEIKEQGKTLTFTVENKEVKGNMQLLKVDGENPDEKLDGAVFVLQDSKG 429

Query: 153 HKALL-ITDKVRSGTLVRLGTNNYQITSHYGKYNAIV---STVVKV-EPGKIIDVTIQNR 207
            K     +DK     +  L    Y           ++   S    + E GK I +T +N+
Sbjct: 430 KKISEHKSDKNGLIEVKDLPFGAYSFVEKQAPTGYVLTKESIPFSISEQGKTIMLTAKNK 489

Query: 208 --AAKITFKLVSE-MGGEAVADTAWSILTASGDTV----GESANASPSMVLSEGDYTVIA 260
               ++    V    G   + +  ++I    G  V     +         L  G YT   
Sbjct: 490 HITGELEISKVDIADGNNKLPNAEFTIFNEQGKEVAKGKTDENG-IAKFKLPYGKYTYKE 548

Query: 261 RNKERNY---SREFSVLTGKSTIV 281
                 Y      F+    +   +
Sbjct: 549 TFAPDGYLLNEEIFNFEIKEDGQI 572



 Score = 40.3 bits (92), Expect = 0.31,   Method: Composition-based stats.
 Identities = 12/97 (12%), Positives = 21/97 (21%), Gaps = 3/97 (3%)

Query: 6   SSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSIS 65
           + Y   +     S            K       +        +  +      + IF+   
Sbjct: 462 TGYVLTKESIPFSISEQGKTIMLTAKNKHITGELEISKVDIADGNNKLPNAEFTIFNEQG 521

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV 102
            +            G   F L  G Y    +F   G 
Sbjct: 522 KEVAKGK---TDENGIAKFKLPYGKYTYKETFAPDGY 555


>gi|229075419|ref|ZP_04208408.1| hypothetical protein bcere0024_32300 [Bacillus cereus Rock4-18]
 gi|228707668|gb|EEL59852.1| hypothetical protein bcere0024_32300 [Bacillus cereus Rock4-18]
          Length = 1072

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/279 (14%), Positives = 87/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 232 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEATGSLKIKKVGENGEVLAGAVFEVFNANN 291

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    QV  
Sbjct: 292 ESVGK--ITTGADGTAELNNLQIGTYTVKEIKAPTGYVSGDKPQTIEVKTGETGAVQVVN 349

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 350 NKVKGNIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIAKVEDLTYGKYYFLE 408

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  + +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 409 TKTPNGYLENKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 468

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 469 DASGKVIGEYKTDKKGEVNVKNLAYGKYSFVEKASPNGY 507



 Score = 58.4 bits (139), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 27/192 (14%), Positives = 50/192 (26%), Gaps = 19/192 (9%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 424 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAVFELKDASGKV 474

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK-------KITVSSKEKNQKQVFI 120
                      G     +L  G Y         G V        +I    K      V  
Sbjct: 475 IGEYK--TDKKGEVNVKNLAYGKYSFVEKASPNGYVLIKELIMFEIKEHGKIIELLAVNH 532

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 533 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 592

Query: 180 HYGKYNAIVSTV 191
                  +++  
Sbjct: 593 TVAPKGYVLNEE 604



 Score = 47.2 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 30/86 (34%), Gaps = 10/86 (11%)

Query: 208 AAKITFKLVSEMGGEAVADTAWSILTAS----GDTVGESANASPSMVLSEGDYTVIARNK 263
              +  K V    GE +A   + +  A+    G     +   +    L  G YTV     
Sbjct: 264 TGSLKIKKV-GENGEVLAGAVFEVFNANNESVGKITTGADGTAELNNLQIGTYTVKEIKA 322

Query: 264 ERNYS-----REFSVLTGKSTIVEVL 284
              Y      +   V TG++  V+V+
Sbjct: 323 PTGYVSGDKPQTIEVKTGETGAVQVV 348


>gi|229051028|ref|ZP_04194576.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus AH676]
 gi|228722337|gb|EEL73734.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus AH676]
          Length = 3041

 Score =  137 bits (344), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/308 (12%), Positives = 92/308 (29%), Gaps = 28/308 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T        +    K  +    +      + +   +  G  + I   ++      +    
Sbjct: 2643 TIERSQLTHASVTAKNGLTKGGVELTKVDSIDKKEMLEGAVFKI-TDLNGNDIRTNLVTN 2701

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRL 128
              G  ++ DL PGDY    +             K T+   +     V  +N    G + L
Sbjct: 2702 KDGKIIAKDLQPGDYQFIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTKGNVEL 2761

Query: 129  YSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
              +         +   F I +   H     L TDK     +  L   +Y+        + 
Sbjct: 2762 IKVDDAKQNTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHY 2821

Query: 187  IVSTV---VKVEPGK----IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
             ++       V+ G+     +  T       +    V       +    ++IL   G  +
Sbjct: 2822 DLNKTPIKFTVKKGQEKIASVTATNSLTKGAVELTKVDIDHHGTLEGAIFNILDQDGKII 2881

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKR 289
                  +         L  G+Y ++     + Y  +     F++   ++T ++  +  K+
Sbjct: 2882 REGLKTDQHGKVIVNDLKPGNYQLVETQAPKGYQLDASPINFTIDKAQATPLQSTVSNKK 2941

Query: 290  MDKNGQHN 297
            ++ +   +
Sbjct: 2942 IESSSGGD 2949



 Score =  126 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1695 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1754

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1755 VRTDLVTNNKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1814

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1815 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFI 1874

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1875 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTILEGAEF 1934

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1935 IIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 1994

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1995 KENITVTATN 2004



 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +I  G 
Sbjct: 1873 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTILEGA 1932

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1933 EFIIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 1992

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1993 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2052

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2053 VSDLRPGDYQFIETKAPEHYVLDETKIPFTIERSQTKEINVTGKNALKNGSVELTKIDDI 2112

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2113 DINTKLANAVFNLLDADGELVKEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKKT 2172

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2173 IVFTIKKSQTETLHVTATN 2191



 Score =  120 bits (299), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 52/310 (16%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1601 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1659

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1660 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1719

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1720 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNNKGMLVVDDLRPGNYKL 1779

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1780 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1839

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1840 TLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1899

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1900 DLPIPVTVKN 1909



 Score =  120 bits (299), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 48/318 (15%), Positives = 88/318 (27%), Gaps = 36/318 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I K + +++       +    +        N  +  S   
Sbjct: 2530 FVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELVKVDDINPDTKLSDAV 2589

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            ++I      K      T    G   + +L PGDY    +               T+   +
Sbjct: 2590 FNII-DAKGKIVRTDLTTDKDGKITATNLRPGDYQFIETKAPKDYDLNKTPISFTIERSQ 2648

Query: 113  KNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                 V   N    GG+ L  +       + +   F I      + +  L+T+K      
Sbjct: 2649 LTHASVTAKNGLTKGGVELTKVDSIDKKEMLEGAVFKITDLNGNDIRTNLVTNKDGKIIA 2708

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQNRAAKIT-----FKLVSEM 219
              L   +YQ        +  ++       +E  +   V +    +         K+    
Sbjct: 2709 KDLQPGDYQFIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTKGNVELIKVDDAK 2768

Query: 220  GGEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE---- 270
                +    + I+   G     D   +         L  GDY  I      +Y       
Sbjct: 2769 QNTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPI 2828

Query: 271  -FSVLTGKSTIVEVLMRQ 287
             F+V  G+  I  V    
Sbjct: 2829 KFTVKKGQEKIASVTATN 2846



 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 48/319 (15%), Positives = 99/319 (31%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K +        + +        +++ +   +   G
Sbjct: 2341 TYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDDVDGTTLEG 2400

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              + I   ++      +      G     DL PGDY    +     +         T++ 
Sbjct: 2401 AVFKIV-DMNGTVIRKNLVTNQQGKISVSDLHPGDYQFIETTAPKHYDLNKEPIPFTITK 2459

Query: 111  KEKNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             + +   V   N    G + L  +    G+ + D     +  +  + +  LITD     +
Sbjct: 2460 SQADPISVTATNSLTKGDVELSKVDDVDGTALKDAVFKITDLNGKDIRTELITDVHGKIS 2519

Query: 167  LVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG- 220
            +  L   +YQ        +       +   +K    + + VT  N   +   +LV     
Sbjct: 2520 VSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELVKVDDI 2579

Query: 221  --GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 ++D  ++I+ A G  V      +      +  L  GDY  I     ++Y      
Sbjct: 2580 NPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITATNLRPGDYQFIETKAPKDYDLNKTP 2639

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   + T   V  + 
Sbjct: 2640 ISFTIERSQLTHASVTAKN 2658



 Score =  113 bits (281), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/298 (14%), Positives = 84/298 (28%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        +  +  +   +++ D+   +         
Sbjct: 2082 TIERSQTKEINVTGKNALKNGSVELTKIDDIDINTKLANAVFNLLDAD-GELVKEGLKTN 2140

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +         T+   +     V   NA   G    
Sbjct: 2141 DEGKIVVENLRPGTYQFVETIAPEHYDLDKKTIVFTIKKSQTETLHVTATNALTKGAVKL 2200

Query: 130  SIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S        V  +  F I +         L+T++     +  L   +YQ        + +
Sbjct: 2201 SKVDDVDGTVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYV 2260

Query: 188  VSTV---VKVEPGK----IIDVTIQNRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+     +  T   +   I   K+        +AD  +++L   G  +
Sbjct: 2261 LDETPIKFTIEKGQKKAISLTATNSLKQGSIELLKVDDLNTQTKLADAVFNLLDQDGKVL 2320

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   S        L  G Y  +      +Y  +     F++   +  I  V M+ 
Sbjct: 2321 KTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKN 2378



 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/312 (10%), Positives = 85/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1127 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1185

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1186 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1245

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1246 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNNQGQITVDNLKPGTYYLQ 1305

Query: 179  SHYGKYNAIVSTV---VKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  + +      ++  +        T              +  G+ +A   +S+
Sbjct: 1306 ETTAPEHYKLDSTPIQFTIKEDQTTVINRTATNSLIPGSAILTKFDKD-GKTLAGAEFSV 1364

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                   +               +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1365 RDRYNKVIRGYEKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKKPIEFTIIKSQKK 1424

Query: 280  IVEVLMRQKRMD 291
             + V      + 
Sbjct: 1425 ALTVTATNHLIK 1436



 Score =  110 bits (273), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 42/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++       +   I K + K +                ++ +   +   G  +
Sbjct: 1398 FVEEKAPKDYDIDKKPIEFTIIKSQKKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1457

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1458 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGAYKFIETEAPKDYTLSTNPIEFTIDKSQ 1517

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1518 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1577

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1578 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1637

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1638 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1697

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1698 KPIKFTITESQTTQATVTAKN 1718



 Score = 75.3 bits (183), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/240 (12%), Positives = 60/240 (25%), Gaps = 22/240 (9%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGK-------RVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++       +   I + + K         +    +           +   G  
Sbjct: 2718 FIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTKGNVELIKVDDAKQNTTLEGAV 2777

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +           T    G  V  +L PGDY    +     +       K TV   +
Sbjct: 2778 FKIVNKD-GHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNKTPIKFTVKKGQ 2836

Query: 113  KNQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            +    V   N    G + L  +       +               +  L TD+     + 
Sbjct: 2837 EKIASVTATNSLTKGAVELTKVDIDHHGTLEGAIFNILDQDGKIIREGLKTDQHGKVIVN 2896

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEA 223
             L   NYQ+               ++  +       +  T+ N+  + +     +     
Sbjct: 2897 DLKPGNYQLVETQAPKGYQLDASPINFTIDKAQATPLQSTVSNKKIESSSGGDDKPVTPP 2956


>gi|229065007|ref|ZP_04200305.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus AH603]
 gi|228716308|gb|EEL68020.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus AH603]
          Length = 2776

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 39/307 (12%), Positives = 93/307 (30%), Gaps = 28/307 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T      +I+    K  +    +        + ++   G  + I + ++           
Sbjct: 2362 TIEKSQVSIATVTMKNSLTKGSVELSKVDDIDGST-LEGAVFKIVN-MNGDVIRKDLITN 2419

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN---AGGIRL 128
              G     DL PGDY    +     +         T+   +     V   N    G + L
Sbjct: 2420 QQGKISVSDLRPGDYQFIETTAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVEL 2479

Query: 129  YSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
              +    GS +          +  + ++ L T+K    ++  L   +YQ           
Sbjct: 2480 TKVDNIDGSTLEGAIFKIVDMNEHDVRSDLTTNKDGKISVSDLRPGDYQFVETKAPTGYD 2539

Query: 188  VST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGEAVADTAWSILTASGDTV- 239
            +S       +  G+    +++         I    V       +    ++IL   G  + 
Sbjct: 2540 LSAKPIPFTITKGQSGVTSVKALNGLTTGSIELTKVDIDHRGTLEGAIFNILDHDGKIIR 2599

Query: 240  ----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRM 290
                 +         L  G+Y ++       Y  +     F++   ++T +++ +  K++
Sbjct: 2600 EGLKTDQHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISFTIEKAQATPLQITVSNKKI 2659

Query: 291  DKNGQHN 297
            + +   +
Sbjct: 2660 ESSPGGD 2666



 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 48/319 (15%), Positives = 96/319 (30%), Gaps = 35/319 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      E+   ++  +N  I KG+ + +                ++ +   +   G  +
Sbjct: 1591 FVETQAPEHYELSTEPINFTIEKGQKEIITVTAENRLVPGNVELLKVDDVDGNALEGAVF 1650

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEK 113
             I    + K   ++      G      L P  Y    +               T+   + 
Sbjct: 1651 KIV-DENGKDVHMNLITNKEGKIAVSGLRPSKYQFIETKAPEHYDLNKKPIDFTIEKSQT 1709

Query: 114  NQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSN--PNHKALLITDKVRSGTLV 168
              K +   N    GGI L  +         ++  F I ++   +    L TDK     + 
Sbjct: 1710 ATKSITATNSLTKGGIELTKVDSLNDKEKLEDAVFKIVNDKDEDVHTNLTTDKEGKLIVK 1769

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMG 220
             L    Y+I               +   ++    +++ +T +N   K   KL        
Sbjct: 1770 DLRPGKYKIVETKAPIYYDVNIEPIEFTIEKSQKELLPLTFKNSLTKGKVKLFKEDDVDS 1829

Query: 221  GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
              A+A   + +  A+G  +      +         L+ GDY  I      +Y  +     
Sbjct: 1830 KIALAGAVFKLQDANGTEIAKDLKTDDYGVLVIPDLAPGDYQFIETAAPEHYKLDQTPIK 1889

Query: 271  FSVLTGKSTIVEVLMRQKR 289
            F++  G    + V +  K 
Sbjct: 1890 FTIKKGNEADLPVTVTVKN 1908



 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/316 (14%), Positives = 94/316 (29%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++   +   +   I K + + +    + +         ++ +   ++  G  +
Sbjct: 1969 FIEVKAPKDYDLSKDPIPFTIGKSQKENITVTAKNSLTKGAVTLTKIDDIDRTMLKGAIF 2028

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I D    K+   +      G     DL PGDY    +     +   G     T+   + 
Sbjct: 2029 TIVDMD-GKEVHTNLVTDDNGEISVSDLRPGDYQFIETQAPEHYVLDGTPIPFTIKKSQT 2087

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                V   N    G + L  I    +        F++           L T+      + 
Sbjct: 2088 ETITVTSKNTFKKGNVELTKIDDIDTNTTLANAVFNLLDADGELVEEGLKTNDEGKIVVE 2147

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQN--RAAKITFKLVSEMGG 221
             L    YQ        +       +   +K    +I+ VT +N      +    V  +  
Sbjct: 2148 NLRPGTYQFVETIAPEHYGLNKKPIVFTIKKSQTEILHVTAKNALTKGAVELSKVDNIDD 2207

Query: 222  EAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++I+  +G       V  S        L  GDY  I     ++Y  +     F
Sbjct: 2208 TTLEGAVFNIVDMNGTVIHKDLVTNSKGKIEINDLRPGDYQFIETEAPKHYVLDETPIGF 2267

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++  G+   + +  + 
Sbjct: 2268 TIEKGQKKSISLTAKN 2283



 Score =  125 bits (314), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 40/286 (13%), Positives = 80/286 (27%), Gaps = 29/286 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    +        + T+   G  ++I   ++             G     DL P
Sbjct: 2187 TAKNALTKGAVELSKVDNIDDTT-LEGAVFNIV-DMNGTVIHKDLVTNSKGKIEINDLRP 2244

Query: 89   GDYLISASFGH-----VGVVKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIVD 140
            GDY    +               T+   +K    +   N    G I L  +         
Sbjct: 2245 GDYQFIETEAPKHYVLDETPIGFTIEKGQKKSISLTAKNSLKQGSIELIKVDDLNDQTKL 2304

Query: 141  DELTFSIYSNPNH--KALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
             +  F++        K  L T+      +  L    YQ        +  +        +E
Sbjct: 2305 ADAVFNLLDQNGKVLKTDLKTNGEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVFTIE 2364

Query: 196  PGKIIDVTIQ----NRAAKITFKLVSEMGGEAVADTAWSILTASGDT-----VGESANAS 246
              ++   T+          +    V ++ G  +    + I+  +GD      +       
Sbjct: 2365 KSQVSIATVTMKNSLTKGSVELSKVDDIDGSTLEGAVFKIVNMNGDVIRKDLITNQQGKI 2424

Query: 247  PSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVLMRQ 287
                L  GDY  I     ++Y        F++  G++  + V  + 
Sbjct: 2425 SVSDLRPGDYQFIETTAPKHYDLNKEPIPFTIEKGQAEPISVTAKN 2470



 Score =  120 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 44/317 (13%), Positives = 83/317 (26%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F       +  T  T +   I KG+ K V       +    +T              G  
Sbjct: 1403 FVETQAPLHYVTDPTPIKFEIEKGQTKAVSVKAENNLIKGGVTLTKVDDVEENVTLEGAV 1462

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + I +   +     +      G  +  +L PG Y    +               T+   +
Sbjct: 1463 FKIVNEKGD-TIQQNLKTGSDGKLIVKNLEPGKYKFIETEAPKYYELNKEPIDFTIEKSQ 1521

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
             +   V   N    G   L  +         +   F +           L TD      +
Sbjct: 1522 TSFVSVTAKNSLTKGDAELVKVDNVDKKESLEGAVFKVIDEHGKDVRTDLTTDAEGKIKV 1581

Query: 168  VRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
              L    YQ        +  +ST      +E G+   +T+          +    V ++ 
Sbjct: 1582 SDLRPGKYQFVETQAPEHYELSTEPINFTIEKGQKEIITVTAENRLVPGNVELLKVDDVD 1641

Query: 221  GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----E 270
            G A+    + I+  +G  V                L    Y  I      +Y       +
Sbjct: 1642 GNALEGAVFKIVDENGKDVHMNLITNKEGKIAVSGLRPSKYQFIETKAPEHYDLNKKPID 1701

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F++   ++    +    
Sbjct: 1702 FTIEKSQTATKSITATN 1718



 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 49/319 (15%), Positives = 96/319 (30%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   A  E+     T +   I KG    +     V    +T    LT   +  ++   G 
Sbjct: 1872 FIETAAPEHYKLDQTPIKFTIKKGNEADLPVTVTVKNSLLTGGVTLTKVDDVDSTTLEGA 1931

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA-----SFGHVGVVKKITVSS 110
             + I D+  + K      T    G   + DL PGDY          +         T+  
Sbjct: 1932 EFIIVDAHDTKKVIRKGLTTDENGIVTASDLRPGDYQFIEVKAPKDYDLSKDPIPFTIGK 1991

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        +     F+I           L+TD     +
Sbjct: 1992 SQKENITVTAKNSLTKGAVTLTKIDDIDRTMLKGAIFTIVDMDGKEVHTNLVTDDNGEIS 2051

Query: 167  LVRLGTNNYQITSHYGKYNAIVS---TVVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        ++  +   +T+      +   +    + + 
Sbjct: 2052 VSDLRPGDYQFIETQAPEHYVLDGTPIPFTIKKSQTETITVTSKNTFKKGNVELTKIDDI 2111

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y      
Sbjct: 2112 DTNTTLANAVFNLLDADGELVEEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYGLNKKP 2171

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++ I+ V  + 
Sbjct: 2172 IVFTIKKSQTEILHVTAKN 2190



 Score =  115 bits (288), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 38/321 (11%), Positives = 88/321 (27%), Gaps = 34/321 (10%)

Query: 3    ISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFD 62
            I+ +S        T +  +  +   G G        +       +N  +  +G  + ++ 
Sbjct: 1123 IAGNSLTVKNTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNAPLAGAEFTLY- 1181

Query: 63   SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKN 114
              + K      T    G     +L    YL+  +    G V          + + S+E  
Sbjct: 1182 DRTGKTVIRKITTDKDGIAKFNNLKRDKYLLKETKAPAGYVISWDLKQGRLVELGSQETT 1241

Query: 115  QKQVFILN-AGGIRLYSIYKPGSPIVDDELTFSIYSNPN----HKALLITDKVRSGTLVR 169
              ++      G   L  +    +        F++    N        L T++    T+  
Sbjct: 1242 TYKLSNKKFVGKAVLTKVDDLNNNETLKGAVFALLDKNNKVIPGYEKLATNENGQITVDP 1301

Query: 170  LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L    YQ+       +  +++      V   +   + +      +   +          +
Sbjct: 1302 LKPGTYQLKEIEAPVHYDLNSQPIWFTVSEDQTTVINVTAKNSLKKGSVILTKFD-ENKK 1360

Query: 223  AVADTAWSILTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             +    +S+    G  +                  L  G Y  +      +Y  +     
Sbjct: 1361 LLEGAIFSLQDEKGKVIPGYEQLTTNKDGYIEVKNLRPGKYQFVETQAPLHYVTDPTPIK 1420

Query: 271  FSVLTGKSTIVEVLMRQKRMD 291
            F +  G++  V V      + 
Sbjct: 1421 FEIEKGQTKAVSVKAENNLIK 1441


>gi|254724016|ref|ZP_05185801.1| lpxtg-motif cell wall anchor domain protein [Bacillus anthracis str.
            A1055]
          Length = 1086

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 90/326 (27%), Gaps = 35/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +N  + K +           +    +        +  +   G  
Sbjct: 686  FIETKAPKHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGAT-LEGAV 744

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++        T    G     DL PGDY    +     +         TV   +
Sbjct: 745  FKIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFTVEKSQ 803

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                 V   N    G    +          +   F I  +  H     L TDK    ++ 
Sbjct: 804  TATASVTATNSLTKGAVELTKVDDIDGTTLEGAIFKIVDSNGHDVRADLTTDKDGKISVS 863

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         +    V     
Sbjct: 864  DLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 923

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 924  GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 983

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   +++ +++ +  K+++ +   +
Sbjct: 984  TIEKAQASPLQITVSNKKVESSSGGD 1009



 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 48/314 (15%), Positives = 85/314 (27%), Gaps = 35/314 (11%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKG-------KGKRVVDAQRITCEARLTENSTSIDSGVS 57
           F       +     T +N  + K          K  +    +        + T+   G  
Sbjct: 593 FVETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGTT-LEGAI 651

Query: 58  WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
           + I D  +        T    G     DL PGDY    +     +         TV   +
Sbjct: 652 FKIVDQ-NGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQTPINFTVEKSQ 710

Query: 113 KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
                V   N    G    +          +   F I     +     L TDK    ++ 
Sbjct: 711 TATASVTATNSLTKGAVELTKVDDIDGATLEGAVFKIVDMNGNDVRTDLTTDKDGKISVS 770

Query: 169 RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
            L   +YQ        +  ++       VE  +    ++          +    V ++ G
Sbjct: 771 DLRPGDYQFIETKAPKHYDLNQNPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDG 830

Query: 222 EAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSR-----EF 271
             +    + I+ ++G     D   +         L  GDY  I       Y        F
Sbjct: 831 TTLEGAIFKIVDSNGHDVRADLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPF 890

Query: 272 SVLTGKSTIVEVLM 285
           ++  G+S +  V  
Sbjct: 891 TITKGQSQVTSVTA 904



 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/315 (14%), Positives = 90/315 (28%), Gaps = 33/315 (10%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
           F       +     T +   + KG+ K        +        +++ +   S      +
Sbjct: 407 FIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSTLKDAVF 466

Query: 59  HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
            I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 467 KIV-DMNGNDVRTDLTTNKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQT 525

Query: 114 NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
               V   N    G + L  +    G+ +          +  + +  L TDK    ++  
Sbjct: 526 ATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDQNGNDVRTDLTTDKDGKISVSD 585

Query: 170 LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
           L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 586 LRPGDYQFVETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGT 645

Query: 223 AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
            +    + I+  +G+ V      +         L  GDY  I     ++Y        F+
Sbjct: 646 TLEGAIFKIVDQNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQTPINFT 705

Query: 273 VLTGKSTIVEVLMRQ 287
           V   ++    V    
Sbjct: 706 VEKSQTATASVTATN 720



 Score =  115 bits (287), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 44/287 (15%), Positives = 77/287 (26%), Gaps = 29/287 (10%)

Query: 29  KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
             K  +    +        N  +  S   ++I      K    + T    G   + +L P
Sbjct: 156 TAKNSLIEGAVELIKVDDINPDTKLSDAVFNII-DAKGKIVRTNLTTDKDGKVSASNLRP 214

Query: 89  GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
           GDY    +               T+   +     V   N    GG+ L  +    +    
Sbjct: 215 GDYQFVETKAPKDYDLNETPIPFTIEKSQSTHVSVTAKNGLTKGGVELTKVDSIDAKDTL 274

Query: 141 DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
           +   F I     +     L+T+K        L   +YQ        +  ++       +E
Sbjct: 275 EGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNETPIKFTIE 334

Query: 196 PGKIIDV----TIQNRAAKITF-KLVSEMGGEAVADTAWSILTASG-----DTVGESANA 245
             +   V    T       +   K+        +    + I+   G     D   +    
Sbjct: 335 RSQTKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHDVRTDLTTDKNGR 394

Query: 246 SPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                L  GDY  I      +Y        F+V  G+  I  V    
Sbjct: 395 LVVDELPPGDYEFIETKAPTHYDLNETPIKFTVKKGQEKIASVTATN 441



 Score =  103 bits (256), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 41/252 (16%), Positives = 72/252 (28%), Gaps = 27/252 (10%)

Query: 63  SISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQ 117
            +       S T    G     DL PGDY    +               T+   +     
Sbjct: 2   DMKGTVIRKSLTTNSQGKISVPDLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPIS 61

Query: 118 VFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL--ITDKVRSGTLVRLGTN 173
           V   N    G    S       I  +   F I     H       TD     ++  L   
Sbjct: 62  VTAKNSLTKGAVELSKVDDIDGIALEGAIFKIVDMNGHDVRTGITTDAKGKVSISDLHPG 121

Query: 174 NYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQNRAAKIT-----FKLVSEMGGEAVA 225
           +YQ        +  +        +E  +   + +  + + I       K+        ++
Sbjct: 122 DYQFIETTAPKHYKLDATPIKFTIEKSQAEKLQVTAKNSLIEGAVELIKVDDINPDTKLS 181

Query: 226 DTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLT 275
           D  ++I+ A G  V      +      +  L  GDY  +     ++Y        F++  
Sbjct: 182 DAVFNIIDAKGKIVRTNLTTDKDGKVSASNLRPGDYQFVETKAPKDYDLNETPIPFTIEK 241

Query: 276 GKSTIVEVLMRQ 287
            +ST V V  + 
Sbjct: 242 SQSTHVSVTAKN 253


>gi|229104052|ref|ZP_04234728.1| hypothetical protein bcere0019_32020 [Bacillus cereus Rock3-28]
 gi|228679396|gb|EEL33597.1| hypothetical protein bcere0019_32020 [Bacillus cereus Rock3-28]
          Length = 1072

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/279 (14%), Positives = 87/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +G  + +F++ +
Sbjct: 232 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEATGSLKIKKVGENGEVLAGAVFEVFNANN 291

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    QV  
Sbjct: 292 ESVGK--ITTGADGTAELNNLQIGTYTVKEIKAPTGYVSGDKPQTIEVKTGETGAVQVVN 349

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            I+ + + F++++    +   +  K      V  L    Y    
Sbjct: 350 NKVKGNIEIKKLSDSGKILPN-VEFTVFTEDGKEVKKVVTKENGIAKVEDLTYGKYYFLE 408

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  + +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 409 TKTPNGYLENKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 468

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 469 DASGKVIGEYKTDKKGEVNVKNLAYGKYSFVEKASPNGY 507



 Score = 59.2 bits (141), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 28/192 (14%), Positives = 52/192 (27%), Gaps = 19/192 (9%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 424 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAVFELKDASGKV 474

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV---KKITVSSKEKNQKQ----VFI 120
                      G     +L  G Y         G V   + I    KE  +      V  
Sbjct: 475 IGEYK--TDKKGEVNVKNLAYGKYSFVEKASPNGYVLIKEPIVFEIKEHGKIIELLAVNH 532

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 533 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 592

Query: 180 HYGKYNAIVSTV 191
                  +++  
Sbjct: 593 TVAPKGYVLNEE 604



 Score = 47.2 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 30/86 (34%), Gaps = 10/86 (11%)

Query: 208 AAKITFKLVSEMGGEAVADTAWSILTAS----GDTVGESANASPSMVLSEGDYTVIARNK 263
              +  K V    GE +A   + +  A+    G     +   +    L  G YTV     
Sbjct: 264 TGSLKIKKV-GENGEVLAGAVFEVFNANNESVGKITTGADGTAELNNLQIGTYTVKEIKA 322

Query: 264 ERNYS-----REFSVLTGKSTIVEVL 284
              Y      +   V TG++  V+V+
Sbjct: 323 PTGYVSGDKPQTIEVKTGETGAVQVV 348


>gi|42784532|ref|NP_981779.1| cell wall anchor domain-containing protein [Bacillus cereus ATCC
            10987]
 gi|42740464|gb|AAS44387.1| LPXTG-motif cell wall anchor domain protein [Bacillus cereus ATCC
            10987]
          Length = 3242

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/325 (12%), Positives = 90/325 (27%), Gaps = 33/325 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F       +     T +   + KG+ K        +        +++ +   S      +
Sbjct: 2826 FIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDVDGSALKDAVF 2885

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +               TV   + 
Sbjct: 2886 KIV-DMNGNNVRSDLTTNKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQT 2944

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVR 169
                V   N    G    +       +  +   F I     +     L T+K    ++  
Sbjct: 2945 ATASVIAKNSLTKGAVELTKVDDIDGVTLEGAVFKIVDMNGNDVRSDLTTNKDGKISVSD 3004

Query: 170  LGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
            L   +YQ           ++       +  G+    ++          +    V      
Sbjct: 3005 LRPGDYQFIETKAPTGYDLNAKPIPFTITKGQAQVTSVTALNSLTTGSMELMKVDMDHNG 3064

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FS 272
             +    ++IL   G  V      +         L  G+Y ++       Y  +     F+
Sbjct: 3065 TLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETTAPTGYQLDASPISFT 3124

Query: 273  VLTGKSTIVEVLMRQKRMDKNGQHN 297
            +   ++T +++ +  K++D +    
Sbjct: 3125 IEKAQATPLQITVSNKKIDSSSGGE 3149



 Score =  128 bits (322), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 43/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
                 +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1709 KNTNPIKFTITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1768

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1769 VRTELVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1828

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S I      F++      +    L T+      +  L   +YQ  
Sbjct: 1829 LTKGKVKLIKEDDVESSIALAGAVFTLQDATGKEIAKDLKTNDYGVLVIPDLAPGDYQFI 1888

Query: 179  SHYGKYNAIVS-TVVKVEPGK--------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +    +K    K         + VT       +T   V ++ G  +    +
Sbjct: 1889 ETSAPEHYKLDPKPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGATLEGAEF 1948

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y        F++   +
Sbjct: 1949 IIVDAHDTKKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYDLRKDPIPFTIGKSQ 2008

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 2009 KENISVTATN 2018



 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 101/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N  +  +   
Sbjct: 2264 FIETKAPKHYVLNETPIHFTIEKGQKKAISLTAKNSLKQGSIELIKVDDLNDQTKLADAV 2323

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  +             G     +L PG Y    +     +        +TV   +
Sbjct: 2324 FNLLDQ-NGTVIKTDLKTNGEGKITVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQ 2382

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K+   V + N    GG+ L  +    G+ +          +       L+T+      + 
Sbjct: 2383 KDVATVTMTNSLTKGGVELTKVDDVDGTTLEGAVFNIVDMNGTVIHKDLVTNSKGKIEIN 2442

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    + ++ G
Sbjct: 2443 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKMDDIDG 2502

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G+ V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2503 TALEGAIFKIVDMNGNDVRTGITTDAKGKVSIPDLHPGDYQFIETTAPKHYKLDATPIKF 2562

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2563 TIEKSQAEKLQVTAKN 2578



 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/287 (15%), Positives = 77/287 (26%), Gaps = 29/287 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              K  +    +        N  +  S   ++I      K    + T    G   + +L P
Sbjct: 2575 TAKNSLIEGAVELIKVDDINQDTKLSDAVFNII-DAKGKVVRTNLTTDKDGKVSASNLRP 2633

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVD 140
            GDY    +               T+   +     V   N    GG+ L  +    +    
Sbjct: 2634 GDYQFVETKAPKDYDLNKTPIPFTIEKSQTTHVSVTAKNGLTKGGVELTKVDSLDAKETL 2693

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
            +   F I     +     L+T+K        L   +YQ        +  ++       +E
Sbjct: 2694 EGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEDPIKFTIE 2753

Query: 196  PGKIIDV----TIQNRAAKITF-KLVSEMGGEAVADTAWSILTASG-----DTVGESANA 245
              +   V    T       +   K+        +    + I+   G     D   +    
Sbjct: 2754 RSQTKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHDVRTDLTTDKNGR 2813

Query: 246  SPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                 L  GDY  I      +Y        F+V  G+  I  V    
Sbjct: 2814 LVVDELPPGDYEFIETKAPTHYDLNETPIKFTVKKGQEKIASVTATN 2860



 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/310 (17%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1615 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1673

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++ DL PGDY          +       K T++  +     V   N 
Sbjct: 1674 IRENIKTGADGKAIATDLRPGDYKFIEVTAPKYYDKNTNPIKFTITESQTTSATVTAKNS 1733

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1734 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTELVTNSEGKLVVDDLRPGNYKL 1793

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGE---AVADTAW 229
                           +   ++    K++ +T +N   K   KL+ E   E   A+A   +
Sbjct: 1794 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSIALAGAVF 1853

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +                L+ GDY  I  +   +Y  +     F++  G   
Sbjct: 1854 TLQDATGKEIAKDLKTNDYGVLVIPDLAPGDYQFIETSAPEHYKLDPKPIKFTIKKGSKD 1913

Query: 280  IVEVLMRQKR 289
             + V +    
Sbjct: 1914 DLPVPVTVTN 1923



 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 45/319 (14%), Positives = 92/319 (28%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   +  E+       +   I KG    +     V    +T    LT   +   +   G 
Sbjct: 1887 FIETSAPEHYKLDPKPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGATLEGA 1946

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1947 EFIIVDAHDTKKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYDLRKDPIPFTIGK 2006

Query: 111  KEKNQKQVFILN----AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             +K    V   N     G I         + +          +    +  L+TD     +
Sbjct: 2007 SQKENISVTATNSLTKGGVILTKIDDIDRTMLKGAIFKVVDMNGNEVRTNLVTDDNGEIS 2066

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +   +T+      +   +    + + 
Sbjct: 2067 VSNLRPGDYQFIETAAPEHYVLDEKPIPFTIERSQTEKITVTGKNTLKKGSVELTKIDDI 2126

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y      
Sbjct: 2127 DTDTKLANAVFNLLDADGEIVEEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLNKKP 2186

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + +  + 
Sbjct: 2187 IKFTIKKSQTETLHITAKN 2205



 Score =  114 bits (284), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/307 (12%), Positives = 76/307 (24%), Gaps = 31/307 (10%)

Query: 11   AENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNT 70
               +  T      +++       +    +               G  + I   ++N    
Sbjct: 1522 TNPIEFTIDKSQQSLATVTATNSLKTGEVELLKVDEFGDKKPLQGAVFKIV-DVNNNDVR 1580

Query: 71   LSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA-- 123
               T    G   +  L PG Y    +             + T+   +K    V   NA  
Sbjct: 1581 TDLTTDADGKTKADKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALK 1640

Query: 124  GGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSGTLVRLGTNNYQITS 179
             G    +          +   F I    +     +  + T          L   +Y+   
Sbjct: 1641 PGDVELTKVDDIDGTALEGAVFKIVDANDEKKVIRENIKTGADGKAIATDLRPGDYKFIE 1700

Query: 180  HYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVS-EMGGEAVADTAWSI 231
                     +T      +   +    T+          I    V+     E +    + I
Sbjct: 1701 VTAPKYYDKNTNPIKFTITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKI 1760

Query: 232  LTASGDT------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTI 280
            +    +       V  S        L  G+Y +I       Y       EF++  G+  +
Sbjct: 1761 VNRDTNEDVRTELVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKL 1820

Query: 281  VEVLMRQ 287
            + +  + 
Sbjct: 1821 LPLTFKN 1827



 Score =  113 bits (282), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/298 (12%), Positives = 89/298 (29%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   +++ D+   +         
Sbjct: 2096 TIERSQTEKITVTGKNTLKKGSVELTKIDDIDTDTKLANAVFNLLDAD-GEIVEEGLKTN 2154

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA---GGIRL 128
              G  V  +L PG Y    +     +       K T+   +     +   NA   GG+ L
Sbjct: 2155 DEGKIVVENLRPGTYQFVETIAPEHYDLNKKPIKFTIKKSQTETLHITAKNALTKGGVEL 2214

Query: 129  YSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
              +    G+ +          +       L+T+   +  +  L   +YQ        + +
Sbjct: 2215 SKVDDIDGTKLEGAVFNIVDMNGTVIHKDLVTNSKGNIEIDDLRPGDYQFIETKAPKHYV 2274

Query: 188  VSTV---VKVEPGKIIDVTIQ----NRAAKITF-KLVSEMGGEAVADTAWSILTASGDTV 239
            ++       +E G+   +++      +   I   K+        +AD  +++L  +G  +
Sbjct: 2275 LNETPIHFTIEKGQKKAISLTAKNSLKQGSIELIKVDDLNDQTKLADAVFNLLDQNGTVI 2334

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                            L  G Y  +     ++Y  +      +V   +  +  V M  
Sbjct: 2335 KTDLKTNGEGKITVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKDVATVTMTN 2392



 Score =  112 bits (279), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 44/319 (13%), Positives = 93/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++       +   I K + K V                 T++   +  +G  +
Sbjct: 1414 FVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAVF 1473

Query: 59   HIFDSISNKKNTLSTT-KKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK           G     DL PG Y    +             + T+   +
Sbjct: 1474 KIVDAHDEKKVIRENVKTGADGKVTVKDLEPGTYKFIETEAPKDYVLNTNPIEFTIDKSQ 1533

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1534 QSLATVTATNSLKTGEVELLKVDEFGDKKPLQGAVFKIVDVNNNDVRTDLTTDADGKTKA 1593

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1594 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1653

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
            G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1654 GTALEGAVFKIVDANDEKKVIRENIKTGADGKAIATDLRPGDYKFIEVTAPKYYDKNTNP 1713

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++T   V  + 
Sbjct: 1714 IKFTITESQTTSATVTAKN 1732



 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 37/286 (12%), Positives = 78/286 (27%), Gaps = 33/286 (11%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
              +       ++ T   +G  + ++D           T    G     +L    YLI  +
Sbjct: 1169 GSLQIIKVDDKDQTVRLAGAEFTLYDQT-GTTAIRPITTGDDGVAKFNNLRRDKYLIKET 1227

Query: 97   FGHVGVVKK--------ITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIY 148
                G V          + + S+E  +         G  + +     S    +   FS+ 
Sbjct: 1228 KAPTGYVISKELREGILVELGSEEITKYTFTNKKFVGKVVLTKTDAKSRERLEHAVFSLL 1287

Query: 149  SNP----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKII- 200
                        L T+     T+  L    Y +       +  +      VK+   +   
Sbjct: 1288 DQNKQVIPEHKELTTNDKGQITVDHLKPGTYYLQEIKAPEHYKLDDRLIEVKIAEDQTTV 1347

Query: 201  ---DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV-------GESANASPSMV 250
                 T            V +  G+ +A   +S+     + +               +  
Sbjct: 1348 INRTATNSLIPGSAILTKVDKD-GKTLAGAEFSVRDRHNNVIRGYEKLTTNDQGQIEAKD 1406

Query: 251  LSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
            L  GDY  +     ++Y  +     F+++  +   V V      + 
Sbjct: 1407 LRPGDYQFVEEKAPKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIK 1452



 Score = 97.3 bits (240), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/245 (14%), Positives = 68/245 (27%), Gaps = 29/245 (11%)

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--- 123
              T    G      L PG Y +              + ++ ++  +         N+   
Sbjct: 1299 ELTTNDKGQITVDHLKPGTYYLQEIKAPEHYKLDDRLIEVKIAEDQTTVINRTATNSLIP 1358

Query: 124  GGIRLYSIYKPGSPIVDDELTFSIYSNP--NHKALLITDKVRSGTLVRLGTNNYQITSHY 181
            G   L  + K G  +   E +     N        L T+         L   +YQ     
Sbjct: 1359 GSAILTKVDKDGKTLAGAEFSVRDRHNNVIRGYEKLTTNDQGQIEAKDLRPGDYQFVEEK 1418

Query: 182  GKYNA-----IVSTVVKVEPGKIIDVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTA 234
               +       +   +     K + VT  N      +T     ++ G A+A   + I+ A
Sbjct: 1419 APKDYDIDKKPIEFTIVKSQKKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAVFKIVDA 1478

Query: 235  SG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVE 282
                     +    +        L  G Y  I     ++Y       EF++   + ++  
Sbjct: 1479 HDEKKVIRENVKTGADGKVTVKDLEPGTYKFIETEAPKDYVLNTNPIEFTIDKSQQSLAT 1538

Query: 283  VLMRQ 287
            V    
Sbjct: 1539 VTATN 1543


>gi|254761543|ref|ZP_05213563.1| collagen adhesion protein, C-terminal [Bacillus anthracis str.
           Australia 94]
          Length = 785

 Score =  136 bits (342), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 93/326 (28%), Gaps = 35/326 (10%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
           F       +     T +N  + K +           +    +        +  +   G  
Sbjct: 385 FVETKAPTHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGAT-LEGAV 443

Query: 58  WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
           + I   ++        T    G     DL PGDY    +     +         TV   +
Sbjct: 444 FKIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFTVEKSQ 502

Query: 113 KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                V   N    G + L  +    G+ +          +  + +A L TDK    ++ 
Sbjct: 503 TATASVTATNSLTKGAVELMKVDDIDGTTLEGAIFKIVDSNGHDVRADLTTDKDGKISVS 562

Query: 169 RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
            L   +YQ                +   +     ++  VT         +    V     
Sbjct: 563 DLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 622

Query: 222 EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 623 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 682

Query: 272 SVLTGKSTIVEVLMRQKRMDKNGQHN 297
           ++   +++ +++ +  K+++ +   +
Sbjct: 683 TIEKAQASPLQITVSNKKVESSSGGD 708



 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/315 (14%), Positives = 90/315 (28%), Gaps = 33/315 (10%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
           F       +     T +   + KG+ K        +        +++ +   S      +
Sbjct: 199 FIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSTLKDAVF 258

Query: 59  HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
            I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 259 KIV-DMNGNDVRTDLTTNKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQT 317

Query: 114 NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
               V   N    G + L  +    G+ +          +  + +  L TDK    ++  
Sbjct: 318 ATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDQNGNDVRTDLTTDKDGKISVSD 377

Query: 170 LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
           L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 378 LRPGDYQFVETKAPTHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGA 437

Query: 223 AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
            +    + I+  +G+ V      +         L  GDY  I     ++Y        F+
Sbjct: 438 TLEGAVFKIVDMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFT 497

Query: 273 VLTGKSTIVEVLMRQ 287
           V   ++    V    
Sbjct: 498 VEKSQTATASVTATN 512



 Score =  115 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/303 (14%), Positives = 86/303 (28%), Gaps = 28/303 (9%)

Query: 12  ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
           E +  T       +     K  +   ++         S+   +G  + +    +  +   
Sbjct: 25  EPIEFTIEKGQQTLLPLTFKNSLTKGKVKLIKEDDVESSIALAGAVFTL-QDANGTEIAK 83

Query: 72  STTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEKNQKQVFILN---A 123
                  G  V  DL PGDY    +             K T+   +     V   N    
Sbjct: 84  DLKTDEHGVLVIPDLAPGDYQFIETAAPEHYKLDQTPIKFTIERSQTKHVFVTATNSLTK 143

Query: 124 GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHY 181
           G + L  +         +   F I +   H     L TDK     +  L   +Y+     
Sbjct: 144 GSVELIKVDDVEENTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETK 203

Query: 182 GKYNAIVSTV---VKVEPGK----IIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTA 234
              +  ++       V+ G+     +  T       +    V ++ G  + D  + I+  
Sbjct: 204 APTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSTLKDAVFKIVDM 263

Query: 235 SGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGKSTIVEVL 284
           +G+ V                L  GDY  +      +Y        F+V   ++    V 
Sbjct: 264 NGNDVRTDLTTNKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQTATASVT 323

Query: 285 MRQ 287
            + 
Sbjct: 324 AKN 326



 Score = 95.8 bits (236), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 65/233 (27%), Gaps = 28/233 (12%)

Query: 83  SFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRLYSIYKP 134
             DL PG+Y +  +             + T+   ++    +   N    G ++L      
Sbjct: 1   VDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNSLTKGKVKLIKEDDV 60

Query: 135 GSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV- 191
            S I      F++      +    L TD+     +  L   +YQ        +  +    
Sbjct: 61  ESSIALAGAVFTLQDANGTEIAKDLKTDEHGVLVIPDLAPGDYQFIETAAPEHYKLDQTP 120

Query: 192 --VKVEPGKIIDV----TIQNRAAKITF-KLVSEMGGEAVADTAWSILTASG-----DTV 239
               +E  +   V    T       +   K+        +    + I+   G     D  
Sbjct: 121 IKFTIERSQTKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHDVRTDLT 180

Query: 240 GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
            +         L  GDY  I      +Y        F+V  G+  I  V    
Sbjct: 181 TDKNGRLVVDELPPGDYEFIETKAPTHYDLNETPIKFTVKKGQEKIASVTATN 233


>gi|49188193|ref|YP_031446.1| collagen adhesion protein, C-terminal [Bacillus anthracis str.
           Sterne]
 gi|49182120|gb|AAT57496.1| collagen adhesion protein, C-terminal [Bacillus anthracis str.
           Sterne]
          Length = 882

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 93/326 (28%), Gaps = 35/326 (10%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
           F       +     T +N  + K +           +    +        +  +   G  
Sbjct: 482 FVETKAPTHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGAT-LEGAV 540

Query: 58  WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
           + I   ++        T    G     DL PGDY    +     +         TV   +
Sbjct: 541 FKIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFTVEKSQ 599

Query: 113 KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                V   N    G + L  +    G+ +          +  + +A L TDK    ++ 
Sbjct: 600 TATASVTATNSLTKGAVELMKVDDIDGTTLEGAIFKIVDSNGHDVRADLTTDKDGKISVS 659

Query: 169 RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
            L   +YQ                +   +     ++  VT         +    V     
Sbjct: 660 DLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 719

Query: 222 EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 720 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 779

Query: 272 SVLTGKSTIVEVLMRQKRMDKNGQHN 297
           ++   +++ +++ +  K+++ +   +
Sbjct: 780 TIEKAQASPLQITVSNKKVESSSGGD 805



 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/315 (14%), Positives = 90/315 (28%), Gaps = 33/315 (10%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
           F       +     T +   + KG+ K        +        +++ +   S      +
Sbjct: 296 FIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSTLKDAVF 355

Query: 59  HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
            I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 356 KIV-DMNGNDVRTDLTTNKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQT 414

Query: 114 NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
               V   N    G + L  +    G+ +          +  + +  L TDK    ++  
Sbjct: 415 ATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDQNGNDVRTDLTTDKDGKISVSD 474

Query: 170 LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
           L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 475 LRPGDYQFVETKAPTHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGA 534

Query: 223 AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
            +    + I+  +G+ V      +         L  GDY  I     ++Y        F+
Sbjct: 535 TLEGAVFKIVDMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFT 594

Query: 273 VLTGKSTIVEVLMRQ 287
           V   ++    V    
Sbjct: 595 VEKSQTATASVTATN 609



 Score =  125 bits (314), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 45/299 (15%), Positives = 82/299 (27%), Gaps = 28/299 (9%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
           T T      +    K  +    I        +      G  + I +  +N+    +    
Sbjct: 32  TITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDARTNLVTN 91

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRL 128
             G  V  DL PG+Y +  +             + T+   ++    +   N    G ++L
Sbjct: 92  SEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNSLTKGKVKL 151

Query: 129 YSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
                  S I      F++      +    L TD+     +  L   +YQ        + 
Sbjct: 152 IKEDDVESSIALAGAVFTLQDANGTEIAKDLKTDEHGVLVIPDLAPGDYQFIETAAPEHY 211

Query: 187 IVSTV---VKVEPGKIIDV----TIQNRAAKITF-KLVSEMGGEAVADTAWSILTASG-- 236
            +        +E  +   V    T       +   K+        +    + I+   G  
Sbjct: 212 KLDQTPIKFTIERSQTKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHD 271

Query: 237 ---DTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
              D   +         L  GDY  I      +Y        F+V  G+  I  V    
Sbjct: 272 VRTDLTTDKNGRLVVDELPPGDYEFIETKAPTHYDLNETPIKFTVKKGQEKIASVTATN 330


>gi|229051641|ref|ZP_04195111.1| hypothetical protein bcere0027_55450 [Bacillus cereus AH676]
 gi|228721752|gb|EEL73226.1| hypothetical protein bcere0027_55450 [Bacillus cereus AH676]
          Length = 1044

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 40/279 (14%), Positives = 87/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    S  + +G  + +F++ +
Sbjct: 199 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGESGEVLAGAVFEVFNANN 258

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 259 ESVGK--ITTGADGTAELNNLPIGTYTVKEIKAPTGYVLGDKPQTIEVKTGETGAVQIVN 316

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
             A G      +     ++ + + F++++    +             V  L    Y    
Sbjct: 317 NKAKGNIEIKKFSDSGKVLPN-VEFTVFTEDGKEVKKAVTNENGIAKVEGLTFGKYYFLE 375

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 376 TKTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 435

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 436 DASGKVIGEYKTDKNGEINVKDLAYGKYSFVEKTSPNGY 474



 Score = 71.1 bits (172), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 39/292 (13%), Positives = 87/292 (29%), Gaps = 26/292 (8%)

Query: 18  STLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDS----GVSWHIFDSISNKKNTLST 73
           + L     +   G   V A+      ++   +  +      G  + I    + K    + 
Sbjct: 127 TNLYTVQTNAKSGSYKVVAKNAPNGVKIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFNL 186

Query: 74  TKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYK 133
           +      KV    + G   +  +   +          K  +   V    AG +++  + +
Sbjct: 187 SVAANLTKVQAIAYRGTDTVQNATVLLERN-----EEKLSSDLAVNWEAAGSLKIKKVGE 241

Query: 134 PGSPIVDDELTFSIYSNPNHKALLITDK-VRSGTLVRLGTNNYQITSHYGKYNAIV---S 189
            G   V     F +++  N     IT     +  L  L    Y +         ++    
Sbjct: 242 SGE--VLAGAVFEVFNANNESVGKITTGADGTAELNNLPIGTYTVKEIKAPTGYVLGDKP 299

Query: 190 TVVKVEPGKIIDVTIQNRAAKITFKLVS-EMGGEAVADTAWSILTASGDT----VGESAN 244
             ++V+ G+   V I N  AK   ++      G+ + +  +++ T  G      V     
Sbjct: 300 QTIEVKTGETGAVQIVNNKAKGNIEIKKFSDSGKVLPNVEFTVFTEDGKEVKKAVTNENG 359

Query: 245 ASPSMVLSEGDYTVIARNKERNY-----SREFSVLTGKSTIVEVLMRQKRMD 291
            +    L+ G Y  +       Y        F +    +  +   +    + 
Sbjct: 360 IAKVEGLTFGKYYFLETKTPNGYIGNKTKYPFEIKE-HNKTLTFTVENTEVK 410



 Score = 66.1 bits (159), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 41/287 (14%), Positives = 83/287 (28%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 391 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAVFELKDASGKV 441

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISA---SFGHVGVVKKITVSSKEKNQKQ----VFI 120
                      G     DL  G Y         G+V V + I    KE  +      V  
Sbjct: 442 IGEYK--TDKNGEINVKDLAYGKYSFVEKTSPNGYVLVTEPIVFEIKEHGKIIELLAVNH 499

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 500 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 559

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEA-VADTAWSILTASGDT 238
                  I++             + + +      K + +      +  TA+     + + 
Sbjct: 560 TIAPNGYILNEE---------TFSFEIKENGQIIKHIVKDEKIPSIKTTAFDKKDGTKEM 610

Query: 239 VGESA----NASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
               +    +      L  G +YT+  +  ++  ++ F V   + T 
Sbjct: 611 HTSKSVTIQDKVEYKDLQVGKEYTLKGKLMDKKTNKPFVVNGKEVTA 657


>gi|228924104|ref|ZP_04087380.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            serovar huazhongensis BGSC 4BD1]
 gi|228835594|gb|EEM80959.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            serovar huazhongensis BGSC 4BD1]
          Length = 2829

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 44/326 (13%), Positives = 98/326 (30%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I+K +   +      +        +++ +   +      +
Sbjct: 2424 FIETTAPKHYDLNKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDGTALKDAIF 2483

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T  + G     DL PGDY    +             K T+   +K
Sbjct: 2484 KI-TDMNGNDIRTELTTDVDGKISVSDLRPGDYQFIETKAPEHYKLDSKPIKFTIKKSQK 2542

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    ++ 
Sbjct: 2543 EKLQVTATNSLTEGSVELIKVDDINPDTKLSDAVFNIIDANGKIVRTDLTTDKDGKISVS 2602

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     +I  VT         I    V     
Sbjct: 2603 DLRPGDYQFIETKAPTGYDLNVKPIPFTITKGQSQITSVTALNSLTTGSIELTKVDIDHH 2662

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 2663 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 2722

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   +++ +++ +  K+++ +   +
Sbjct: 2723 TIEKAQASPLQITVSNKKIESSSGGD 2748



 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 39/310 (12%), Positives = 86/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1682 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1741

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1742 VRTDLVTNSNGMLVVDDLRPGNYKLIETKAPTYYDVNEEPIEFTIEKSQQKLIPITFKNS 1801

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1802 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDGHGVLVIPDLAPGDYQFI 1861

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + +        +T   V ++ G  +    +
Sbjct: 1862 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTIKNSLLTGGVTLTKVDDVDGTTLEGAEF 1921

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             ++     +  L  GDY  +     ++Y+       F++   +
Sbjct: 1922 IIVDAHDTKKVIRKGLTTDTNGKITASDLRPGDYQFVEVKAPKDYTLSKDPIPFTIEKSQ 1981

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1982 KENITVTATN 1991



 Score =  126 bits (315), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 91/316 (28%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++   +   +   I K + + +      + +       ++ +   ++  G  +
Sbjct: 1957 FVEVKAPKDYTLSKDPIPFTIEKSQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIF 2016

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++ K    +      G      L PGDY    +     +         T+   + 
Sbjct: 2017 KIV-DMNGKDVHTNLVTDKNGKISVSHLRPGDYQFIETIAPEHYVLDETTIPFTIERSQT 2075

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
             +  V   NA   G + L  I             F++           L T+      + 
Sbjct: 2076 KEINVTSKNALKNGSVELTKIDDIDINTKLANAVFNLLDADGELVEEGLKTNDEGKIVVE 2135

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQN--RAAKITFKLVSEMGG 221
             L    YQ        +       +   +K    + + VT  N      +      ++ G
Sbjct: 2136 NLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHVTATNALTKGAVKLSKTDDVDG 2195

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              + D  + I+  +GD V                L  GDY  I     ++Y  +     F
Sbjct: 2196 TVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKF 2255

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++  G+   + +    
Sbjct: 2256 TIEKGQKKAISLTATN 2271



 Score =  121 bits (302), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 53/310 (17%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1588 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1646

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1647 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1706

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1707 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSNGMLVVDDLRPGNYKL 1766

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K+I +T +N   K   KL+        +A+A   +
Sbjct: 1767 IETKAPTYYDVNEEPIEFTIEKSQQKLIPITFKNSLTKGKVKLIKEDDVESSKALAGAVF 1826

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1827 TLQDATGKEIMKDLTTDGHGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1886

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1887 DLPIPVTIKN 1896



 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 48/317 (15%), Positives = 97/317 (30%), Gaps = 34/317 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K +        + +        +++ +   +   G
Sbjct: 2328 TYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKMDDVDGTTLEG 2387

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              + I   ++             G     DL PGDY    +     +         T++ 
Sbjct: 2388 AVFKIV-DMNGTVIHKELVTNQQGKISVSDLRPGDYQFIETTAPKHYDLNKEPIPFTITK 2446

Query: 111  KEKNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             + +   V   N    G + L  +    G+ + D     +  +  + +  L TD     +
Sbjct: 2447 SQADPISVTATNSLTKGAVELSKVDDVDGTALKDAIFKITDMNGNDIRTELTTDVDGKIS 2506

Query: 167  LVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG- 220
            +  L   +YQ        +       +   +K    + + VT  N   + + +L+     
Sbjct: 2507 VSDLRPGDYQFIETKAPEHYKLDSKPIKFTIKKSQKEKLQVTATNSLTEGSVELIKVDDI 2566

Query: 221  --GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 ++D  ++I+ A+G  V      +         L  GDY  I       Y      
Sbjct: 2567 NPDTKLSDAVFNIIDANGKIVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNVKP 2626

Query: 270  -EFSVLTGKSTIVEVLM 285
              F++  G+S I  V  
Sbjct: 2627 IPFTITKGQSQITSVTA 2643



 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 43/319 (13%), Positives = 89/319 (27%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K + + +               ++  +   ++   
Sbjct: 2141 TYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHVTATNALTKGAVKLSKTDDVDGTVLKD 2200

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              + I + ++             G     DL PGDY    +     +       K T+  
Sbjct: 2201 AVFKIVN-MNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKFTIEK 2259

Query: 111  KEKNQKQ---VFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNH--KALLITDKVRSG 165
             +K          L  G I L  +    +     +  F++        K  L T+     
Sbjct: 2260 GQKKAISLTATNSLKQGSIELLKVDDLNNQTKLADAVFNLLDQDGKVLKTDLKTNSEGKI 2319

Query: 166  TLVRLGTNNYQITSHYGKYNAIVS-----TVVKVEPGKIIDVTIQN--RAAKITFKLVSE 218
             +  L    YQ        +  +        ++     I  VT++N      +    + +
Sbjct: 2320 VIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKMDD 2379

Query: 219  MGGEAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            + G  +    + I+  +G       V           L  GDY  I     ++Y      
Sbjct: 2380 VDGTTLEGAVFKIVDMNGTVIHKELVTNQQGKISVSDLRPGDYQFIETTAPKHYDLNKEP 2439

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2440 IPFTITKSQADPISVTATN 2458



 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 94/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     +    +T    LT   +   +   G 
Sbjct: 1860 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTIKNSLLTGGVTLTKVDDVDGTTLEGA 1919

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1920 EFIIVDAHDTKKVIRKGLTTDTNGKITASDLRPGDYQFVEVKAPKDYTLSKDPIPFTIEK 1979

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1980 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKDVHTNLVTDKNGKIS 2039

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2040 VSHLRPGDYQFIETIAPEHYVLDETTIPFTIERSQTKEINVTSKNALKNGSVELTKIDDI 2099

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2100 DINTKLANAVFNLLDADGELVEEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2159

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2160 IVFTIKKSQTETLHVTATN 2178



 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+       L   I K + K +                ++ +   +   G  +
Sbjct: 1385 FVEEKAPEHYEIDKKPLKFTIDKSQQKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1444

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1445 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGVYKFIETEAPKDYTLSTNPIEFTIDKSQ 1504

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1505 QTLATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1564

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1565 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1624

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1625 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1684

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1685 KPIKFTITESQTTQATVTAKN 1705



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/312 (10%), Positives = 83/312 (26%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1114 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1172

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1173 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1232

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1233 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNDKGQITVDNLKPGTYYLK 1292

Query: 179  SHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +       K+E  +   +                 V +  G  +    +S+
Sbjct: 1293 EIKAPEHYQLDDRLIEFKIEENQTTVINKTAQNSLIRGSAILTKVDKE-GNTLEGAVFSV 1351

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
               +   +               +  L  G+Y  +      +Y  +     F++   +  
Sbjct: 1352 RDQNNKRIPGYTKLTTNGNGQIEAKNLLPGEYQFVEEKAPEHYEIDKKPLKFTIDKSQQK 1411

Query: 280  IVEVLMRQKRMD 291
             + V      + 
Sbjct: 1412 ALTVTATNHLIK 1423



 Score = 78.0 bits (190), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 35/240 (14%), Positives = 66/240 (27%), Gaps = 22/240 (9%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+    S  +   I K + +++       +    +        N  +  S   
Sbjct: 2517 FIETKAPEHYKLDSKPIKFTIKKSQKEKLQVTATNSLTEGSVELIKVDDINPDTKLSDAV 2576

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            ++I    + K      T    G     DL PGDY    +    G          T++  +
Sbjct: 2577 FNII-DANGKIVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNVKPIPFTITKGQ 2635

Query: 113  KNQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V  LN    G I L  +       +               +  L TD      + 
Sbjct: 2636 SQITSVTALNSLTTGSIELTKVDIDHHGTLEGAIFNILDQDGKVVREGLKTDGHGKLIVN 2695

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEA 223
             L   NYQ+               +S  ++      + +T+ N+  + +     +     
Sbjct: 2696 DLKPGNYQLVETKAPEGYQLDASPISFTIEKAQASPLQITVSNKKIESSSGGDDKPVTPP 2755



 Score = 74.6 bits (181), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 26/218 (11%), Positives = 58/218 (26%), Gaps = 23/218 (10%)

Query: 100  VGVVKKITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LL 157
                + I V     +         G + +  +       +     F++Y          +
Sbjct: 1115 TETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLYDRTGKTVIRKI 1174

Query: 158  ITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITF 213
             TDK        L  + Y +         ++S  +K    VE G     T +    K   
Sbjct: 1175 TTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKFVG 1234

Query: 214  KLV-----SEMGGEAVADTAWSILTASGDTV-------GESANASPSMVLSEGDYTVIAR 261
            K+V            +    +++L      +                  L  G Y +   
Sbjct: 1235 KVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNDKGQITVDNLKPGTYYLKEI 1294

Query: 262  NKERNYSRE-----FSVLTGKSTIVEVLMRQKRMDKNG 294
                +Y  +     F +   ++T++    +   +  + 
Sbjct: 1295 KAPEHYQLDDRLIEFKIEENQTTVINKTAQNSLIRGSA 1332


>gi|227818122|ref|YP_002818131.1| LPXTG-motif cell wall anchor domain protein [Bacillus anthracis
           str. CDC 684]
 gi|227003961|gb|ACP13704.1| LPXTG-motif cell wall anchor domain protein [Bacillus anthracis
           str. CDC 684]
          Length = 824

 Score =  136 bits (341), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 93/326 (28%), Gaps = 35/326 (10%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
           F       +     T +N  + K +           +    +        +  +   G  
Sbjct: 424 FVETKAPTHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGAT-LEGAV 482

Query: 58  WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
           + I   ++        T    G     DL PGDY    +     +         TV   +
Sbjct: 483 FKIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFTVEKSQ 541

Query: 113 KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                V   N    G + L  +    G+ +          +  + +A L TDK    ++ 
Sbjct: 542 TATASVTATNSLTKGAVELMKVDDIDGTTLEGAIFKIVDSNGHDVRADLTTDKDGKISVS 601

Query: 169 RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
            L   +YQ                +   +     ++  VT         +    V     
Sbjct: 602 DLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 661

Query: 222 EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 662 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 721

Query: 272 SVLTGKSTIVEVLMRQKRMDKNGQHN 297
           ++   +++ +++ +  K+++ +   +
Sbjct: 722 TIEKAQASPLQITVSNKKVESSSGGD 747



 Score =  127 bits (319), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 45/315 (14%), Positives = 90/315 (28%), Gaps = 33/315 (10%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
           F       +     T +   + KG+ K        +        +++ +   S      +
Sbjct: 238 FIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSTLKDAVF 297

Query: 59  HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
            I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 298 KIV-DMNGNDVRTDLTTNKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQT 356

Query: 114 NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
               V   N    G + L  +    G+ +          +  + +  L TDK    ++  
Sbjct: 357 ATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDQNGNDVRTDLTTDKDGKISVSD 416

Query: 170 LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
           L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 417 LRPGDYQFVETKAPTHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGA 476

Query: 223 AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
            +    + I+  +G+ V      +         L  GDY  I     ++Y        F+
Sbjct: 477 TLEGAVFKIVDMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFT 536

Query: 273 VLTGKSTIVEVLMRQ 287
           V   ++    V    
Sbjct: 537 VEKSQTATASVTATN 551



 Score =  126 bits (316), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 47/316 (14%), Positives = 90/316 (28%), Gaps = 34/316 (10%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGK-------RVVDAQRITCEARLTENSTSIDSGVS 57
           F   A  E+     T +   I + + K         +    +           +   G  
Sbjct: 144 FIETAAPEHYKLDQTPIKFTIERSQTKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAV 203

Query: 58  WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
           + I +           T    G  V  +L PGDY    +             K TV   +
Sbjct: 204 FKIVNKD-GHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPTHYDLNETPIKFTVKKGQ 262

Query: 113 KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
           +    V   N    G + L  +    GS + D        +  + +  L T+K    ++ 
Sbjct: 263 EKIASVTATNSLTKGAVELSKVDDIDGSTLKDAVFKIVDMNGNDVRTDLTTNKDGKISVS 322

Query: 169 RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
            L   +YQ        +  ++       VE  +    ++          +    V ++ G
Sbjct: 323 DLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDG 382

Query: 222 EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EF 271
             +    + I+  +G+ V      +         L  GDY  +      +Y        F
Sbjct: 383 TTLEGAIFKIVDQNGNDVRTDLTTDKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINF 442

Query: 272 SVLTGKSTIVEVLMRQ 287
           +V   ++    V    
Sbjct: 443 TVEKSQTATASVTATN 458



 Score =  118 bits (295), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 41/270 (15%), Positives = 76/270 (28%), Gaps = 28/270 (10%)

Query: 46  TENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV--- 102
             +      G  + I +  +N+    +      G  V  DL PG+Y +  +         
Sbjct: 3   AADEKETLEGAVFKIVNRDTNEDARTNLVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVN 62

Query: 103 --VKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA-- 155
               + T+   ++    +   N    G ++L       S I      F++      +   
Sbjct: 63  VEPIEFTIEKGQQTLLPLTFKNSLTKGKVKLIKEDDVESSIALAGAVFTLQDANGTEIAK 122

Query: 156 LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDV----TIQNRA 208
            L TD+     +  L   +YQ        +  +        +E  +   V    T     
Sbjct: 123 DLKTDEHGVLVIPDLAPGDYQFIETAAPEHYKLDQTPIKFTIERSQTKHVFVTATNSLTK 182

Query: 209 AKITF-KLVSEMGGEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARN 262
             +   K+        +    + I+   G     D   +         L  GDY  I   
Sbjct: 183 GSVELIKVDDVEENTTLEGAVFKIVNKDGHDVRTDLTTDKNGRLVVDELPPGDYEFIETK 242

Query: 263 KERNYSRE-----FSVLTGKSTIVEVLMRQ 287
              +Y        F+V  G+  I  V    
Sbjct: 243 APTHYDLNETPIKFTVKKGQEKIASVTATN 272


>gi|15612924|ref|NP_241227.1| hypothetical protein BH0361 [Bacillus halodurans C-125]
 gi|10172974|dbj|BAB04080.1| BH0361 [Bacillus halodurans C-125]
          Length = 1661

 Score =  136 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 42/288 (14%), Positives = 84/288 (29%), Gaps = 29/288 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
            + +  +    +       +++ +   G  + + D           T    G  V  DL P
Sbjct: 1270 QKENHLIPGSVQLVKVDADDAANTLEGAEFTLLDGE-GNVVQEGLTTDENGQVVVTDLKP 1328

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIVD 140
            G+Y    +    G          T+   ++    V + N    G ++L  +    + I  
Sbjct: 1329 GEYQFVETKAPAGYELEATPIGFTIERNQQEVATVAVENHLIPGSVQLVKVDADDAAITL 1388

Query: 141  DELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVE 195
            +   FS+     +     L TD      +  L    YQ           +        +E
Sbjct: 1389 EGAEFSLLDGEGNVVQEGLTTDATGQVVVTDLKPGEYQFVETKAPAGYELDATPIGFTIE 1448

Query: 196  PGKIIDVTIQNRAAKI-----TFKLVSEMGGEAVADTAWSILTASGDTV-----GESANA 245
              +    T+      I       K+  E     +    +S+L   G+ +           
Sbjct: 1449 RNQQEVATVAVENHLIPGSVQLIKVDREDSAVTLEGAEFSLLDEEGNVLREGIRTGENGQ 1508

Query: 246  SPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQK 288
               + L  GDY  I       Y  +     F++  G   ++ ++   K
Sbjct: 1509 LMVIDLKPGDYQFIETKAPTGYELDDTPIAFTIEKGTDEVLTLVFENK 1556



 Score =  120 bits (301), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/273 (13%), Positives = 85/273 (31%), Gaps = 29/273 (10%)

Query: 44   RLTENSTSIDSGVSWHIFDSISNKKNTLSTT-KKIIGGKVSFDLFPGDYLISASFGHVGV 102
            ++ E +     G  + +   + ++  T++       G   +  L PGDY        VG 
Sbjct: 1189 KVDEETGESLQGALFALQQKVDDEFVTIAEMETDEEGIVFAGSLEPGDYQFVELNAPVGY 1248

Query: 103  -----VKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHK 154
                     TV        ++   N    G ++L  +    +    +   F++     + 
Sbjct: 1249 KLDETPVVFTVEEDRTETIELQKENHLIPGSVQLVKVDADDAANTLEGAEFTLLDGEGNV 1308

Query: 155  A--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVS-----TVVKVEPGKIIDVTIQNR 207
                L TD+     +  L    YQ           +        ++    ++  V ++N 
Sbjct: 1309 VQEGLTTDENGQVVVTDLKPGEYQFVETKAPAGYELEATPIGFTIERNQQEVATVAVENH 1368

Query: 208  AAKITFKLVSEMGGEA---VADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVI 259
                + +LV     +A   +    +S+L   G+ V      ++        L  G+Y  +
Sbjct: 1369 LIPGSVQLVKVDADDAAITLEGAEFSLLDGEGNVVQEGLTTDATGQVVVTDLKPGEYQFV 1428

Query: 260  ARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   Y  +     F++   +  +  V +  
Sbjct: 1429 ETKAPAGYELDATPIGFTIERNQQEVATVAVEN 1461



 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/311 (12%), Positives = 93/311 (29%), Gaps = 36/311 (11%)

Query: 11   AENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNT 70
             E +  +S  ++  +S G G    +   +        ++  +  G ++ ++DS   +   
Sbjct: 1059 TEEVTESSGAVSVRLSGGAGTGSGETGSLEVTKVDA-DTGEVLQGATFTLYDSE-GEFAI 1116

Query: 71   LSTTKKIIGGKVSFDLFPGDYLISASFGHVGV------VKKITVS------SKEKNQKQV 118
             +      G     +L  GDYL+       G        +++T+       + E  +  +
Sbjct: 1117 RTLETGEDGKATFVNLLYGDYLLKEDSAPEGYLVGINDTQRVTIDTVLHEVTVENEKSDI 1176

Query: 119  FILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLI----TDKVRSGTLVRLGTNN 174
              ++A G          +        F++    + + + I    TD+        L   +
Sbjct: 1177 NRVSAVGAVQLQKVDEETGESLQGALFALQQKVDDEFVTIAEMETDEEGIVFAGSLEPGD 1236

Query: 175  YQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMG-GEAVAD 226
            YQ           +        VE  +   + +Q         +    V        +  
Sbjct: 1237 YQFVELNAPVGYKLDETPVVFTVEEDRTETIELQKENHLIPGSVQLVKVDADDAANTLEG 1296

Query: 227  TAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTG 276
              +++L   G+ V      +         L  G+Y  +       Y  E     F++   
Sbjct: 1297 AEFTLLDGEGNVVQEGLTTDENGQVVVTDLKPGEYQFVETKAPAGYELEATPIGFTIERN 1356

Query: 277  KSTIVEVLMRQ 287
            +  +  V +  
Sbjct: 1357 QQEVATVAVEN 1367



 Score = 81.5 bits (199), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/228 (11%), Positives = 69/228 (30%), Gaps = 23/228 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGK-------GKRVVDAQRITCEARLTENSTSIDSGVS 57
            F            +T +   I + +        +  +    +       +++     G  
Sbjct: 1333 FVETKAPAGYELEATPIGFTIERNQQEVATVAVENHLIPGSVQLVKVDADDAAITLEGAE 1392

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            + + D           T    G  V  DL PG+Y    +    G          T+   +
Sbjct: 1393 FSLLDGE-GNVVQEGLTTDATGQVVVTDLKPGEYQFVETKAPAGYELDATPIGFTIERNQ 1451

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH--KALLITDKVRSGTL 167
            +    V + N    G ++L  + +  S +  +   FS+     +  +  + T +     +
Sbjct: 1452 QEVATVAVENHLIPGSVQLIKVDREDSAVTLEGAEFSLLDEEGNVLREGIRTGENGQLMV 1511

Query: 168  VRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAK 210
            + L   +YQ                ++  ++    +++ +  +N+   
Sbjct: 1512 IDLKPGDYQFIETKAPTGYELDDTPIAFTIEKGTDEVLTLVFENKLTP 1559



 Score = 46.1 bits (107), Expect = 0.007,   Method: Composition-based stats.
 Identities = 13/93 (13%), Positives = 30/93 (32%), Gaps = 8/93 (8%)

Query: 207  RAAKITFKLVSEMGGEAVADTAWSILTASGD-----TVGESANASPSMVLSEGDYTVIAR 261
                +    V    GE +    +++  + G+             +  + L  GDY +   
Sbjct: 1083 ETGSLEVTKVDADTGEVLQGATFTLYDSEGEFAIRTLETGEDGKATFVNLLYGDYLLKED 1142

Query: 262  NKERNYSREF--SVLTGKSTIV-EVLMRQKRMD 291
            +    Y      +      T++ EV +  ++ D
Sbjct: 1143 SAPEGYLVGINDTQRVTIDTVLHEVTVENEKSD 1175


>gi|218898616|ref|YP_002447027.1| collagen adhesion protein [Bacillus cereus G9842]
 gi|218544038|gb|ACK96432.1| collagen adhesion protein [Bacillus cereus G9842]
          Length = 1055

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 38/279 (13%), Positives = 86/279 (30%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +   + +F++ +
Sbjct: 215 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLADAVFEVFNANN 274

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 275 ESVGK--ITTGADGIAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 332

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 333 NKVKGNIEIKKLSDSGKVLPN-VEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLE 391

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 392 TQTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDVSKKLEGAEFELK 451

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 452 DASGKVIGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 490



 Score = 60.7 bits (145), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 39/287 (13%), Positives = 75/287 (26%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 407 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDVSKKLEGAEFELKDASGKV 457

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK-------KITVSSKEKNQKQVFI 120
                      G     DL  G Y         G V        +I    K      V  
Sbjct: 458 IGEYK--TDKNGEINVKDLAYGKYSFVEKASPNGYVLVKEPIMFEIKEHGKIIELLAVNH 515

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 516 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 575

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
                  +++             + + +      K + +        T  +  T     +
Sbjct: 576 TVAPKGYVLNEE---------TFSFEIKENGQIIKHIVKDEKIPSIKTTATDKTDGTKEM 626

Query: 240 GESAN-----ASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
             S +           L  G +YTV  +   +  ++   V   + T 
Sbjct: 627 HTSKSVTIQDKVEYKDLQVGKEYTVKGKLMNKETNKPLVVNGKEVTA 673



 Score = 47.6 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/191 (14%), Positives = 60/191 (31%), Gaps = 19/191 (9%)

Query: 112 EKNQKQVFILNAGGIRLYSIYKPGSPIVD----DELTFSIYSNPNHKALLITDKVRSGTL 167
           E N   V     GG          + +       E+   +      +  +  +       
Sbjct: 142 ETNLYSVQTNAKGGSYKVVAKNAPNGVKIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFN 201

Query: 168 VRLGTNNYQITS-HYGKYNAIVSTVVKVEPGKIIDVTIQN----RAAKITFKLVSEMGGE 222
           + +  N  ++ +  Y   + + +  V +E  +    +        A  +  K V    GE
Sbjct: 202 LSVAANLTKVQAIAYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKV-GENGE 260

Query: 223 AVADTAWSILTAS----GDTVGESANASPSMVLSEGDYTVIARNKERNYS-----REFSV 273
            +AD  + +  A+    G     +   +    L  G YT+        Y      +   V
Sbjct: 261 VLADAVFEVFNANNESVGKITTGADGIAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEV 320

Query: 274 LTGKSTIVEVL 284
            TG++  V+++
Sbjct: 321 KTGETGAVQIV 331


>gi|65317337|ref|ZP_00390296.1| COG4932: Predicted outer membrane protein [Bacillus anthracis str.
           A2012]
 gi|254687200|ref|ZP_05151058.1| collagen adhesion protein, C-terminal [Bacillus anthracis str.
           CNEVA-9066]
 gi|254735496|ref|ZP_05193204.1| collagen adhesion protein, C-terminal [Bacillus anthracis str.
           Western North America USA6153]
 gi|254742257|ref|ZP_05199944.1| collagen adhesion protein, C-terminal [Bacillus anthracis str.
           Kruger B]
 gi|254755829|ref|ZP_05207861.1| collagen adhesion protein, C-terminal [Bacillus anthracis str.
           Vollum]
          Length = 880

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 93/326 (28%), Gaps = 35/326 (10%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
           F       +     T +N  + K +           +    +        +  +   G  
Sbjct: 480 FVETKAPTHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGAT-LEGAV 538

Query: 58  WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
           + I   ++        T    G     DL PGDY    +     +         TV   +
Sbjct: 539 FKIV-DMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFTVEKSQ 597

Query: 113 KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                V   N    G + L  +    G+ +          +  + +A L TDK    ++ 
Sbjct: 598 TATASVTATNSLTKGAVELMKVDDIDGTTLEGAIFKIVDSNGHDVRADLTTDKDGKISVS 657

Query: 169 RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
            L   +YQ                +   +     ++  VT         +    V     
Sbjct: 658 DLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHN 717

Query: 222 EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             +    ++IL   G  V      +         L  G+Y ++       Y  +     F
Sbjct: 718 GTLEGAIFNILDQDGKVVREGLKTDGHGKLIVNDLKPGNYQLVETKAPEGYQLDASPISF 777

Query: 272 SVLTGKSTIVEVLMRQKRMDKNGQHN 297
           ++   +++ +++ +  K+++ +   +
Sbjct: 778 TIEKAQASPLQITVSNKKVESSSGGD 803



 Score =  127 bits (318), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 45/315 (14%), Positives = 90/315 (28%), Gaps = 33/315 (10%)

Query: 5   FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
           F       +     T +   + KG+ K        +        +++ +   S      +
Sbjct: 294 FIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSTLKDAVF 353

Query: 59  HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
            I   ++        T    G     DL PGDY    +     +         TV   + 
Sbjct: 354 KIV-DMNGNDVRTDLTTNKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQT 412

Query: 114 NQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVR 169
               V   N    G + L  +    G+ +          +  + +  L TDK    ++  
Sbjct: 413 ATASVTAKNSLTKGAVELTKVDDIDGTTLEGAIFKIVDQNGNDVRTDLTTDKDGKISVSD 472

Query: 170 LGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGE 222
           L   +YQ        +  ++       VE  +    ++          +    V ++ G 
Sbjct: 473 LRPGDYQFVETKAPTHYDLNQTPINFTVEKSQTATASVTATNSLTKGAVELTKVDDIDGA 532

Query: 223 AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR-----EFS 272
            +    + I+  +G+ V      +         L  GDY  I     ++Y        F+
Sbjct: 533 TLEGAVFKIVDMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFT 592

Query: 273 VLTGKSTIVEVLMRQ 287
           V   ++    V    
Sbjct: 593 VEKSQTATASVTATN 607



 Score =  125 bits (313), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 45/299 (15%), Positives = 82/299 (27%), Gaps = 28/299 (9%)

Query: 17  TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
           T T      +    K  +    I        +      G  + I +  +N+    +    
Sbjct: 30  TITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDARTNLVTN 89

Query: 77  IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN---AGGIRL 128
             G  V  DL PG+Y +  +             + T+   ++    +   N    G ++L
Sbjct: 90  SEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNSLTKGKVKL 149

Query: 129 YSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNA 186
                  S I      F++      +    L TD+     +  L   +YQ        + 
Sbjct: 150 IKEDDVESSIALAGAVFTLQDANGTEIAKDLKTDEHGVLVIPDLAPGDYQFIETAAPEHY 209

Query: 187 IVSTV---VKVEPGKIIDV----TIQNRAAKITF-KLVSEMGGEAVADTAWSILTASG-- 236
            +        +E  +   V    T       +   K+        +    + I+   G  
Sbjct: 210 KLDQTPIKFTIERSQTKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAVFKIVNKDGHD 269

Query: 237 ---DTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
              D   +         L  GDY  I      +Y        F+V  G+  I  V    
Sbjct: 270 VRTDLTTDKNGRLVVDELPPGDYEFIETKAPTHYDLNETPIKFTVKKGQEKIASVTATN 328


>gi|229199483|ref|ZP_04326144.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus m1293]
 gi|228583888|gb|EEK42045.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus m1293]
          Length = 2849

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 44/327 (13%), Positives = 100/327 (30%), Gaps = 35/327 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I KG+ + +    + +        +++ +   +   G  +
Sbjct: 2415 FIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKMDDIDGTALEGAVF 2474

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T    G     DL PGDY    +             K T+   + 
Sbjct: 2475 KIV-DMNGNDVRTGITTDAKGKVSIPDLHPGDYQFIETTAPKHYKLDATPIKFTIEKSQA 2533

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    +  
Sbjct: 2534 EKLQVTAKNSLIEGAVELIKVDDINPDTKLSDAVFNIIDAKGKIVRTNLTTDKDGKVSAS 2593

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  +   V++          +    V     
Sbjct: 2594 NLRPGDYQFVETKAPKHYDLNKTPIPFTIEKSQTTHVSVTAKNGLTKGGVELTKVDSIDA 2653

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             + +    + I   +G     + V        +  L  GDY  I       Y  +     
Sbjct: 2654 KDTLEGAVFKITDMNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPEGYQLDASPIS 2713

Query: 271  FSVLTGKSTIVEVLMRQKRMDKNGQHN 297
            F++   ++  +++ +  K+++ +   +
Sbjct: 2714 FTIEKAQAAPLQITVSNKKIESSSGGD 2740



 Score =  129 bits (324), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 42/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
                 +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1673 KNTNPIKFTITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1732

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1733 VRAELVTNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1792

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S I      F++      +    L T+      +  L   +YQ  
Sbjct: 1793 LTKGKVKLIKEDDVESSIALAGAVFTLQDATGKEIAKDLKTNDYGVLVIPDLAPGDYQFI 1852

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + VT       +T   V ++ G  +    +
Sbjct: 1853 ETSAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGATLEGAEF 1912

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y        F++   +
Sbjct: 1913 IIVDAHDTKKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYDLRQDPIPFTIGKSQ 1972

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1973 KENISVTATN 1982



 Score =  126 bits (316), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 46/316 (14%), Positives = 101/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T ++  I KG+ K +       +    I        N     S   
Sbjct: 2228 FIETKAPKHYVLDETPIHFTIEKGQKKAISLTAKNSLQQGSIELLKVDDLNDQMKLSDAV 2287

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            +++ D  + K           G  V  +L PG Y    +     +        +TV   +
Sbjct: 2288 FNLLDQ-NGKVLKTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQ 2346

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K+   V + N    GG+ L  +    G+ +                  L+T+      + 
Sbjct: 2347 KDIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFNIVDMKGTVIHKDLVTNSKGKIEIN 2406

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +E G+   +++          +    + ++ G
Sbjct: 2407 DLRPGDYQFIETKAPKHYDLNKEPIPFTIEKGQAEPISVTAKNSLTKGAVELSKMDDIDG 2466

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+    + I+  +G+ V      ++        L  GDY  I     ++Y  +     F
Sbjct: 2467 TALEGAVFKIVDMNGNDVRTGITTDAKGKVSIPDLHPGDYQFIETTAPKHYKLDATPIKF 2526

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   ++  ++V  + 
Sbjct: 2527 TIEKSQAEKLQVTAKN 2542



 Score =  119 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 90/319 (28%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F   +  E+     T +   I KG    +     V    +T    LT   +   +   G 
Sbjct: 1851 FIETSAPEHYKLDQTPIKFTIKKGSKDDLPVPVTVTNSLLTGGVTLTKVDDVDGATLEGA 1910

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1911 EFIIVDAHDTKKVVRKGLTTDEHGKVSASDLRPGDYQFIEVKAPKDYDLRQDPIPFTIGK 1970

Query: 111  KEKNQKQVFILN----AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             +K    V   N     G I         + +          +    +  L TDK    +
Sbjct: 1971 SQKENISVTATNSLTKGGVILTKIDDIDRTMLKGAIFKIVDMNGNEVRTNLGTDKNGKIS 2030

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTI----QNRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +   +T+      +   +    +   
Sbjct: 2031 VSDLRPGDYQFIETKAPEHYVLDETPIPFTIERSQTKKITVTGKNTLKKGSVELTKIDNI 2090

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  + +L A G  V                L  G Y  +      +Y      
Sbjct: 2091 DTNTKLANAVFDLLDADGQLVEKGLKTNDEGKIIVENLRPGTYQFVETIAPEHYDLNKKP 2150

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + +  + 
Sbjct: 2151 IKFTIKKSQTETLHITAKN 2169



 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 54/310 (17%), Positives = 102/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1579 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1637

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +     V   N 
Sbjct: 1638 IRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNPIKFTITESQTTSATVTAKNS 1697

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +A L+T+      +  L   NY++
Sbjct: 1698 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRAELVTNSEGKLVVDDLRPGNYKL 1757

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGE---AVADTAW 229
                           +   ++    K++ +T +N   K   KL+ E   E   A+A   +
Sbjct: 1758 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSIALAGAVF 1817

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +                L+ GDY  I  +   +Y  +     F++  G   
Sbjct: 1818 TLQDATGKEIAKDLKTNDYGVLVIPDLAPGDYQFIETSAPEHYKLDQTPIKFTIKKGSKD 1877

Query: 280  IVEVLMRQKR 289
             + V +    
Sbjct: 1878 DLPVPVTVTN 1887



 Score =  115 bits (288), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 46/319 (14%), Positives = 96/319 (30%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITC-----EARLTEN-STSIDSGVSW 58
            F      ++     T +   I K + K V                 T++   +  +G  +
Sbjct: 1378 FVEEKAPKDYDIDKTPIEFTIVKSQQKAVTVTATNHLIKGGVTLTKTDDIDGTALAGAIF 1437

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
             I D+   KK    + T    G     DL PG Y    +             + T+   +
Sbjct: 1438 KIVDANDEKKVIRENVTTGADGKVTVKDLEPGTYKFIETEAPKDYVLNTNPIEFTIDKSQ 1497

Query: 113  ---KNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYS--NPNHKALLITDKVRSGTL 167
                       L  G + L  + + G         F I    N + +  L TD       
Sbjct: 1498 QSFATVTATNSLKTGEVELLKVDEFGDKKPLAGAVFKIVDVNNNDVRTDLTTDADGKTKA 1557

Query: 168  VRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMG 220
             +L    Y+        + ++        ++  +   + ++     +   +    V ++ 
Sbjct: 1558 DKLRPGTYKFIETAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDID 1617

Query: 221  GEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
            G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +    
Sbjct: 1618 GTALEGAVFKIVDANDEKKVIRENIKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTNP 1677

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++T   V  + 
Sbjct: 1678 IKFTITESQTTSATVTAKN 1696



 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/298 (12%), Positives = 87/298 (29%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        ++ +  +   + + D+   +         
Sbjct: 2060 TIERSQTKKITVTGKNTLKKGSVELTKIDNIDTNTKLANAVFDLLDAD-GQLVEKGLKTN 2118

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA---GGIRL 128
              G  +  +L PG Y    +     +       K T+   +     +   NA   GG+ L
Sbjct: 2119 DEGKIIVENLRPGTYQFVETIAPEHYDLNKKPIKFTIKKSQTETLHITAKNALTKGGVEL 2178

Query: 129  YSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
              +     + +          +       L+T+      +  L   +YQ        + +
Sbjct: 2179 SKVDDIDDTKLEGAVFNIVDMNGTVIHKDLVTNSKGKIEIDDLRPGDYQFIETKAPKHYV 2238

Query: 188  VSTV---VKVEPGKIIDVTIQ----NRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+   +++      +   I   K+        ++D  +++L  +G  +
Sbjct: 2239 LDETPIHFTIEKGQKKAISLTAKNSLQQGSIELLKVDDLNDQMKLSDAVFNLLDQNGKVL 2298

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   +        L  G Y  +     ++Y  +      +V   +  I  V M+ 
Sbjct: 2299 KTDLKTNNEGKIVVENLRPGTYQFVETTAPKHYDLDKKPIVVTVEKSQKDIATVTMKN 2356



 Score =  106 bits (263), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 39/286 (13%), Positives = 79/286 (27%), Gaps = 33/286 (11%)

Query: 37   QRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS 96
              +       ++     +G  + ++D         S T    G     +L    YLI  +
Sbjct: 1133 GSLQIIKVDDKDRKVPLAGAEFTLYDQT-GTTAIRSITTGDDGVAKFNNLRRDKYLIKET 1191

Query: 97   FGHVGVVKK--------ITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIY 148
                G V          + + S+E  +  +      G  + +     S    +   FS+ 
Sbjct: 1192 KAPQGYVISKELKEGILVELGSEEITKYTLTNKKFVGKVVLTKTDATSRERLEHAVFSLL 1251

Query: 149  SNP----NHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKII- 200
                        LIT+     T+  L    Y +       +  +      VK+   +   
Sbjct: 1252 DQNKQVIPEHKELITNDKGQITVDHLKPGTYYLQETKAPEHYKLDDRLIEVKIAEDQTTV 1311

Query: 201  ---DVTIQNRAAKITFKLVSEMGGEAVADTAWSILTAS-------GDTVGESANASPSMV 250
                 T            V +  G+ +A   +S+           G           +  
Sbjct: 1312 INRTATNSLIPGSAILTKVDKD-GKTLAGAEFSVRDRKNKIIPGYGKLTTNDQGQIEATN 1370

Query: 251  LSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKRMD 291
            L  GDY  +     ++Y  +     F+++  +   V V      + 
Sbjct: 1371 LRPGDYQFVEEKAPKDYDIDKTPIEFTIVKSQQKAVTVTATNHLIK 1416



 Score = 39.5 bits (90), Expect = 0.64,   Method: Composition-based stats.
 Identities = 26/200 (13%), Positives = 50/200 (25%), Gaps = 14/200 (7%)

Query: 105  KITVSSKEKNQKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRS 164
              TV+      K        G          +     +         N   +L    + +
Sbjct: 1027 PTTVAVDGTLTKDTANELKEGTDYKLKVTTDNDTGKQQFKVEFLHTINRAYILEYRSLIN 1086

Query: 165  GTLVRLGTNNYQIT---SHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGG 221
                   +N  +IT       +       VVKV  G       + R +    K+  +   
Sbjct: 1087 ADNNETVSNKVKITGNRLTLTQVETTEEKVVKVSSGSGGGSANKGRGSLQIIKVDDKDRK 1146

Query: 222  EAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNY------SRE 270
              +A   +++   +G T            +    L    Y +      + Y         
Sbjct: 1147 VPLAGAEFTLYDQTGTTAIRSITTGDDGVAKFNNLRRDKYLIKETKAPQGYVISKELKEG 1206

Query: 271  FSVLTGKSTIVEVLMRQKRM 290
              V  G   I +  +  K+ 
Sbjct: 1207 ILVELGSEEITKYTLTNKKF 1226


>gi|229097968|ref|ZP_04228918.1| hypothetical protein bcere0020_32040 [Bacillus cereus Rock3-29]
 gi|228685405|gb|EEL39333.1| hypothetical protein bcere0020_32040 [Bacillus cereus Rock3-29]
          Length = 1067

 Score =  135 bits (340), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 41/279 (14%), Positives = 88/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K  G   V+ +   + + +    +  + +G  + +F++ +
Sbjct: 232 AYRGTDTVQNATVLLERNEEKLSGDLAVNWEATGSLKIKKVGENGEVLAGAVFEVFNANN 291

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    QV  
Sbjct: 292 ESVGK--ITTGADGTAELNNLQIGTYTVKEIKAPTGYVSGDKPQTIEVKTGETGAVQVVN 349

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 350 NKVKGNIEIKKLSDSGKVLPN-VEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLE 408

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 409 TKTLNGYIENKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDISKKLEGAVFELK 468

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 469 DASGKVIGEYKTDKNGEVNVKNLAYGKYSFVEKASPNGY 507



 Score = 59.6 bits (142), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 28/192 (14%), Positives = 52/192 (27%), Gaps = 19/192 (9%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 424 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDISKKLEGAVFELKDASGKV 474

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV---KKITVSSKEKNQKQ----VFI 120
                      G     +L  G Y         G V   + I    KE  +      V  
Sbjct: 475 IGEYK--TDKNGEVNVKNLAYGKYSFVEKASPNGYVLIKEPIVFEIKEHGKIIELLAVNH 532

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 533 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 592

Query: 180 HYGKYNAIVSTV 191
                  +++  
Sbjct: 593 TVAPKGYVLNEE 604



 Score = 47.2 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 30/86 (34%), Gaps = 10/86 (11%)

Query: 208 AAKITFKLVSEMGGEAVADTAWSILTAS----GDTVGESANASPSMVLSEGDYTVIARNK 263
              +  K V    GE +A   + +  A+    G     +   +    L  G YTV     
Sbjct: 264 TGSLKIKKV-GENGEVLAGAVFEVFNANNESVGKITTGADGTAELNNLQIGTYTVKEIKA 322

Query: 264 ERNYS-----REFSVLTGKSTIVEVL 284
              Y      +   V TG++  V+V+
Sbjct: 323 PTGYVSGDKPQTIEVKTGETGAVQVV 348


>gi|228905043|ref|ZP_04069082.1| hypothetical protein bthur0014_61580 [Bacillus thuringiensis IBL
           4222]
 gi|228854588|gb|EEM99207.1| hypothetical protein bthur0014_61580 [Bacillus thuringiensis IBL
           4222]
          Length = 1055

 Score =  135 bits (340), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 38/279 (13%), Positives = 86/279 (30%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K      V+ +   + + +    +  + +   + +F++ +
Sbjct: 215 AYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKVGENGEVLADAVFEVFNANN 274

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    Q+  
Sbjct: 275 ESVGK--ITTGADGIAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEVKTGETGAVQIVN 332

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 333 NKVKGNIEIKKLSDSGKVLPN-VEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLE 391

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K + KL+        + +    + + 
Sbjct: 392 TQTPNGYIGNKTKYPFEIKEHNKTLTFTVENTEVKGSVKLLKVDNEDVSKKLEGAEFELK 451

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 452 DASGKVIGEYKTDKNGEINVKDLAYGKYSFVEKASPNGY 490



 Score = 60.3 bits (144), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 39/287 (13%), Positives = 75/287 (26%), Gaps = 34/287 (11%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 407 FEIKEHNKTLTFTVENTEVKGSVKLLK---------VDNEDVSKKLEGAEFELKDASGKV 457

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK-------KITVSSKEKNQKQVFI 120
                      G     DL  G Y         G V        +I    K      V  
Sbjct: 458 IGEYK--TDKNGEINVKDLAYGKYSFVEKASPNGYVLVKEPIMFEIKEHGKIIELLAVNH 515

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 516 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 575

Query: 180 HYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV 239
                  +++             + + +      K + +        T  +  T     +
Sbjct: 576 TVAPKGYVLNEE---------TFSFEIKENGQIIKHIVKDEKIPSIKTTATDKTDGTKEM 626

Query: 240 GESAN-----ASPSMVLSEG-DYTVIARNKERNYSREFSVLTGKSTI 280
             S +           L  G +YTV  +   +  ++   V   + T 
Sbjct: 627 HTSKSVTIQDKVEYKDLQVGKEYTVKGKLMNKETNKPLVVNGKEVTA 673



 Score = 47.2 bits (110), Expect = 0.002,   Method: Composition-based stats.
 Identities = 28/191 (14%), Positives = 60/191 (31%), Gaps = 19/191 (9%)

Query: 112 EKNQKQVFILNAGGIRLYSIYKPGSPIVD----DELTFSIYSNPNHKALLITDKVRSGTL 167
           E N   V     GG          + +       E+   +      +  +  +       
Sbjct: 142 ETNLYSVQTNAKGGSYKVVAKNAPNGVKIVSENGEVKDQLSVGEKFRIQIPKNTKTGEFN 201

Query: 168 VRLGTNNYQITS-HYGKYNAIVSTVVKVEPGKIIDVTIQN----RAAKITFKLVSEMGGE 222
           + +  N  ++ +  Y   + + +  V +E  +    +        A  +  K V    GE
Sbjct: 202 LSVAANLTKVQAIAYRGTDTVQNATVLLERNEEKLSSDLAVNWEAAGSLKIKKV-GENGE 260

Query: 223 AVADTAWSILTAS----GDTVGESANASPSMVLSEGDYTVIARNKERNYS-----REFSV 273
            +AD  + +  A+    G     +   +    L  G YT+        Y      +   V
Sbjct: 261 VLADAVFEVFNANNESVGKITTGADGIAELNNLPIGTYTLKEIKAPTGYVSDDKPQTIEV 320

Query: 274 LTGKSTIVEVL 284
            TG++  V+++
Sbjct: 321 KTGETGAVQIV 331


>gi|217962487|ref|YP_002341059.1| cell wall surface anchor family protein [Bacillus cereus AH187]
 gi|217063078|gb|ACJ77328.1| cell wall surface anchor family protein [Bacillus cereus AH187]
          Length = 627

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 45/310 (14%), Positives = 99/310 (31%), Gaps = 27/310 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           ++  +E +  T+ LL  N  K     VV+ + + + +         +  G  + +    S
Sbjct: 253 AFKGSEKVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKEVLKGAVFEV----S 308

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
           N+    + T    G     +L  G Y +       G      VKKI V + E    ++  
Sbjct: 309 NENFKQNVTTNDKGIAELGNLPIGIYSVKEIQAPAGYVLDGSVKKIEVKTGETAVLELKN 368

Query: 121 LNAGG-IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITS 179
            N  G + +  +             F+IY+    + +      +     +L    Y    
Sbjct: 369 ENVKGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTDEKGVAKFKLPYGKYTYKE 428

Query: 180 HYGKYNAIVSTV---VKVEPGKII---DVTIQNRAAKITFKLVSE-MGGEAVADTAWSIL 232
                  +++      +++    I    V  +    ++    V    G   + +  ++I 
Sbjct: 429 TIAPNGYVINEETFAFEIKENGQIIKHIVQDKKVEGELEITKVDIADGNTKLPNAEFTIY 488

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKSTI-VEVL 284
              G  V     +    +    L  G YT         Y      F+    ++   ++ +
Sbjct: 489 NEQGKEVVKRKTDEKGVAKFK-LPYGKYTYKETIAPNGYVINEETFAFEIKENGEIIKHI 547

Query: 285 MRQKRMDKNG 294
           ++ K+ +K  
Sbjct: 548 VKNKKEEKAS 557


>gi|326943155|gb|AEA19051.1| collagen adhesion protein [Bacillus thuringiensis serovar chinensis
            CT-43]
          Length = 3330

 Score =  135 bits (339), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 42/325 (12%), Positives = 94/325 (28%), Gaps = 32/325 (9%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++       +   + K +  +       +         ++ +   +  +G  +
Sbjct: 2925 FIETKAPKHYDLNQNPIKFTVEKSQTAKASVTATNSLTKGAVELTKVDDIDGTTLAGAIF 2984

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I D      ++ + T    G     DL PGDY    +     +       K TV   + 
Sbjct: 2985 KIVDMNGKDVHSENLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLYQNPIKFTVEKSQT 3044

Query: 114  NQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVR 169
             +  V   N    G    +              F I         + L TDK    ++  
Sbjct: 3045 AKASVTATNSLTKGAVELTKVDDIDGTTLAGAIFKIVDMNGKDVHSDLTTDKDGKISVSD 3104

Query: 170  LGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGGE 222
            L   +YQ                +   +     ++  VT         I    V      
Sbjct: 3105 LRPGDYQFIETKAPTGYDLNIKPIPFTITKGQSQVTSVTALNSLTTGAIELTKVDIDHHG 3164

Query: 223  AVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FS 272
             +    ++IL   G  +      +         L  G+Y ++     + Y  +     F+
Sbjct: 3165 TLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETQAPKGYQLDASPINFT 3224

Query: 273  VLTGKSTIVEVLMRQKRMDKNGQHN 297
            +   ++T +++ +  K+++ +   +
Sbjct: 3225 IDKAQATPLQITVSNKKIESSSGGD 3249



 Score =  132 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 45/317 (14%), Positives = 90/317 (28%), Gaps = 35/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGK-------RVVDAQRITCEARLTENSTSIDSGVS 57
            F      ++       +   I + + K         +    +           +   G  
Sbjct: 2738 FIETKAPKHYDLNEEPIKFTIERSQTKHVFVTAINSLTKGSVELIKVDDAKQNTTLEGAV 2797

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I +           T    G  V  +L PGDY    +     +       K TV   +
Sbjct: 2798 FKIVNKD-GHDVRTDLTTDKNGRLVVDELPPGDYEFIETKAPEHYDLNETPIKFTVKKGQ 2856

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            +    V   N    G + L  +    G+ +             + ++ L TDK    ++ 
Sbjct: 2857 EKIASVTATNSLTKGAVELTKVDNIDGTTLEGAIFKIVDMDGKDIRSDLTTDKDGKISVS 2916

Query: 169  RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       VE  +    ++          +    V ++ G
Sbjct: 2917 DLRPGDYQFIETKAPKHYDLNQNPIKFTVEKSQTAKASVTATNSLTKGAVELTKVDDIDG 2976

Query: 222  EAVADTAWSILTASGDTV------GESANASPSMVLSEGDYTVIARNKERNYSR-----E 270
              +A   + I+  +G  V       +         L  GDY  I     ++Y       +
Sbjct: 2977 TTLAGAIFKIVDMNGKDVHSENLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLYQNPIK 3036

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F+V   ++    V    
Sbjct: 3037 FTVEKSQTAKASVTATN 3053



 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1715 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1774

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1775 VRTDLVTNSKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1834

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1835 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFI 1894

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1895 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1954

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1955 IIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 2014

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 2015 KENITVTATN 2024



 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/316 (13%), Positives = 94/316 (29%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++   +   +   I K + + +      + +       ++ +   ++  G  +
Sbjct: 1990 FIEVKAPKDYTLSKDPIPFTIEKSQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIF 2049

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++ K+   +      G     DL PGDY    +     +         T+   + 
Sbjct: 2050 KIV-DMNGKEVHTNLVTDKNGKISVSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQT 2108

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
             +  V   NA   G + L  I             F++           L T+      + 
Sbjct: 2109 KEINVTGKNALKKGSVELTKIDDIDITTKLANAVFNLLDADGELVKEGLKTNDEGKIVVE 2168

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQN--RAAKITFKLVSEMGG 221
             L    YQ        +       +   +K    + + +T  N      +    V ++ G
Sbjct: 2169 NLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHITATNALTKGAVKLSKVDDVDG 2228

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              + D  + I+  +GD V                L  GDY  I     ++Y  +     F
Sbjct: 2229 TVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKF 2288

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++  G+   + +    
Sbjct: 2289 TIEKGQKKAISLTATN 2304



 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 93/316 (29%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I KG+ K +       +    I        N+ +  +   
Sbjct: 2270 FIETKAPKHYVLDETPIKFTIEKGQKKAISLTATNSLKQGSIELLKVDDLNTQTKLADAV 2329

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA-----SFGHVGVVKKITVSSKE 112
            +++ D    K           G  V  +L PG Y          +         T+   +
Sbjct: 2330 FNLLDQD-GKVLKTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIKKSQ 2388

Query: 113  KNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
            K+   V + N    G    S          +   F I +         L+T++    ++ 
Sbjct: 2389 KDIATVTMKNSLTKGGVELSKVNDVDGTTLEGAVFKIVNMNGTVIRKNLVTNQQGKISVS 2448

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  +S       +   +   +++          +    V ++ G
Sbjct: 2449 DLRPGDYQFIETTAPKHYDLSKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDG 2508

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+ D  + I   +G+ +      +         L  GDY  +      +Y  +     F
Sbjct: 2509 TALKDAVFKITDLNGNEIRTELTTDVHGKISVSDLRPGDYQFVETKAPEHYKLDSTPIKF 2568

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   +   ++V    
Sbjct: 2569 TIKKSQKEKLQVTATN 2584



 Score =  118 bits (295), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 51/310 (16%), Positives = 101/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            + E +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1621 REEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1679

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1680 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1739

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1740 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYKL 1799

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1800 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1859

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1860 TLQDATGKEIMKDLTTDDYGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1919

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1920 DLPIPVTVKN 1929



 Score =  116 bits (289), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 45/315 (14%), Positives = 94/315 (29%), Gaps = 35/315 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++   +   +   I+K +   +      +        +++ +   +      +
Sbjct: 2457 FIETTAPKHYDLSKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDGTALKDAVF 2516

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++  +     T  + G     DL PGDY    +             K T+   +K
Sbjct: 2517 KI-TDLNGNEIRTELTTDVHGKISVSDLRPGDYQFVETKAPEHYKLDSTPIKFTIKKSQK 2575

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    T  
Sbjct: 2576 EKLQVTATNSLTEGAVELIKVDDINPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKITAT 2635

Query: 169  RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSE-MG 220
             L   +YQ        +  ++       +E  ++   ++          +    V     
Sbjct: 2636 NLRPGDYQFIETKAPKHYDLNKTPISFTIERSQLTHASVTAKNGLTKGGVELTKVDSIDK 2695

Query: 221  GEAVADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
             E +    + I   +G     + V        +  L  GDY  I     ++Y        
Sbjct: 2696 KEMLEGAVFKITDLNGNDIRTNLVTNKDGKIIAKDLQPGDYQFIETKAPKHYDLNEEPIK 2755

Query: 271  FSVLTGKSTIVEVLM 285
            F++   ++  V V  
Sbjct: 2756 FTIERSQTKHVFVTA 2770



 Score =  116 bits (289), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 94/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1893 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1952

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1953 EFIIVDAHDTKKVIRKGLTTDKNGKISASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 2012

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 2013 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2072

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2073 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKKGSVELTKIDDI 2132

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2133 DITTKLANAVFNLLDADGELVKEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2192

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + +    
Sbjct: 2193 IVFTIKKSQTETLHITATN 2211



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/312 (10%), Positives = 85/312 (27%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1147 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1205

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1206 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1265

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1266 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNDQGQITVDNLKPGTYYLQ 1325

Query: 179  SHYGKYNAIVSTV---VKVEPGKII----DVTIQNRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  + +      ++  +        T              +  G+ +A   +S+
Sbjct: 1326 ETTAPEHYKLDSTPIQFTIKEDQTTVINRTATNSLIPGSAILTKFDKD-GKTLAGAEFSV 1384

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
                   +               +  L  GDY  +     ++Y  +     F+++  +  
Sbjct: 1385 RDRYNKVIRGYEKLTTNDQGQIEAKDLRPGDYQFVEEKAPKDYDIDKKPIEFTIIKSQKK 1444

Query: 280  IVEVLMRQKRMD 291
             + V      + 
Sbjct: 1445 ALTVTATNHLIK 1456



 Score =  109 bits (272), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++       +   I K + K +                ++ +   +   G  +
Sbjct: 1418 FVEEKAPKDYDIDKKPIEFTIIKSQKKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1477

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1478 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGAYKFIETEAPKDYTLSTNPIEFTIDKSQ 1537

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1538 QTLATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPHTNLTTDKHGKV 1597

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1598 KVSNLRPGTYKFIEIAAPEHYVLREEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1657

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1658 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1717

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1718 KPIKFTITESQTTQATVTAKN 1738


>gi|229094125|ref|ZP_04225209.1| Cell wall surface anchor [Bacillus cereus Rock3-42]
 gi|228689337|gb|EEL43156.1| Cell wall surface anchor [Bacillus cereus Rock3-42]
          Length = 632

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 45/310 (14%), Positives = 99/310 (31%), Gaps = 27/310 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           ++  +E +  T+ LL  N  K     VV+ + + + +         +  G  + +    S
Sbjct: 258 AFKGSEKVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKEVLKGAVFEV----S 313

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
           N+    + T    G     +L  G Y +       G      VKKI V + E    ++  
Sbjct: 314 NENFKQNVTTNDKGIAELGNLPIGIYSVKEIQAPAGYVLDGSVKKIEVKTGETAVLELKN 373

Query: 121 LNAGG-IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITS 179
            N  G + +  +             F+IY+    + +      +     +L    Y    
Sbjct: 374 ENVKGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTDEKGVAKFKLPYGKYTYKE 433

Query: 180 HYGKYNAIVSTV---VKVEPGKII---DVTIQNRAAKITFKLVSE-MGGEAVADTAWSIL 232
                  +++      +++    I    V  +    ++    V    G   + +  ++I 
Sbjct: 434 TIAPNGYVINEETFAFEIKENGQIIKHIVQDKKVEGELEITKVDIADGNTKLPNAEFTIY 493

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKSTI-VEVL 284
              G  V     +    +    L  G YT         Y      F+    ++   ++ +
Sbjct: 494 NEQGKEVVKGKTDEKGVAKFK-LPYGKYTYKETIAPNGYVINEETFAFEIKENGEIIKHI 552

Query: 285 MRQKRMDKNG 294
           ++ K+ +K  
Sbjct: 553 VKNKKEEKAS 562


>gi|206976375|ref|ZP_03237282.1| cell wall surface anchor family protein [Bacillus cereus H3081.97]
 gi|206745299|gb|EDZ56699.1| cell wall surface anchor family protein [Bacillus cereus H3081.97]
          Length = 632

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 45/310 (14%), Positives = 98/310 (31%), Gaps = 27/310 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           ++  +E +  T+ LL  N  K     VV+ + + + +         +  G  + +    S
Sbjct: 258 AFKGSEKVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKEVLKGAVFEV----S 313

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
           N+    + T    G     +L  G Y +       G      VKKI V + E    ++  
Sbjct: 314 NENFKQNVTTNDKGIAELGNLPIGIYSVKEIQAPAGYVLDGSVKKIEVKTGETAVLELKN 373

Query: 121 LNAGG-IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITS 179
            N  G + +  +             F+IY+    + +      +     +L    Y    
Sbjct: 374 ENVKGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTDEKGVAKFKLPYGKYTYKE 433

Query: 180 HYGKYNAIVS-TVVKVEPGKIID-----VTIQNRAAKITFKLVSE-MGGEAVADTAWSIL 232
                  +++      E  +  +     V  +    ++    V    G   + +  ++I 
Sbjct: 434 TIAPNGYVINEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDIADGNTKLPNAEFTIY 493

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKSTI-VEVL 284
              G  V     +    +    L  G YT         Y      F+    ++   ++ +
Sbjct: 494 NEQGKEVVKGKTDEKGVAKFK-LPYGKYTYKETIAPNGYVINEETFAFEIKENGEIIKHI 552

Query: 285 MRQKRMDKNG 294
           ++ K+ +K  
Sbjct: 553 VKNKKEEKAS 562


>gi|229141737|ref|ZP_04270267.1| Cell wall surface anchor [Bacillus cereus BDRD-ST26]
 gi|228641805|gb|EEK98106.1| Cell wall surface anchor [Bacillus cereus BDRD-ST26]
          Length = 632

 Score =  135 bits (339), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 45/310 (14%), Positives = 99/310 (31%), Gaps = 27/310 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           ++  +E +  T+ LL  N  K     VV+ + + + +         +  G  + +    S
Sbjct: 258 AFKGSEKVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKEVLKGAVFEV----S 313

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
           N+    + T    G     +L  G Y +       G      VKKI V + E    ++  
Sbjct: 314 NENFKQNVTTNDKGIAELGNLPIGIYSVKEIQAPAGYVLDGSVKKIEVKTGETAVLELKN 373

Query: 121 LNAGG-IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITS 179
            N  G + +  +             F+IY+    + +      +     +L    Y    
Sbjct: 374 ENVKGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTDEKGVAKFKLPYGKYTYKE 433

Query: 180 HYGKYNAIVSTV---VKVEPGKII---DVTIQNRAAKITFKLVSE-MGGEAVADTAWSIL 232
                  +++      +++    I    V  +    ++    V    G   + +  ++I 
Sbjct: 434 TIAPNGYVINEETFAFEIKENGQIIKHIVQDKKVEGELEITKVDIADGNTKLPNAEFTIY 493

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKSTI-VEVL 284
              G  V     +    +    L  G YT         Y      F+    ++   ++ +
Sbjct: 494 NEQGKEVVKGKTDEKGVAKFK-LPYGKYTYKETIAPNGYVINEETFAFEIKENGEIIKHI 552

Query: 285 MRQKRMDKNG 294
           ++ K+ +K  
Sbjct: 553 VKNKKEEKAS 562


>gi|229116987|ref|ZP_04246369.1| hypothetical protein bcere0017_32690 [Bacillus cereus Rock1-3]
 gi|228666391|gb|EEL21851.1| hypothetical protein bcere0017_32690 [Bacillus cereus Rock1-3]
          Length = 1062

 Score =  135 bits (338), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/279 (14%), Positives = 87/279 (31%), Gaps = 21/279 (7%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           +Y   + +   + LL  N  K  G   V+ +   + + +    +  + +G  + +F++ +
Sbjct: 232 AYRGTDTVQNATVLLERNEEKLSGDLAVNWEATGSLKIKKVGENGEVLAGAVFEVFNANN 291

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
                   T    G     +L  G Y +       G       + I V + E    QV  
Sbjct: 292 ESVGK--ITTGADGTAELNNLQIGTYTVKEIKAPTGYVSGDKPQTIEVKTGETGAVQVVN 349

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV-RLGTNNYQITS 179
               G            ++ + + F++++    +   +  K      V  L    Y    
Sbjct: 350 NKVKGNIEIKKLSDSGKVLPN-VEFTVFTEDGKEVKKVVTKENGIANVEGLTYGKYYFLE 408

Query: 180 HYGKYNAIVSTVVK----VEPGKIIDVTIQNRAAKITFKLVSEMG---GEAVADTAWSIL 232
                  I +         E  K +  T++N   K   KL+        + +    + + 
Sbjct: 409 TKTLNGYIENKTKYPFEIKEHNKTLTFTVENTEVKGNVKLLKVDNEDISKKLEGAVFELK 468

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY 267
            ASG  +     +         L+ G Y+ + +     Y
Sbjct: 469 DASGKVIGEYKTDKNGEVNVKNLAYGKYSFVEKASPNGY 507



 Score = 58.4 bits (139), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 28/192 (14%), Positives = 52/192 (27%), Gaps = 19/192 (9%)

Query: 8   YAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNK 67
           +   E+  T +  + N   KG  K +             E+ +    G  + + D+    
Sbjct: 424 FEIKEHNKTLTFTVENTEVKGNVKLLK---------VDNEDISKKLEGAVFELKDASGKV 474

Query: 68  KNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV---KKITVSSKEKNQKQ----VFI 120
                      G     +L  G Y         G V   + I    KE  +      V  
Sbjct: 475 IGEYK--TDKNGEVNVKNLAYGKYSFVEKASPNGYVLIKEPIVFEIKEHGKIIELLAVNH 532

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALL-ITDKVRSGTLVRLGTNNYQITS 179
           L  G + +  +             F+IY+    + +   TD        +L    Y    
Sbjct: 533 LIKGDLEITKVDVADGNNKLPNAEFTIYNEAGKEVVKGKTDDKGIAKFEKLPFGKYTYKE 592

Query: 180 HYGKYNAIVSTV 191
                  +++  
Sbjct: 593 TVAPKGYVLNEE 604



 Score = 46.8 bits (109), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 30/86 (34%), Gaps = 10/86 (11%)

Query: 208 AAKITFKLVSEMGGEAVADTAWSILTAS----GDTVGESANASPSMVLSEGDYTVIARNK 263
              +  K V    GE +A   + +  A+    G     +   +    L  G YTV     
Sbjct: 264 TGSLKIKKV-GENGEVLAGAVFEVFNANNESVGKITTGADGTAELNNLQIGTYTVKEIKA 322

Query: 264 ERNYS-----REFSVLTGKSTIVEVL 284
              Y      +   V TG++  V+V+
Sbjct: 323 PTGYVSGDKPQTIEVKTGETGAVQVV 348


>gi|229181606|ref|ZP_04308931.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus 172560W]
 gi|228601802|gb|EEK59298.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus 172560W]
          Length = 2845

 Score =  134 bits (337), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/326 (13%), Positives = 100/326 (30%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I+K +   +      +        +++ +   +      +
Sbjct: 2424 FIETTAPKHYDLNKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDGTALKDAVF 2483

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++ K      T  + G     DL PGDY    +             K T+   +K
Sbjct: 2484 KI-TDMNGKDIRTELTTDVHGKISVSDLRPGDYQFVETKAPKHYKLDSTPIKFTIKKSQK 2542

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +    S     +  F+I        +  L TDK    ++ 
Sbjct: 2543 EKLQVTATNSLTEGAVELIKVDDINSDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKISVS 2602

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         I    V     
Sbjct: 2603 DLRPGDYQFIETKAPTGYDLNVKPIPFTITKGQSQVTSVTALNSLTTGSIELTKVDIDHH 2662

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 2663 GTLEGAIFNILDQDGKIIREGLKTDQHGKVIVNDLKPGNYQLVETKAPKGYQLDASPINF 2722

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++  +++ +  K+++ +   +
Sbjct: 2723 TIDKAQAKPLQITVSNKKIESSSGGD 2748



 Score =  128 bits (321), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1682 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1741

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1742 VRTDLVTNNKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1801

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1802 LTKGKVKLIKEDDVESSKALAGAVFTLQDPTGKEIMKDLTTDDHGVLVIPDLAPGDYQFI 1861

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1862 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1921

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1922 IIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 1981

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1982 KENITVTATN 1991



 Score =  123 bits (309), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/316 (13%), Positives = 95/316 (30%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++   +   +   I K + + +      + +       ++ +   ++  G  +
Sbjct: 1957 FIEVKAPKDYTLSKDPIPFTIEKSQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIF 2016

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++ K+   +      G     DL PGDY    +     +         T+   + 
Sbjct: 2017 KIV-DMNGKEVHTNLVTDKNGKISVSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQT 2075

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
             +  V   NA   G + L  I             F++           L T+      + 
Sbjct: 2076 KEINVTGKNALKKGSVELTKIDDIDINTKLSNAVFNLLDADGELVEEGLKTNAEGKIVVE 2135

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQN--RAAKITFKLVSEMGG 221
             L    YQ        +       +   +K    + + +T  N      +    V ++ G
Sbjct: 2136 NLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHITATNALTKGAVKLSKVDDIDG 2195

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              + D  + I+  +GD V                L  GDY  I     ++Y  +     F
Sbjct: 2196 TVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKF 2255

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++  G+  ++ +    
Sbjct: 2256 TIEKGQKKVISLTATN 2271



 Score =  122 bits (305), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 42/316 (13%), Positives = 98/316 (31%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I KG+ K +       +    I        N+ +  +   
Sbjct: 2237 FIETKAPKHYVLDETPIKFTIEKGQKKVISLTATNSLKQGSIELLKVDDLNTQTKLADAV 2296

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA-----SFGHVGVVKKITVSSKE 112
            +++ D    K           G  V  +L PG Y          +         T+   +
Sbjct: 2297 FNLLDQD-GKVLKTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQ 2355

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K+   V + N    GG++L  +    G+ +          +    +  L+T++    ++ 
Sbjct: 2356 KDIATVTMKNSLTKGGVKLSKVDDVDGTTLEGAVFKIVDMNGTVIRKDLVTNQQGKISVS 2415

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +   +   +++          +    V ++ G
Sbjct: 2416 DLRPGDYQFIETTAPKHYDLNKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDG 2475

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+ D  + I   +G  +      +         L  GDY  +     ++Y  +     F
Sbjct: 2476 TALKDAVFKITDMNGKDIRTELTTDVHGKISVSDLRPGDYQFVETKAPKHYKLDSTPIKF 2535

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   +   ++V    
Sbjct: 2536 TIKKSQKEKLQVTATN 2551



 Score =  120 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 51/310 (16%), Positives = 101/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1588 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1646

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1647 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1706

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1707 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNNKGMLVVDDLRPGNYKL 1766

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1767 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1826

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++   +G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1827 TLQDPTGKEIMKDLTTDDHGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1886

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1887 DLPIPVTVKN 1896



 Score =  119 bits (297), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 46/319 (14%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1860 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1919

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1920 EFIIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 1979

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1980 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2039

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2040 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKKGSVELTKIDDI 2099

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +++  +++L A G+ V       +        L  G Y  +      +Y  +   
Sbjct: 2100 DINTKLSNAVFNLLDADGELVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2159

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + +    
Sbjct: 2160 IVFTIKKSQTETLHITATN 2178



 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 32/312 (10%), Positives = 82/312 (26%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1114 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1172

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1173 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1232

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1233 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNDKGQITVDNLKPGTYYLK 1292

Query: 179  SHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +        +E  +   +                 V +  G  +    +S+
Sbjct: 1293 EIKAPEHYQLDDRLIEFTIEEDQTTVINKTAQNSLIRGSAILTKVDKE-GNTLEGAVFSV 1351

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
               +   +               +  L  G+Y  +      +Y  +     F++   +  
Sbjct: 1352 RDQNNKRIPGYTKLTTNGNGQIEAKNLLPGEYQFVEEKAPEHYEIDKKPLKFTIEKSQQK 1411

Query: 280  IVEVLMRQKRMD 291
             + V      + 
Sbjct: 1412 ALTVTATNHLIK 1423



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+       L   I K + K +                ++ +   +   G  +
Sbjct: 1385 FVEEKAPEHYEIDKKPLKFTIEKSQQKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1444

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1445 KIVDANDEKQVIRENIKTGSDGKVTIKDLEPGVYKFIETEAPKDYTLSTNPIEFTIDKSQ 1504

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1505 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPYTNLTTDKHGKV 1564

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1565 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1624

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1625 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1684

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1685 KPIKFTITESQTTQATVTAKN 1705


>gi|313622790|gb|EFR93123.1| peptidoglycan binding protein [Listeria innocua FSL J1-023]
          Length = 1530

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/302 (14%), Positives = 90/302 (29%), Gaps = 28/302 (9%)

Query: 14   MHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLST 73
              + +T ++   + G G        +       +++T   +G  + ++    +K      
Sbjct: 991  YKSRTTNISPAFTIGSGSGTATIGSLEITKVDKKDNTKKLAGAKFQLYTLEGDKAGQ-EA 1049

Query: 74   TKKIIGGKVSFDLFPGDYLISASFGHVGVV--------KKITVSSKEKNQKQVFILNAGG 125
            T    G  V   L  G Y +  +    G          K+IT+++       +      G
Sbjct: 1050 TTDSEGKIVMDGLQSGKYKLVETAAPTGYTISDEYKDGKEITITADVATSVTIENTEQTG 1109

Query: 126  IRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGK 183
              +       +        F +      K    L+TD      +  L   +YQ       
Sbjct: 1110 SAVLQKEDSVTKATIAGAEFELQKADGTKVSENLVTDADGKIEVTDLAPGDYQFVETKAP 1169

Query: 184  YNAIVS-----TVVKVEPGKIIDVTIQNRA--AKITFKLVSEMGGEAVADTAWSILTASG 236
                +        ++      + VT +N A    +    +       +A   + + T  G
Sbjct: 1170 TGYELDAAPVIFTIEFNQATAVKVTKENVAKTGSVVLTKLDSKSKSNLAGAEFELQTKLG 1229

Query: 237  -----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMR 286
                   V E+        L+ GDY ++     + Y  +     F++   +   V+V   
Sbjct: 1230 VSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPKGYELDATPVEFTIEFNQKDAVQVTKT 1289

Query: 287  QK 288
             K
Sbjct: 1290 NK 1291



 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/296 (12%), Positives = 83/296 (28%), Gaps = 36/296 (12%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            TS  + N    G      +                  +G  + +  +    K + +    
Sbjct: 1098 TSVTIENTEQTGSAVLQKEDSVTKAT----------IAGAEFELQKAD-GTKVSENLVTD 1146

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGVVKK-----ITVSSKEKNQKQVFILNA--GGIRLY 129
              G     DL PGDY    +    G          T+   +    +V   N    G  + 
Sbjct: 1147 ADGKIEVTDLAPGDYQFVETKAPTGYELDAAPVIFTIEFNQATAVKVTKENVAKTGSVVL 1206

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKAL--LITDKVRSGTLVRLGTNNYQITSHYGKYNA- 186
            +     S        F + +         ++T+      +  L   +YQ+          
Sbjct: 1207 TKLDSKSKSNLAGAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPKGYE 1266

Query: 187  ----IVSTVVKVEPGKIIDVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASGDTV- 239
                 V   ++      + VT  N+     +            +AD  + ++ A  +   
Sbjct: 1267 LDATPVEFTIEFNQKDAVQVTKTNKMSTGSVVLTKTDGQTKAPLADATFKLVDADNNVTE 1326

Query: 240  ---GESANASPSMVLSEGDYTVIARNKERNYS-----REFSVLTGKSTIVEVLMRQ 287
                +++       L+ GDY +I     + Y       +  +   ++ +++V    
Sbjct: 1327 NLTTDASGKLEITNLAPGDYQLIETKAPKGYELDTVPVDVKIDFNQNQVLQVTKTN 1382



 Score = 72.7 bits (176), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 32/215 (14%), Positives = 69/215 (32%), Gaps = 15/215 (6%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T         K   + V     +      +++ ++  +G  + +               +
Sbjct: 1182 TIEFNQATAVKVTKENVAKTGSVVLTKLDSKSKSN-LAGAEFELQT-KLGVSLKDKVVTE 1239

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G     +L PGDY +  +    G        + T+   +K+  QV   N    G  + 
Sbjct: 1240 ANGQLQIDNLAPGDYQLVETKAPKGYELDATPVEFTIEFNQKDAVQVTKTNKMSTGSVVL 1299

Query: 130  SIYKPGSPIVDDELTFSIYS-NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIV 188
            +     +     + TF +   + N    L TD      +  L   +YQ+          +
Sbjct: 1300 TKTDGQTKAPLADATFKLVDADNNVTENLTTDASGKLEITNLAPGDYQLIETKAPKGYEL 1359

Query: 189  ST-----VVKVEPGKIIDVTIQNRAAKITFKLVSE 218
             T      +     +++ VT  N    ++ K+++E
Sbjct: 1360 DTVPVDVKIDFNQNQVLQVTKTNIKTVVSGKVIAE 1394



 Score = 37.6 bits (85), Expect = 2.4,   Method: Composition-based stats.
 Identities = 8/70 (11%), Positives = 21/70 (30%), Gaps = 4/70 (5%)

Query: 205 QNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVGE----SANASPSMVLSEGDYTVIA 260
           +     +      +   E +  + + I         +    +   +    L  GDY V  
Sbjct: 35  ETAKTTLKITKEDKDTKEKINGSTFEIKNKETSETTDLTISANGEATMDSLLPGDYLVKE 94

Query: 261 RNKERNYSRE 270
           +   + Y+ +
Sbjct: 95  KVAPKGYTLD 104


>gi|229082571|ref|ZP_04215034.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus Rock4-2]
 gi|228701003|gb|EEL53526.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus Rock4-2]
          Length = 2842

 Score =  134 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 98/326 (30%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I+K +   +      +        +++ +   +      +
Sbjct: 2437 FIETTAPKHYDLNKEPIPFTITKSQADPISVTATNSLTKGTVELSKVDDVDGTALKDAIF 2496

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T  + G     DL PGDY    +             K T+   +K
Sbjct: 2497 KI-TDMNGNDIRTELTTDVHGKISVSDLRPGDYQFIETKAPEHYKLDSTPIKFTIKKSQK 2555

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    ++ 
Sbjct: 2556 EKLQVTATNSLTEGAVELIKVDDINPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKISVS 2615

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         I    V     
Sbjct: 2616 DLRPGDYQFIETKAPTGYDLNVKPIPFTITKGQSQVTSVTALNSLTTGSIELTKVDIDHH 2675

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 2676 GTLEGAIFNILDQDGKVIREGLKTDQHGKVIVNDLKPGNYQLVETKAPKGYQLDASPINF 2735

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++  +++ +  K+++ +   +
Sbjct: 2736 TIDKAQAKPLQITVSNKKIESSSGGD 2761



 Score =  128 bits (321), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 42/310 (13%), Positives = 86/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1695 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1754

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1755 VRTDLVTNNKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1814

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1815 LTKGKVKLIKEDDVESSKALAGAVFTLQDPTGKEIMKDLTTDDHGVLVIPDLAPGDYQFI 1874

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1875 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1934

Query: 230  SILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A         D   +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1935 IIVDAHDTKKVIRKDLTTDKNGKITASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 1994

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1995 KENITVTATN 2004



 Score =  123 bits (309), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/316 (13%), Positives = 95/316 (30%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++   +   +   I K + + +      + +       ++ +   ++  G  +
Sbjct: 1970 FIEVKAPKDYTLSKDPIPFTIEKSQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIF 2029

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++ K+   +      G     DL PGDY    +     +         T+   + 
Sbjct: 2030 KIV-DMNGKEVHTNLVTDKNGKISVSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQT 2088

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
             +  V   NA   G + L  I             F++           L T+      + 
Sbjct: 2089 KEINVTGKNALKKGSVELTKIDDIDINTKLSNAVFNLLDADGELVEEGLKTNAEGKIVVE 2148

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQN--RAAKITFKLVSEMGG 221
             L    YQ        +       +   +K    + + +T  N      +    V ++ G
Sbjct: 2149 NLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHITATNALTKGAVKLSKVDDIDG 2208

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              + D  + I+  +GD V                L  GDY  I     ++Y  +     F
Sbjct: 2209 TVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKF 2268

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++  G+  ++ +    
Sbjct: 2269 TIEKGQKKVISLTATN 2284



 Score =  120 bits (299), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 51/310 (16%), Positives = 101/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1601 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1659

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1660 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1719

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1720 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNNKGMLVVDDLRPGNYKL 1779

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1780 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1839

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++   +G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1840 TLQDPTGKEIMKDLTTDDHGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1899

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1900 DLPIPVTVKN 1909



 Score =  119 bits (298), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 46/319 (14%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1873 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1932

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1933 EFIIVDAHDTKKVIRKDLTTDKNGKITASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 1992

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1993 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2052

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2053 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKKGSVELTKIDDI 2112

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +++  +++L A G+ V       +        L  G Y  +      +Y  +   
Sbjct: 2113 DINTKLSNAVFNLLDADGELVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2172

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + +    
Sbjct: 2173 IVFTIKKSQTETLHITATN 2191



 Score =  118 bits (296), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 44/319 (13%), Positives = 90/319 (28%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K + + +               +++ +   ++   
Sbjct: 2154 TYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHITATNALTKGAVKLSKVDDIDGTVLKD 2213

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              + I + ++             G     DL PGDY    +     +       K T+  
Sbjct: 2214 AVFKIVN-MNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKFTIEK 2272

Query: 111  KEKNQKQ---VFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNH--KALLITDKVRSG 165
             +K          L  G I L  +    +     +  F++        K  L T+     
Sbjct: 2273 GQKKVISLTATNSLKQGSIELLKVDDLNTQTKLADAVFNLLDQDGKVLKTDLKTNSEGKI 2332

Query: 166  TLVRLGTNNYQITSHYGKYNAIVS-----TVVKVEPGKIIDVTIQN--RAAKITFKLVSE 218
             +  L    YQ        +  +        ++     I  VT++N      +    V +
Sbjct: 2333 VIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDD 2392

Query: 219  MGGEAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            + G  +    + I+  +G       V           L  GDY  I     ++Y      
Sbjct: 2393 VDGTTLEGAVFKIVDMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYDLNKEP 2452

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2453 IPFTITKSQADPISVTATN 2471



 Score =  118 bits (295), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 47/317 (14%), Positives = 95/317 (29%), Gaps = 34/317 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K +        + +        +++ +   +   G
Sbjct: 2341 TYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDDVDGTTLEG 2400

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              + I   ++             G     DL PGDY    +     +         T++ 
Sbjct: 2401 AVFKIV-DMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYDLNKEPIPFTITK 2459

Query: 111  KEKNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             + +   V   N    G + L  +    G+ + D     +  +  + +  L TD     +
Sbjct: 2460 SQADPISVTATNSLTKGTVELSKVDDVDGTALKDAIFKITDMNGNDIRTELTTDVHGKIS 2519

Query: 167  LVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG- 220
            +  L   +YQ        +       +   +K    + + VT  N   +   +L+     
Sbjct: 2520 VSDLRPGDYQFIETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELIKVDDI 2579

Query: 221  --GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 ++D  ++I+ A G  V      +         L  GDY  I       Y      
Sbjct: 2580 NPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNVKP 2639

Query: 270  -EFSVLTGKSTIVEVLM 285
              F++  G+S +  V  
Sbjct: 2640 IPFTITKGQSQVTSVTA 2656



 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 32/312 (10%), Positives = 82/312 (26%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1127 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1185

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1186 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1245

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1246 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNDKGQITVDNLKPGTYYLK 1305

Query: 179  SHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +        +E  +   +                 V +  G  +    +S+
Sbjct: 1306 EIKAPEHYQLDDRLIEFTIEEDQTTVINKTAQNSLIRGSAILTKVDKE-GNTLEGAVFSV 1364

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
               +   +               +  L  G+Y  +      +Y  +     F++   +  
Sbjct: 1365 RDQNNKRIPGYTKLTTNGNGQIEAKNLLPGEYQFVEEKAPEHYEIDKKPLKFTIEKSQQK 1424

Query: 280  IVEVLMRQKRMD 291
             + V      + 
Sbjct: 1425 ALTVTATNHLIK 1436



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+       L   I K + K +                ++ +   +   G  +
Sbjct: 1398 FVEEKAPEHYEIDKKPLKFTIEKSQQKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1457

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1458 KIVDANDEKQVIRENIKTGSDGKVTIKDLEPGVYKFIETEAPKDYTLSTNPIEFTIDKSQ 1517

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1518 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPYTNLTTDKHGKV 1577

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1578 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1637

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1638 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1697

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1698 KPIKFTITESQTTQATVTAKN 1718



 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 36/236 (15%), Positives = 67/236 (28%), Gaps = 22/236 (9%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I K + +++       +    +        N  +  S   
Sbjct: 2530 FIETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELIKVDDINPDTKLSDAV 2589

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            ++I      K      T    G     DL PGDY    +    G          T++  +
Sbjct: 2590 FNII-DAKGKIVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNVKPIPFTITKGQ 2648

Query: 113  KNQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V  LN    G I L  +       +               +  L TD+     + 
Sbjct: 2649 SQVTSVTALNSLTTGSIELTKVDIDHHGTLEGAIFNILDQDGKVIREGLKTDQHGKVIVN 2708

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEM 219
             L   NYQ+               ++  +     K + +T+ N+  + +     + 
Sbjct: 2709 DLKPGNYQLVETKAPKGYQLDASPINFTIDKAQAKPLQITVSNKKIESSSGGDDKP 2764


>gi|228917648|ref|ZP_04081190.1| Cell wall surface anchor [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228842025|gb|EEM87130.1| Cell wall surface anchor [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
          Length = 723

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/307 (14%), Positives = 98/307 (31%), Gaps = 27/307 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           ++  +E +  T+ LL  N  K     VV+ + + + +         +  G  + +    S
Sbjct: 258 AFKGSEKVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKELLKGAVFEV----S 313

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
           N+    + T    G     +L  G Y +       G      VKK+ V + E    ++  
Sbjct: 314 NENFKQNITTNDKGIAELGNLPIGIYSVKEIQAPAGYVLDGSVKKVEVKNGETAVLELKN 373

Query: 121 LNAGG-IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITS 179
            N  G + +  +             F+IY+    + +      +     +L    Y    
Sbjct: 374 ENVKGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTDEKGVAKFKLPYGKYTYKE 433

Query: 180 HYGKYNAIVS-TVVKVEPGKIID-----VTIQNRAAKITFKLVS-EMGGEAVADTAWSIL 232
                  +V+      E  +  +     V  +    ++    V    G   + +  ++I 
Sbjct: 434 TIAPNGYVVNEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 493

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKSTI-VEVL 284
              G  V     +    +    L  G YT         Y      F+    ++   ++ +
Sbjct: 494 NEQGKEVVKGKTDEKGVAKFK-LPYGKYTYKETIAPNGYVINEETFAFEIKENGEIIKHI 552

Query: 285 MRQKRMD 291
           ++ K+++
Sbjct: 553 VQDKKVE 559



 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/281 (10%), Positives = 72/281 (25%), Gaps = 26/281 (9%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +        +  +      + I++    +           G    F L  G Y    
Sbjct: 377 KGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGK--TDEKG-VAKFKLPYGKYTYKE 433

Query: 96  SFGHVGVVKK-----ITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIY 148
           +    G V         +    +  K +       G + +  +             F+IY
Sbjct: 434 TIAPNGYVVNEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 493

Query: 149 SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST-VVKVEPGKIID-----V 202
           +    + +      +     +L    Y           +++      E  +  +     V
Sbjct: 494 NEQGKEVVKGKTDEKGVAKFKLPYGKYTYKETIAPNGYVINEETFAFEIKENGEIIKHIV 553

Query: 203 TIQNRAAKITFKLVSE-MGGEAVADTAWSILTASGDTV----GESANASPSMVLSEGDYT 257
             +    ++    V    G   + +  ++I    G  V               L  G YT
Sbjct: 554 QDKKVEGELEITKVDIADGNTKLPNAEFTIYNEQGKEVVKGKTNEQG-IAKFKLPYGKYT 612

Query: 258 VIARNKERNY---SREFSVLTGKSTI-VEVLMRQKRMDKNG 294
                    Y     +F     ++   ++ +++ K+ +K  
Sbjct: 613 YKETIAPNGYVINEEKFGFEIKENGEIIKHIVKNKKEEKAS 653



 Score = 41.5 bits (95), Expect = 0.15,   Method: Composition-based stats.
 Identities = 20/144 (13%), Positives = 35/144 (24%), Gaps = 6/144 (4%)

Query: 2   TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
           TI+ + Y   E         N  I K   +       +        +  +      + I+
Sbjct: 525 TIAPNGYVINEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDIADGNTKLPNAEFTIY 584

Query: 62  DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK---KITVSSKEKNQKQV 118
           +    +            G   F L  G Y    +    G V    K     KE  +   
Sbjct: 585 NEQGKEVVKGK---TNEQGIAKFKLPYGKYTYKETIAPNGYVINEEKFGFEIKENGEIIK 641

Query: 119 FILNAGGIRLYSIYKPGSPIVDDE 142
            I+        S     +    + 
Sbjct: 642 HIVKNKKEEKASFPSKPNKPTPNG 665


>gi|228955607|ref|ZP_04117606.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            serovar kurstaki str. T03a001]
 gi|228804069|gb|EEM50689.1| Lpxtg-motif cell wall anchor domain protein [Bacillus thuringiensis
            serovar kurstaki str. T03a001]
          Length = 2782

 Score =  133 bits (335), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/326 (13%), Positives = 99/326 (30%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I+K +   +      +        +++ +   +   G  +
Sbjct: 2377 FIETTAPKHYDLNKEPIPFTITKSQADPISVTATNSLTKGTVELSKVDDVDGTALKGAIF 2436

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T  + G     DL PGDY    +             K T+   +K
Sbjct: 2437 KI-TDMNGNDIGTELTTDVHGKISVSDLRPGDYQFIETKAPEHYKLDSTPIKFTIKKSQK 2495

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    ++ 
Sbjct: 2496 EKLQVTATNSLTEGAVELIKVDDINPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKISVS 2555

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         I    V     
Sbjct: 2556 DLRPGDYQFIETKAPTGYDLNVKPIPFTITKGQSQVTSVTALNSLTTGSIELTKVDIDHH 2615

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 2616 GTLEGAIFNILDQDGKVIREGLKTDQHGKVIVNDLKPGNYQLVETKAPKGYQLDASPINF 2675

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++  +++ +  K+++ +   +
Sbjct: 2676 TIDKAQAKPLQITVSNKKIESSSGGD 2701



 Score =  126 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1635 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1694

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1695 VRTDLVTNSKGMLVVDDLRPGNYELIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1754

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1755 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDHGVLVIPDLAPGDYQFI 1814

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1815 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1874

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1875 IIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 1934

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1935 KENITVTATN 1944



 Score =  121 bits (304), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 45/317 (14%), Positives = 96/317 (30%), Gaps = 36/317 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++   +   +   I K + + +       +    +T   ++ +   ++  G  
Sbjct: 1910 FIEVKAPKDYTLSKDPIPFTIEKSQKENITVTATNGLKKGAVTLT-KIDDIDRTMLEGAI 1968

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKE 112
            + I   ++ K+   +      G     DL PGDY    +     +         T+   +
Sbjct: 1969 FKIV-DMNGKEVHTNLVTDKNGKISVSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQ 2027

Query: 113  KNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTL 167
              +  V   NA   G + L  I             F++           L T+      +
Sbjct: 2028 TKEINVTGKNALKKGSVELTKIDDIDINTKLSNAVFNLLDADGELVEEGLKTNAEGKIVV 2087

Query: 168  VRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQN--RAAKITFKLVSEMG 220
              L    YQ        +       +   +K    + + +T  N      +    V ++ 
Sbjct: 2088 ENLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHITATNALTKGAVKLSKVDDID 2147

Query: 221  GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE----- 270
            G  + D  + I+  +GD V                L  GDY  I     ++Y  +     
Sbjct: 2148 GTVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIK 2207

Query: 271  FSVLTGKSTIVEVLMRQ 287
            F++  G+  ++ +    
Sbjct: 2208 FTIEKGQKKVISLTATN 2224



 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 49/291 (16%), Positives = 97/291 (33%), Gaps = 31/291 (10%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN-TLSTTKKIIGGKVSFDLF 87
            K +  +    +        + T+   G  + I D+   KK    +      G  ++  L 
Sbjct: 1560 KAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLR 1618

Query: 88   PGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN---AGGIRLYSIYKPGSPIV 139
            PGDY          +       K T++  +  Q  V   N    GGI L  +        
Sbjct: 1619 PGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKET 1678

Query: 140  DDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTV 191
             +   F I +   N + +  L+T+      +  L   NY++               +   
Sbjct: 1679 LEGAVFKIVNRDTNEDVRTDLVTNSKGMLVVDDLRPGNYELIETKAPTYYDVNVEPIEFT 1738

Query: 192  VKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAWSILTASGDTV-----GESA 243
            ++    K++ +T +N   K   KL+        +A+A   +++  A+G  +      +  
Sbjct: 1739 IEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDH 1798

Query: 244  NASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQKR 289
                   L+ GDY  I      +Y  +     F++  G    + + +  K 
Sbjct: 1799 GVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKN 1849



 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/317 (14%), Positives = 93/317 (29%), Gaps = 34/317 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K +        + +        +++ +   +   G
Sbjct: 2281 TYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDDVDGTTLEG 2340

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              + I   ++             G     DL PGDY    +     +         T++ 
Sbjct: 2341 AVFKIV-DMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYDLNKEPIPFTITK 2399

Query: 111  KEKNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
             + +   V   N    G + L  +    G+ +       +  +  +    L TD     +
Sbjct: 2400 SQADPISVTATNSLTKGTVELSKVDDVDGTALKGAIFKITDMNGNDIGTELTTDVHGKIS 2459

Query: 167  LVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG- 220
            +  L   +YQ        +       +   +K    + + VT  N   +   +L+     
Sbjct: 2460 VSDLRPGDYQFIETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELIKVDDI 2519

Query: 221  --GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 ++D  ++I+ A G  V      +         L  GDY  I       Y      
Sbjct: 2520 NPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNVKP 2579

Query: 270  -EFSVLTGKSTIVEVLM 285
              F++  G+S +  V  
Sbjct: 2580 IPFTITKGQSQVTSVTA 2596



 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/319 (14%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1813 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1872

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1873 EFIIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 1932

Query: 111  KEKNQKQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1933 SQKENITVTATNGLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 1992

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 1993 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKKGSVELTKIDDI 2052

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +++  +++L A G+ V       +        L  G Y  +      +Y  +   
Sbjct: 2053 DINTKLSNAVFNLLDADGELVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2112

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + +    
Sbjct: 2113 IVFTIKKSQTETLHITATN 2131



 Score =  117 bits (292), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 44/319 (13%), Positives = 90/319 (28%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K + + +               +++ +   ++   
Sbjct: 2094 TYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHITATNALTKGAVKLSKVDDIDGTVLKD 2153

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              + I + ++             G     DL PGDY    +     +       K T+  
Sbjct: 2154 AVFKIVN-MNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKFTIEK 2212

Query: 111  KEKNQKQ---VFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNH--KALLITDKVRSG 165
             +K          L  G I L  +    +     +  F++        K  L T+     
Sbjct: 2213 GQKKVISLTATNSLKQGSIELLKVDDLNTQTKLADAVFNLLDQDGKVLKTDLKTNSEGKI 2272

Query: 166  TLVRLGTNNYQITSHYGKYNAIVS-----TVVKVEPGKIIDVTIQN--RAAKITFKLVSE 218
             +  L    YQ        +  +        ++     I  VT++N      +    V +
Sbjct: 2273 VIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDD 2332

Query: 219  MGGEAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            + G  +    + I+  +G       V           L  GDY  I     ++Y      
Sbjct: 2333 VDGTTLEGAVFKIVDMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYDLNKEP 2392

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2393 IPFTITKSQADPISVTATN 2411



 Score =  109 bits (271), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 45/321 (14%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      EN       L   I K + K +                ++ +   +   G  +
Sbjct: 1338 FVEEKAPENYEIDKKPLKFTIDKSQQKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1397

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1398 KIVDANDEKQVIRENIKTGSDGKVTVKDLEPGVYKFIETEAPKDYTLSTNPIEFTIDKSQ 1457

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1458 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPYTNLTTDKNGKV 1517

Query: 166  TLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1518 KVSNLRPGTYKFIEIAAPEHYVLRAEPIKFTIDRSQKETLLVKAENALKPGDVELTKVDD 1577

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1578 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1637

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1638 KPIKFTITESQTTQATVTAKN 1658



 Score =  108 bits (270), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 33/312 (10%), Positives = 82/312 (26%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1067 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1125

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1126 KITTDKDGITKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1185

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1186 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDQKIISEHEKLTTNDKGQITVDNLKPGTYYLK 1245

Query: 179  SHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +        +E  +   +                 V +  G  +    +S+
Sbjct: 1246 EIKAPEHYQLDDRLIEFTIEEDQTTVINKTAQNSLIRGSAILTKVDKE-GNTLEGAVFSV 1304

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
               +   +               +  L  G+Y  +      NY  +     F++   +  
Sbjct: 1305 RDQNNKRIPGYTKLTTNGNGQIEAKNLLPGEYQFVEEKAPENYEIDKKPLKFTIDKSQQK 1364

Query: 280  IVEVLMRQKRMD 291
             + V      + 
Sbjct: 1365 ALTVTATNHLIK 1376



 Score = 76.1 bits (185), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 36/236 (15%), Positives = 67/236 (28%), Gaps = 22/236 (9%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I K + +++       +    +        N  +  S   
Sbjct: 2470 FIETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELIKVDDINPDTKLSDAV 2529

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            ++I      K      T    G     DL PGDY    +    G          T++  +
Sbjct: 2530 FNII-DAKGKIVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNVKPIPFTITKGQ 2588

Query: 113  KNQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V  LN    G I L  +       +               +  L TD+     + 
Sbjct: 2589 SQVTSVTALNSLTTGSIELTKVDIDHHGTLEGAIFNILDQDGKVIREGLKTDQHGKVIVN 2648

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEM 219
             L   NYQ+               ++  +     K + +T+ N+  + +     + 
Sbjct: 2649 DLKPGNYQLVETKAPKGYQLDASPINFTIDKAQAKPLQITVSNKKIESSSGGDDKP 2704


>gi|65317006|ref|ZP_00389965.1| COG4932: Predicted outer membrane protein [Bacillus anthracis str.
           A2012]
 gi|167634860|ref|ZP_02393178.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0442]
 gi|170685829|ref|ZP_02877052.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0465]
 gi|177652280|ref|ZP_02934783.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0174]
 gi|190567213|ref|ZP_03020128.1| cell wall surface anchor family protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|227817790|ref|YP_002817799.1| cell wall surface anchor family protein [Bacillus anthracis str.
           CDC 684]
 gi|229604513|ref|YP_002869257.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0248]
 gi|167529610|gb|EDR92359.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0442]
 gi|170670293|gb|EDT21033.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0465]
 gi|172082286|gb|EDT67352.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0174]
 gi|190561717|gb|EDV15687.1| cell wall surface anchor family protein [Bacillus anthracis
           Tsiankovskii-I]
 gi|227003140|gb|ACP12883.1| cell wall surface anchor family protein [Bacillus anthracis str.
           CDC 684]
 gi|229268921|gb|ACQ50558.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0248]
          Length = 632

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/310 (14%), Positives = 96/310 (30%), Gaps = 27/310 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           ++  +E +  T+ LL  N  K     VV+ + + + +         +  G  + +    S
Sbjct: 258 AFKGSEKVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKEVLKGAVFEV----S 313

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
           N+    + T    G     +L  G Y +       G      VKKI V + E    ++  
Sbjct: 314 NENFKQNVTTSDKGIAELGNLPIGIYSVKEIQAPAGYVLDRSVKKIEVKTGETAVLELKN 373

Query: 121 LNAGG-IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITS 179
            N  G + +  +             F+IY+    + +      +     +L    Y    
Sbjct: 374 ENVKGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTDEKGVAKFKLPYGKYTYKE 433

Query: 180 HYGKYNAIVS-TVVKVEPGKIID-----VTIQNRAAKITFKLVS-EMGGEAVADTAWSIL 232
                  +++      E  +  +     V  +    ++    V    G   + +  ++I 
Sbjct: 434 TIAPNGYVINEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 493

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKSTI-VEVL 284
              G  V               L  G YT         Y     +F     ++   ++ +
Sbjct: 494 NEQGKEVVKGKTNEQG-IAKFKLPYGKYTYKETIAPNGYVINEEKFGFEIKENGEIIKHI 552

Query: 285 MRQKRMDKNG 294
           ++ K+ +K  
Sbjct: 553 VKNKKEEKAS 562


>gi|206970008|ref|ZP_03230961.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus AH1134]
 gi|206734585|gb|EDZ51754.1| lpxtg-motif cell wall anchor domain protein [Bacillus cereus AH1134]
          Length = 2852

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 98/326 (30%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I+K +   +      +        +++ +   +      +
Sbjct: 2431 FIETTAPKHYDLNKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDGTALKDAIF 2490

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T  + G     DL PGDY    +             K T+   +K
Sbjct: 2491 KI-TDMNGNDIRTELTTDVHGKISVSDLRPGDYQFIETKAPEHYKLDSTPIKFTIKKSQK 2549

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    ++ 
Sbjct: 2550 EKLQVTATNSLTEGAVELIKVDDINPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKISVS 2609

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         I    V     
Sbjct: 2610 DLRPGDYQFIETKAPTGYDLNVKPIPFTITKGQSQVTSVTALNSLTTGSIELTKVDIDHH 2669

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 2670 GTLEGAIFNILDQDGKVIREGLKTDQHGKVIVNDLKPGNYQLVETKAPKGYQLDASPINF 2729

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++  +++ +  K+++ +   +
Sbjct: 2730 TIDKAQAKPLQITVSNKKIESSSGGD 2755



 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 43/310 (13%), Positives = 86/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1689 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1748

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1749 VRTDLVTNSKGRLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1808

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1809 LTKGKVKLIKEDDVESSKALAGAVFTLQDATGKEIMKDLTTDDHGVLVIPDLAPGDYQFI 1868

Query: 179  SHYGKYNAIVS-TVVKVEPGKI--------IDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +  T +K    K         + V        +T   V ++ G  +    +
Sbjct: 1869 ETKAPEHYKLDKTPIKFTIKKASKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1928

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1929 IIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 1988

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1989 KENITVTATN 1998



 Score =  120 bits (300), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 43/316 (13%), Positives = 97/316 (30%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      ++     T +   I KG+ K +       +    I        N+ +  +   
Sbjct: 2244 FIETKAPKHYVLDETPIKFTIEKGQKKAISLTATNSLQQGSIELLKVDDLNTQTKLADAV 2303

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA-----SFGHVGVVKKITVSSKE 112
            +++ D    K           G  V  +L PG Y          +         T+   +
Sbjct: 2304 FNLLDQD-GKVLKTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQ 2362

Query: 113  KNQKQVFILN---AGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
            K+   V + N    GG+ L  +    G+ +          +    +  L+T++    ++ 
Sbjct: 2363 KDIATVTMKNSLTKGGVELSKVDDVDGTTLEGAVFKIVDMNGTVIRKDLVTNQQGKISVS 2422

Query: 169  RLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGG 221
             L   +YQ        +  ++       +   +   +++          +    V ++ G
Sbjct: 2423 DLRPGDYQFIETTAPKHYDLNKEPIPFTITKSQADPISVTATNSLTKGAVELSKVDDVDG 2482

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             A+ D  + I   +G+ +      +         L  GDY  I      +Y  +     F
Sbjct: 2483 TALKDAIFKITDMNGNDIRTELTTDVHGKISVSDLRPGDYQFIETKAPEHYKLDSTPIKF 2542

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++   +   ++V    
Sbjct: 2543 TIKKSQKEKLQVTATN 2558



 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 51/310 (16%), Positives = 101/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1595 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1653

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1654 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1713

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1714 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNSKGRLVVDDLRPGNYKL 1773

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1774 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1833

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++  A+G  +      +         L+ GDY  I      +Y  +     F++      
Sbjct: 1834 TLQDATGKEIMKDLTTDDHGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKASKE 1893

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1894 DLPIPVTVKN 1903



 Score =  116 bits (291), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 47/319 (14%), Positives = 93/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I K   + +     V    +T    LT   +   +   G 
Sbjct: 1867 FIETKAPEHYKLDKTPIKFTIKKASKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1926

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1927 EFIIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 1986

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1987 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2046

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2047 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKNGSVELTKIDDI 2106

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +A+  +++L A G+ V                L  G Y  +      +Y  +   
Sbjct: 2107 DMNTKLANAVFNLLDADGELVKEGLKTNDEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2166

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + V    
Sbjct: 2167 IVFTIKKSQTETLHVTATN 2185



 Score =  112 bits (280), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 42/298 (14%), Positives = 84/298 (28%), Gaps = 28/298 (9%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            T            GK  +    +        +  +  +   +++ D+   +         
Sbjct: 2076 TIERSQTKEINVTGKNALKNGSVELTKIDDIDMNTKLANAVFNLLDAD-GELVKEGLKTN 2134

Query: 77   IIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G  V  +L PG Y    +     +         T+   +     V   NA   G    
Sbjct: 2135 DEGKIVVENLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHVTATNALTKGAVKL 2194

Query: 130  SIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            S        V  +  F I +         L+T++     +  L   +YQ        + +
Sbjct: 2195 SKVDDVDGTVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYV 2254

Query: 188  VSTV---VKVEPGK----IIDVTIQNRAAKIT-FKLVSEMGGEAVADTAWSILTASGDTV 239
            +        +E G+     +  T   +   I   K+        +AD  +++L   G  +
Sbjct: 2255 LDETPIKFTIEKGQKKAISLTATNSLQQGSIELLKVDDLNTQTKLADAVFNLLDQDGKVL 2314

Query: 240  -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
                   S        L  G Y  +      +Y  +     F++   +  I  V M+ 
Sbjct: 2315 KTDLKTNSEGKIVIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKN 2372



 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/312 (10%), Positives = 82/312 (26%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1121 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1179

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1180 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1239

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1240 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNDKGQITVDNLKPGTYYLK 1299

Query: 179  SHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +        +E  +   +                 V +  G  +    +S+
Sbjct: 1300 EIKAPEHYQLDDRLIEFTIEEDQTTVINKTAQNSLIRGSAILTKVDKE-GNTLEGAVFSV 1358

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
               +   +               +  L  G+Y  +      +Y  +     F++   +  
Sbjct: 1359 RDQNNKRIPGYTKLTTNGNGQIEAKNLLPGEYQFVEEKAPEHYEIDKKPLKFTIEKSQQK 1418

Query: 280  IVEVLMRQKRMD 291
             + V      + 
Sbjct: 1419 ALTVTATNHLIK 1430



 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 44/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+       L   I K + K +                ++ +   +   G  +
Sbjct: 1392 FVEEKAPEHYEIDKKPLKFTIEKSQQKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1451

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1452 KIVDANDEKQVIRENIKTGSDGKVTIKDLEPGVYKFIETEAPKDYTLSTNPIEFTIDKSQ 1511

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1512 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPYTNLTTDKHGKV 1571

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1572 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1631

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1632 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1691

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1692 KPIKFTITESQTTQATVTAKN 1712


>gi|56965328|ref|YP_177060.1| collagen adhesion protein [Bacillus clausii KSM-K16]
 gi|56911572|dbj|BAD66099.1| collagen adhesion protein [Bacillus clausii KSM-K16]
          Length = 475

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/316 (13%), Positives = 87/316 (27%), Gaps = 35/316 (11%)

Query: 6   SSYAKAENMHTTSTLLNNNISKGKG-------KRVVDAQRITCEARLTENSTSIDSGVSW 58
                 E+    +T +   I KG+        +  +            +N     +G  +
Sbjct: 53  VETKAPEHYQLDATPIVFTIEKGQTVTPVITVENTLIPGAAALIKVDQDNGDIRLAGAEF 112

Query: 59  HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK-----ITVSSKEK 113
            +                  G     DL PG Y    +   +   +      +TV   + 
Sbjct: 113 ML-TDADGNVVAEQLVTDENGLVAVSDLVPGTYYFVETKAPLHYERDAEPVAVTVEKGQT 171

Query: 114 NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKAL--LITDKVRSGTLV 168
               V   N    G + L  +       +     F +           L+TD+     + 
Sbjct: 172 EAAVVKKSNTLIPGAVVLEKVDSSDHSTLLAGAEFRLEDEQGTVIQEKLVTDETGRIIVT 231

Query: 169 RLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTI----QNRAAKITFKLVSEMGG 221
            L   NYQ           ++       +E  +   V +          +    V    G
Sbjct: 232 DLKPGNYQFVETKAPNGYDLNEEGLAFTIERSQEAAVVVKAENTLTPGSVEIVKVDSSDG 291

Query: 222 EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
             +    +++LT  GD V      + + +     L+ G Y ++      +Y        F
Sbjct: 292 ARLEGAVFTVLTEDGDMVAEGLTTDESGSVQLDGLAPGTYQLVETKAPAHYQLNETPIAF 351

Query: 272 SVLTGKSTIVEVLMRQ 287
            +  G++  + + +  
Sbjct: 352 EISKGQTERLVLTVEN 367



 Score =  119 bits (297), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 34/275 (12%), Positives = 69/275 (25%), Gaps = 29/275 (10%)

Query: 41  CEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH- 99
            E     +   + +G  + +    +      +      G     +L PGDY +  +    
Sbjct: 1   MEKVDAADQQLLLAGAVFSLL-DEAGNVLEENLMTDQHGRLEINNLPPGDYQLVETKAPE 59

Query: 100 ----VGVVKKITVSSKEKNQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN 152
                      T+   +     + + N    G   L  + +    I      F +     
Sbjct: 60  HYQLDATPIVFTIEKGQTVTPVITVENTLIPGAAALIKVDQDNGDIRLAGAEFMLTDADG 119

Query: 153 HKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTI--- 204
           +     L+TD+     +  L    Y         +         V VE G+     +   
Sbjct: 120 NVVAEQLVTDENGLVAVSDLVPGTYYFVETKAPLHYERDAEPVAVTVEKGQTEAAVVKKS 179

Query: 205 -QNRAAKITFKLVS-EMGGEAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYT 257
                  +  + V        +A   + +    G       V +         L  G+Y 
Sbjct: 180 NTLIPGAVVLEKVDSSDHSTLLAGAEFRLEDEQGTVIQEKLVTDETGRIIVTDLKPGNYQ 239

Query: 258 VIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
            +       Y        F++   +   V V    
Sbjct: 240 FVETKAPNGYDLNEEGLAFTIERSQEAAVVVKAEN 274



 Score = 85.0 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 29/229 (12%), Positives = 65/229 (28%), Gaps = 20/229 (8%)

Query: 2   TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVD-------AQRITCEARLTENSTSIDS 54
           T  F       +    +  +   + KG+ +  V           +  E   + + +++ +
Sbjct: 143 TYYFVETKAPLHYERDAEPVAVTVEKGQTEAAVVKKSNTLIPGAVVLEKVDSSDHSTLLA 202

Query: 55  GVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK-----ITVS 109
           G  + + +                G  +  DL PG+Y    +    G          T+ 
Sbjct: 203 GAEFRL-EDEQGTVIQEKLVTDETGRIIVTDLKPGNYQFVETKAPNGYDLNEEGLAFTIE 261

Query: 110 SKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSG 165
             ++    V   N    G               +   F++ +         L TD+  S 
Sbjct: 262 RSQEAAVVVKAENTLTPGSVEIVKVDSSDGARLEGAVFTVLTEDGDMVAEGLTTDESGSV 321

Query: 166 TLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQNRAAKI 211
            L  L    YQ+       +  ++      ++  G+   + +      I
Sbjct: 322 QLDGLAPGTYQLVETKAPAHYQLNETPIAFEISKGQTERLVLTVENTLI 370


>gi|229072824|ref|ZP_04206023.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus F65185]
 gi|228710315|gb|EEL62290.1| Lpxtg-motif cell wall anchor domain protein [Bacillus cereus F65185]
          Length = 2858

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 42/326 (12%), Positives = 97/326 (29%), Gaps = 34/326 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSGVSW 58
            F      ++       +   I K +   +      +        +++ +   +      +
Sbjct: 2437 FIETTAPKHYDLNKEPIPFTIIKSQADPISVTATNSLTKGTVELSKVDDVDGTALKDAIF 2496

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGH-----VGVVKKITVSSKEK 113
             I   ++        T  + G     DL PGDY    +             K T+   +K
Sbjct: 2497 KI-TDMNGNDIRTELTTDVHGKISVSDLRPGDYQFIETKAPEHYKLDSTPIKFTIKKSQK 2555

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGTLV 168
             + QV   N+   G + L  +          +  F+I        +  L TDK    ++ 
Sbjct: 2556 EKLQVTATNSLTEGAVELIKVDDINPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKISVS 2615

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVT--IQNRAAKITFKLVSEMGG 221
             L   +YQ                +   +     ++  VT         I    V     
Sbjct: 2616 DLRPGDYQFIETKAPTGYDLNVKPIPFTITKGQSQVTSVTALNSLTTGSIELTKVDIDHH 2675

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              +    ++IL   G  +      +         L  G+Y ++     + Y  +     F
Sbjct: 2676 GTLEGAIFNILDQDGKVIREGLKTDQHGKVIVNDLKPGNYQLVETKAPKGYQLDASPINF 2735

Query: 272  SVLTGKSTIVEVLMRQKRMDKNGQHN 297
            ++   ++  +++ +  K+++ +   +
Sbjct: 2736 TIDKAQAKPLQITVSNKKIESSSGGD 2761



 Score =  128 bits (320), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 41/310 (13%), Positives = 85/310 (27%), Gaps = 31/310 (10%)

Query: 9    AKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKK 68
               + +  T T      +    K  +    I        +      G  + I +  +N+ 
Sbjct: 1695 KNTKPIKFTITESQTTQATVTAKNSLTKGGIELTKVNAADEKETLEGAVFKIVNRDTNED 1754

Query: 69   NTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN- 122
                      G  V  DL PG+Y +  +             + T+   ++    +   N 
Sbjct: 1755 VRTDLVTNNKGMLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNS 1814

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQIT 178
               G ++L       S        F++      +    L TD      +  L   +YQ  
Sbjct: 1815 LTKGKVKLIKEDDVESSKALAGAVFTLQDPTGKEIMKDLTTDDHGVLVIPDLAPGDYQFI 1874

Query: 179  SHYGKYNAIVSTV---VKVEPGK------IIDVTIQNRAAKITFKLVSEMGGEAVADTAW 229
                  +  +        ++ G        + V        +T   V ++ G  +    +
Sbjct: 1875 ETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGAEF 1934

Query: 230  SILTASGDT-------VGESANASPSMVLSEGDYTVIARNKERNYSR-----EFSVLTGK 277
             I+ A             +      +  L  GDY  I     ++Y+       F++   +
Sbjct: 1935 IIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEKSQ 1994

Query: 278  STIVEVLMRQ 287
               + V    
Sbjct: 1995 KENITVTATN 2004



 Score =  123 bits (308), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 44/316 (13%), Positives = 95/316 (30%), Gaps = 34/316 (10%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      ++   +   +   I K + + +      + +       ++ +   ++  G  +
Sbjct: 1970 FIEVKAPKDYTLSKDPIPFTIEKSQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIF 2029

Query: 59   HIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEK 113
             I   ++ K+   +      G     DL PGDY    +     +         T+   + 
Sbjct: 2030 KIV-DMNGKEVHTNLVTDKNGKISVSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQT 2088

Query: 114  NQKQVFILNA---GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLV 168
             +  V   NA   G + L  I             F++           L T+      + 
Sbjct: 2089 KEINVTGKNALKKGSVELTKIDDIDINTKLSNAVFNLLDADGELVEEGLKTNAEGKIVVE 2148

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQN--RAAKITFKLVSEMGG 221
             L    YQ        +       +   +K    + + +T  N      +    V ++ G
Sbjct: 2149 NLRPGTYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHITATNALTKGAVKLSKVDDIDG 2208

Query: 222  EAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----F 271
              + D  + I+  +GD V                L  GDY  I     ++Y  +     F
Sbjct: 2209 TVLKDAVFKIVNMNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKF 2268

Query: 272  SVLTGKSTIVEVLMRQ 287
            ++  G+  ++ +    
Sbjct: 2269 TIEKGQKKVISLTATN 2284



 Score =  119 bits (298), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 51/310 (16%), Positives = 101/310 (32%), Gaps = 31/310 (10%)

Query: 10   KAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKN 69
            +AE +  T           K +  +    +        + T+   G  + I D+   KK 
Sbjct: 1601 RAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDDIDGTA-LEGAVFKIVDANDEKKV 1659

Query: 70   -TLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSSKEKNQKQVFILN- 122
               +      G  ++  L PGDY          +       K T++  +  Q  V   N 
Sbjct: 1660 IRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNTKPIKFTITESQTTQATVTAKNS 1719

Query: 123  --AGGIRLYSIYKPGSPIVDDELTFSIYS---NPNHKALLITDKVRSGTLVRLGTNNYQI 177
               GGI L  +         +   F I +   N + +  L+T+      +  L   NY++
Sbjct: 1720 LTKGGIELTKVNAADEKETLEGAVFKIVNRDTNEDVRTDLVTNNKGMLVVDDLRPGNYKL 1779

Query: 178  TSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLV---SEMGGEAVADTAW 229
                           +   ++    K++ +T +N   K   KL+        +A+A   +
Sbjct: 1780 IETKAPTYYDVNVEPIEFTIEKGQQKLLPLTFKNSLTKGKVKLIKEDDVESSKALAGAVF 1839

Query: 230  SILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
            ++   +G  +      +         L+ GDY  I      +Y  +     F++  G   
Sbjct: 1840 TLQDPTGKEIMKDLTTDDHGVLVIPDLAPGDYQFIETKAPEHYKLDKTPIKFTIKKGSKE 1899

Query: 280  IVEVLMRQKR 289
             + + +  K 
Sbjct: 1900 DLPIPVTVKN 1909



 Score =  118 bits (296), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 46/319 (14%), Positives = 95/319 (29%), Gaps = 36/319 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-----VDAQRITCEARLT---ENSTSIDSGV 56
            F      E+     T +   I KG  + +     V    +T    LT   +   +   G 
Sbjct: 1873 FIETKAPEHYKLDKTPIKFTIKKGSKEDLPIPVTVKNSLLTGGVTLTKVDDVDGTTLEGA 1932

Query: 57   SWHIFDS-ISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSS 110
             + I D+  + K      T    G   + DL PGDY                    T+  
Sbjct: 1933 EFIIVDAHDTKKVIRKGLTTDKNGKITASDLRPGDYQFIEVKAPKDYTLSKDPIPFTIEK 1992

Query: 111  KEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPN--HKALLITDKVRSGT 166
             +K    V   N    G    +        + +   F I           L+TDK    +
Sbjct: 1993 SQKENITVTATNSLKKGAVTLTKIDDIDRTMLEGAIFKIVDMNGKEVHTNLVTDKNGKIS 2052

Query: 167  LVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE- 218
            +  L   +YQ        + ++        +E  +  ++ +      +   +    + + 
Sbjct: 2053 VSDLRPGDYQFIETKAPEHYVLDETTIPFTIERSQTKEINVTGKNALKKGSVELTKIDDI 2112

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
                 +++  +++L A G+ V       +        L  G Y  +      +Y  +   
Sbjct: 2113 DINTKLSNAVFNLLDADGELVEEGLKTNAEGKIVVENLRPGTYQFVETIAPEHYDLDKKP 2172

Query: 271  --FSVLTGKSTIVEVLMRQ 287
              F++   ++  + +    
Sbjct: 2173 IVFTIKKSQTETLHITATN 2191



 Score =  118 bits (294), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 44/319 (13%), Positives = 91/319 (28%), Gaps = 34/319 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K + + +               +++ +   ++   
Sbjct: 2154 TYQFVETIAPEHYDLDKKPIVFTIKKSQTETLHITATNALTKGAVKLSKVDDIDGTVLKD 2213

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITVSS 110
              + I + ++             G     DL PGDY    +     +       K T+  
Sbjct: 2214 AVFKIVN-MNGDVVHKDLVTNEQGIIEINDLRPGDYQFIETKAPKHYVLDETPIKFTIEK 2272

Query: 111  KEKNQKQ---VFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNH--KALLITDKVRSG 165
             +K          L  G I L  +    +     +  F++        K  L T+     
Sbjct: 2273 GQKKVISLTATNSLKQGSIELLKVDDLNTQTKLADAVFNLLDQDGKVLKTDLKTNSEGKI 2332

Query: 166  TLVRLGTNNYQITSHYGKYNAIVS-----TVVKVEPGKIIDVTIQN--RAAKITFKLVSE 218
             +  L    YQ        +  +        ++     I  VT++N      +    V +
Sbjct: 2333 VIENLRPGTYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDD 2392

Query: 219  MGGEAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNYSR---- 269
            + G  +    + I+  +G       V           L  GDY  I     ++Y      
Sbjct: 2393 VDGTTLEGAVFKIVDMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYDLNKEP 2452

Query: 270  -EFSVLTGKSTIVEVLMRQ 287
              F+++  ++  + V    
Sbjct: 2453 IPFTIIKSQADPISVTATN 2471



 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 46/317 (14%), Positives = 93/317 (29%), Gaps = 34/317 (10%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCE------ARLTENSTSIDSG 55
            T  F      E+       +   I K +        + +        +++ +   +   G
Sbjct: 2341 TYQFVEITAPEHYDLDKKPIIFTIEKSQKDIATVTMKNSLTKGGVELSKVDDVDGTTLEG 2400

Query: 56   VSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISAS-----FGHVGVVKKITV-- 108
              + I   ++             G     DL PGDY    +     +         T+  
Sbjct: 2401 AVFKIV-DMNGTVIRKDLVTNQQGKISVSDLRPGDYQFIETTAPKHYDLNKEPIPFTIIK 2459

Query: 109  -SSKEKNQKQVFILNAGGIRLYSIYK-PGSPIVDDELTFSIYSNPNHKALLITDKVRSGT 166
              +   +      L  G + L  +    G+ + D     +  +  + +  L TD     +
Sbjct: 2460 SQADPISVTATNSLTKGTVELSKVDDVDGTALKDAIFKITDMNGNDIRTELTTDVHGKIS 2519

Query: 167  LVRLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMG- 220
            +  L   +YQ        +       +   +K    + + VT  N   +   +L+     
Sbjct: 2520 VSDLRPGDYQFIETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELIKVDDI 2579

Query: 221  --GEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSR---- 269
                 ++D  ++I+ A G  V      +         L  GDY  I       Y      
Sbjct: 2580 NPDTKLSDAVFNIIDAKGKIVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNVKP 2639

Query: 270  -EFSVLTGKSTIVEVLM 285
              F++  G+S +  V  
Sbjct: 2640 IPFTITKGQSQVTSVTA 2656



 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/312 (10%), Positives = 82/312 (26%), Gaps = 34/312 (10%)

Query: 12   ENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTL 71
                T +  +  +   G G        +       +N  ++ +G  + ++   + K    
Sbjct: 1127 NTETTETIEVRMSSGSGGGSATKGRGNLEIIKVDNDNKNALLAGAEFTLY-DRTGKTVIR 1185

Query: 72   STTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK--------ITVSSKEKNQKQVFILN- 122
              T    G     +L    YL+  +    G V          + + ++E    ++     
Sbjct: 1186 KITTDKDGIAKFNNLKRDKYLLKETKAPEGYVISWDLKQGKIVELGTQETTTYKLANKKF 1245

Query: 123  AGGIRLYSIYKPGSPIVDDELTFSIYSNP----NHKALLITDKVRSGTLVRLGTNNYQIT 178
             G + L         +      F++        +    L T+     T+  L    Y + 
Sbjct: 1246 VGKVVLTKSDDLNKNVTLQGAVFTLLDKDKKIISEHEKLTTNDKGQITVDNLKPGTYYLK 1305

Query: 179  SHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSEMGGEAVADTAWSI 231
                  +  +        +E  +   +                 V +  G  +    +S+
Sbjct: 1306 EIKAPEHYQLDDRLIEFTIEEDQTTVINKTAQNSLIRGSAILTKVDKE-GNTLEGAVFSV 1364

Query: 232  LTASGDTV-------GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKST 279
               +   +               +  L  G+Y  +      +Y  +     F++   +  
Sbjct: 1365 RDQNNKRIPGYTKLTTNGNGQIEAKNLLPGEYQFVEEKAPEHYEIDKKPLKFTIEKSQQK 1424

Query: 280  IVEVLMRQKRMD 291
             + V      + 
Sbjct: 1425 ALTVTATNHLIK 1436



 Score =  110 bits (274), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 44/321 (13%), Positives = 96/321 (29%), Gaps = 38/321 (11%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEA------RLTENSTSIDSGVSW 58
            F      E+       L   I K + K +                ++ +   +   G  +
Sbjct: 1398 FVEEKAPEHYEIDKKPLKFTIEKSQQKALTVTATNHLIKGGVTLTKVDDVDGTALEGAVF 1457

Query: 59   HIFDSISNKKN-TLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVV-----KKITVSSKE 112
             I D+   K+    +      G     DL PG Y    +             + T+   +
Sbjct: 1458 KIVDANDEKQVIRENIKTGSDGKVTIKDLEPGVYKFIETEAPKDYTLSTNPIEFTIDKSQ 1517

Query: 113  KNQKQVFILN---AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH----KALLITDKVRSG 165
            +    V   N    G + L  + + G     +   F +    N+       L TDK    
Sbjct: 1518 QALATVTANNSLKTGEVELLKVDEFGEKKPLEGAVFKLVDTNNNDVSPYTNLTTDKHGKV 1577

Query: 166  TLVRLGTNNYQITSHYGKYNAIVST---VVKVEPGKIIDVTIQ----NRAAKITFKLVSE 218
             +  L    Y+        + ++        ++  +   + ++     +   +    V +
Sbjct: 1578 KVSNLRPGTYKFIEIAAPEHYVLRAEPIEFTIDRSQKETLLVKAENALKPGDVELTKVDD 1637

Query: 219  MGGEAVADTAWSILTASG-------DTVGESANASPSMVLSEGDYTVIARNKERNYSRE- 270
            + G A+    + I+ A+        +    +   + +  L  GDY  I     + Y +  
Sbjct: 1638 IDGTALEGAVFKIVDANDEKKVIRENVKTGADGKAIATGLRPGDYKFIEVTAPKYYDKNT 1697

Query: 271  ----FSVLTGKSTIVEVLMRQ 287
                F++   ++T   V  + 
Sbjct: 1698 KPIKFTITESQTTQATVTAKN 1718



 Score = 77.3 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 36/240 (15%), Positives = 67/240 (27%), Gaps = 22/240 (9%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRV-------VDAQRITCEARLTENSTSIDSGVS 57
            F      E+    ST +   I K + +++       +    +        N  +  S   
Sbjct: 2530 FIETKAPEHYKLDSTPIKFTIKKSQKEKLQVTATNSLTEGAVELIKVDDINPDTKLSDAV 2589

Query: 58   WHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKE 112
            ++I      K      T    G     DL PGDY    +    G          T++  +
Sbjct: 2590 FNII-DAKGKIVRTDLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNVKPIPFTITKGQ 2648

Query: 113  KNQKQVFILN---AGGIRLYSIY-KPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLV 168
                 V  LN    G I L  +       +               +  L TD+     + 
Sbjct: 2649 SQVTSVTALNSLTTGSIELTKVDIDHHGTLEGAIFNILDQDGKVIREGLKTDQHGKVIVN 2708

Query: 169  RLGTNNYQITSHYGKYNA-----IVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEA 223
             L   NYQ+               ++  +     K + +T+ N+  + +     +     
Sbjct: 2709 DLKPGNYQLVETKAPKGYQLDASPINFTIDKAQAKPLQITVSNKKIESSSGGDDKPVTPP 2768


>gi|30265060|ref|NP_847437.1| cell wall surface anchor family protein [Bacillus anthracis str.
           Ames]
 gi|47778380|ref|YP_021914.2| cell wall surface anchor family protein [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49187873|ref|YP_031126.1| cell wall surface anchor family protein [Bacillus anthracis str.
           Sterne]
 gi|165870868|ref|ZP_02215520.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0488]
 gi|167639906|ref|ZP_02398174.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0193]
 gi|170707027|ref|ZP_02897484.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0389]
 gi|254687351|ref|ZP_05151208.1| cell wall surface anchor family protein [Bacillus anthracis str.
           CNEVA-9066]
 gi|254735312|ref|ZP_05193020.1| cell wall surface anchor family protein [Bacillus anthracis str.
           Western North America USA6153]
 gi|254740578|ref|ZP_05198269.1| cell wall surface anchor family protein [Bacillus anthracis str.
           Kruger B]
 gi|254753160|ref|ZP_05205196.1| cell wall surface anchor family protein [Bacillus anthracis str.
           Vollum]
 gi|254761503|ref|ZP_05213524.1| cell wall surface anchor family protein [Bacillus anthracis str.
           Australia 94]
 gi|30259737|gb|AAP28923.1| cell wall surface anchor family protein [Bacillus anthracis str.
           Ames]
 gi|47552085|gb|AAT34389.2| cell wall surface anchor family protein [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49181800|gb|AAT57176.1| cell wall surface anchor family protein [Bacillus anthracis str.
           Sterne]
 gi|164713377|gb|EDR18902.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0488]
 gi|167511987|gb|EDR87365.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0193]
 gi|170128130|gb|EDS97000.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A0389]
          Length = 627

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 45/310 (14%), Positives = 96/310 (30%), Gaps = 27/310 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           ++  +E +  T+ LL  N  K     VV+ + + + +         +  G  + +    S
Sbjct: 253 AFKGSEKVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKEVLKGAVFEV----S 308

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
           N+    + T    G     +L  G Y +       G      VKKI V + E    ++  
Sbjct: 309 NENFKQNVTTSDKGIAELGNLPIGIYSVKEIQAPAGYVLDRSVKKIEVKTGETAVLELKN 368

Query: 121 LNAGG-IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITS 179
            N  G + +  +             F+IY+    + +      +     +L    Y    
Sbjct: 369 ENVKGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTDEKGVAKFKLPYGKYTYKE 428

Query: 180 HYGKYNAIVS-TVVKVEPGKIID-----VTIQNRAAKITFKLVS-EMGGEAVADTAWSIL 232
                  +++      E  +  +     V  +    ++    V    G   + +  ++I 
Sbjct: 429 TIAPNGYVINEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 488

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKSTI-VEVL 284
              G  V               L  G YT         Y     +F     ++   ++ +
Sbjct: 489 NEQGKEVVKGKTNEQG-IAKFKLPYGKYTYKETIAPNGYVINEEKFGFEIKENGEIIKHI 547

Query: 285 MRQKRMDKNG 294
           ++ K+ +K  
Sbjct: 548 VKNKKEEKAS 557


>gi|16804217|ref|NP_465702.1| peptidoglycan binding protein [Listeria monocytogenes EGD-e]
 gi|224501023|ref|ZP_03669330.1| peptidoglycan binding protein [Listeria monocytogenes FSL R2-561]
 gi|16411648|emb|CAD00256.1| putative peptidoglycan bound protein (LPXTG motif) [Listeria
            monocytogenes EGD-e]
          Length = 1612

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 39/302 (12%), Positives = 88/302 (29%), Gaps = 28/302 (9%)

Query: 13   NMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLS 72
               + +T ++   + G G        +       ++++   +G  + ++    +K     
Sbjct: 988  TYKSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKKLTGAKFQLYTLEGDKAGQ-E 1046

Query: 73   TTKKIIGGKVSFDLFPGDYLISASFGHVGVV--------KKITVSSKEKNQKQVFILNAG 124
             T    G  V   L  G Y +  +    G          K+ITV++       +      
Sbjct: 1047 ATTDSDGKIVMDGLQSGKYKLVETEAPTGYTISDEYKDGKEITVTADIATSVTIENTEQT 1106

Query: 125  GIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYG 182
            G  +       +        F + +    K    L+++      +  L   +YQ      
Sbjct: 1107 GSVVLLKEDSATKDAIAGAEFELQNADGTKVADNLVSNADGKIEVTDLAPGDYQFVETKA 1166

Query: 183  KYNAIVS---TVVKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTAS 235
                ++    T   VE  +   V +          +       +    ++   + +  A+
Sbjct: 1167 PTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVLTKEDSVSKATLSGAEFELQNAT 1226

Query: 236  GDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLM 285
            G  V       +        L+ GDY  +       Y  +     F++   ++T V V  
Sbjct: 1227 GTKVKDNLTTNADGKLEVTDLAPGDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTK 1286

Query: 286  RQ 287
              
Sbjct: 1287 EN 1288



 Score =  112 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 41/297 (13%), Positives = 81/297 (27%), Gaps = 37/297 (12%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            TS  + N    G    + +             +    +G  + + ++    K   +    
Sbjct: 1096 TSVTIENTEQTGSVVLLKEDSA----------TKDAIAGAEFELQNAD-GTKVADNLVSN 1144

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G     DL PGDY    +    G        K TV   ++    V   N    G  + 
Sbjct: 1145 ADGKIEVTDLAPGDYQFVETKAPTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVL 1204

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            +     S        F + +    K    L T+      +  L   +Y+           
Sbjct: 1205 TKEDSVSKATLSGAEFELQNATGTKVKDNLTTNADGKLEVTDLAPGDYKFVETKAPTGYE 1264

Query: 188  VSTV---VKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTASG---- 236
            +        +E  +   V +          +    +       +A   + + T  G    
Sbjct: 1265 LDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQTKLGVSLK 1324

Query: 237  -DTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
               V E+        L+ GDY ++       Y  +     F++   +   ++V    
Sbjct: 1325 DKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPIQVTKTN 1381



 Score =  105 bits (261), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 76/284 (26%), Gaps = 27/284 (9%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              +       +         S +  SG  + + ++    K   + T    G     DL P
Sbjct: 1192 TKENTAKTGSVVLTKED-SVSKATLSGAEFELQNAT-GTKVKDNLTTNADGKLEVTDLAP 1249

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDD 141
            GDY    +    G          T+   +     V   N    G  + +     S     
Sbjct: 1250 GDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLA 1309

Query: 142  ELTFSIYSNPNHKAL--LITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKV 194
               F + +         ++T+      +  L   +YQ+               V   ++ 
Sbjct: 1310 GAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEF 1369

Query: 195  EPGKIIDVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASGDTV----GESANASPS 248
                 I VT  N      +            +A+  + ++    +       +++     
Sbjct: 1370 NQKAPIQVTKTNTMSTGSVVLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEI 1429

Query: 249  MVLSEGDYTVIARNKERNYS-----REFSVLTGKSTIVEVLMRQ 287
              L+ GDY +I       Y       +  +   +   ++V    
Sbjct: 1430 TNLAPGDYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTN 1473



 Score = 71.9 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/230 (16%), Positives = 72/230 (31%), Gaps = 14/230 (6%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
            T + + Y       T +   N   +    K  V         +L   S S  +G  + + 
Sbjct: 1257 TKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQ 1316

Query: 62   DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQK 116
                          +  G     +L PGDY +  +    G        + T+   +K   
Sbjct: 1317 T-KLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPI 1375

Query: 117  QVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYS-NPNHKALLITDKVRSGTLVRLGTN 173
            QV   N    G  + +     +  +    TF +   + N    L TD      +  L   
Sbjct: 1376 QVTKTNTMSTGSVVLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEITNLAPG 1435

Query: 174  NYQITSHYGKYNAIVST-----VVKVEPGKIIDVTIQNRAAKITFKLVSE 218
            +YQ+          + T      +  +  + + VT  N    ++ K+++E
Sbjct: 1436 DYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTNLKTVVSGKVIAE 1485


>gi|254826933|ref|ZP_05231620.1| peptidoglycan binding protein [Listeria monocytogenes FSL N3-165]
 gi|258599313|gb|EEW12638.1| peptidoglycan binding protein [Listeria monocytogenes FSL N3-165]
          Length = 1612

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/302 (12%), Positives = 88/302 (29%), Gaps = 28/302 (9%)

Query: 13   NMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLS 72
               + +T ++   + G G        +       ++++   +G  + ++    +K     
Sbjct: 988  TYKSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKKLTGAKFQLYTLEGDKAGQ-E 1046

Query: 73   TTKKIIGGKVSFDLFPGDYLISASFGHVGVV--------KKITVSSKEKNQKQVFILNAG 124
             T    G  V   L  G Y +  +    G          K+ITV++       +      
Sbjct: 1047 ATTDSDGKIVMDGLQSGKYKLVETEAPTGYTISDEYKDGKEITVTADIATSVTIENTEQT 1106

Query: 125  GIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYG 182
            G  +       +        F + +    K    L+++      +  L   +YQ      
Sbjct: 1107 GSVVLLKEDSATKDAIAGAEFELQNADGTKVADNLVSNADGKIEVTDLAPGDYQFVETKA 1166

Query: 183  KYNAIVS---TVVKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTAS 235
                ++    T   VE  +   V +          +       +    ++   + +  A+
Sbjct: 1167 PTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVLTKEDSVSKATLSGAEFELQNAT 1226

Query: 236  GDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLM 285
            G  V       +        L+ GDY  +       Y  +     F++   ++T V V  
Sbjct: 1227 GTKVQANLTTNADGKLEVTDLAPGDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTK 1286

Query: 286  RQ 287
              
Sbjct: 1287 EN 1288



 Score =  111 bits (278), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 41/297 (13%), Positives = 81/297 (27%), Gaps = 37/297 (12%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            TS  + N    G    + +             +    +G  + + ++    K   +    
Sbjct: 1096 TSVTIENTEQTGSVVLLKEDSA----------TKDAIAGAEFELQNAD-GTKVADNLVSN 1144

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G     DL PGDY    +    G        K TV   ++    V   N    G  + 
Sbjct: 1145 ADGKIEVTDLAPGDYQFVETKAPTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVL 1204

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            +     S        F + +    K    L T+      +  L   +Y+           
Sbjct: 1205 TKEDSVSKATLSGAEFELQNATGTKVQANLTTNADGKLEVTDLAPGDYKFVETKAPTGYE 1264

Query: 188  VSTV---VKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTASG---- 236
            +        +E  +   V +          +    +       +A   + + T  G    
Sbjct: 1265 LDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQTKLGVSLK 1324

Query: 237  -DTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
               V E+        L+ GDY ++       Y  +     F++   +   ++V    
Sbjct: 1325 DKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPIQVTKTN 1381



 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 76/284 (26%), Gaps = 27/284 (9%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              +       +         S +  SG  + + ++    K   + T    G     DL P
Sbjct: 1192 TKENTAKTGSVVLTKED-SVSKATLSGAEFELQNAT-GTKVQANLTTNADGKLEVTDLAP 1249

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDD 141
            GDY    +    G          T+   +     V   N    G  + +     S     
Sbjct: 1250 GDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLA 1309

Query: 142  ELTFSIYSNPNHKAL--LITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKV 194
               F + +         ++T+      +  L   +YQ+               V   ++ 
Sbjct: 1310 GAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEF 1369

Query: 195  EPGKIIDVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASGDTV----GESANASPS 248
                 I VT  N      +            +A+  + ++    +       +++     
Sbjct: 1370 NQKAPIQVTKTNTMSTGSVVLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEI 1429

Query: 249  MVLSEGDYTVIARNKERNYS-----REFSVLTGKSTIVEVLMRQ 287
              L+ GDY +I       Y       +  +   +   ++V    
Sbjct: 1430 TNLAPGDYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTN 1473



 Score = 71.9 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/230 (16%), Positives = 72/230 (31%), Gaps = 14/230 (6%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
            T + + Y       T +   N   +    K  V         +L   S S  +G  + + 
Sbjct: 1257 TKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQ 1316

Query: 62   DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQK 116
                          +  G     +L PGDY +  +    G        + T+   +K   
Sbjct: 1317 T-KLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPI 1375

Query: 117  QVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYS-NPNHKALLITDKVRSGTLVRLGTN 173
            QV   N    G  + +     +  +    TF +   + N    L TD      +  L   
Sbjct: 1376 QVTKTNTMSTGSVVLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEITNLAPG 1435

Query: 174  NYQITSHYGKYNAIVST-----VVKVEPGKIIDVTIQNRAAKITFKLVSE 218
            +YQ+          + T      +  +  + + VT  N    ++ K+++E
Sbjct: 1436 DYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTNLKTVVSGKVIAE 1485


>gi|254831385|ref|ZP_05236040.1| peptidoglycan binding protein [Listeria monocytogenes 10403S]
          Length = 1612

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/302 (12%), Positives = 88/302 (29%), Gaps = 28/302 (9%)

Query: 13   NMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLS 72
               + +T ++   + G G        +       ++++   +G  + ++    +K     
Sbjct: 988  TYKSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKKLTGAKFQLYTLEGDKAGQ-E 1046

Query: 73   TTKKIIGGKVSFDLFPGDYLISASFGHVGVV--------KKITVSSKEKNQKQVFILNAG 124
             T    G  V   L  G Y +  +    G          K+ITV++       +      
Sbjct: 1047 ATTDSDGKIVMDGLQSGKYKLVETEAPTGYTISDEYKDGKEITVTADIATNVTIENTEQT 1106

Query: 125  GIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYG 182
            G  +       +        F + +    K    L+++      +  L   +YQ      
Sbjct: 1107 GSVVLLKEDSATKDAIAGAEFELQNADGTKVADNLVSNADGKIEVTDLAPGDYQFVETKA 1166

Query: 183  KYNAIVS---TVVKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTAS 235
                ++    T   VE  +   V +          +       +    ++   + +  A+
Sbjct: 1167 PTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVLTKEDSVSKATLSGAEFELQNAT 1226

Query: 236  GDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLM 285
            G  V       +        L+ GDY  +       Y  +     F++   ++T V V  
Sbjct: 1227 GTKVKDNLTTNADGKLEVTDLAPGDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTK 1286

Query: 286  RQ 287
              
Sbjct: 1287 EN 1288



 Score =  111 bits (277), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/313 (12%), Positives = 86/313 (27%), Gaps = 28/313 (8%)

Query: 2    TISFSSYAKAENMHT-TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHI 60
            T + + Y  ++         +  +I+        +        +    +    +G  + +
Sbjct: 1070 TEAPTGYTISDEYKDGKEITVTADIATNVTIENTEQTGSVVLLKEDSATKDAIAGAEFEL 1129

Query: 61   FDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQ 115
             ++    K   +      G     DL PGDY    +    G        K TV   ++  
Sbjct: 1130 QNAD-GTKVADNLVSNADGKIEVTDLAPGDYQFVETKAPTGYVLDGAPTKFTVEFNQEAA 1188

Query: 116  KQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLG 171
              V   N    G  + +     S        F + +    K    L T+      +  L 
Sbjct: 1189 VIVTKENTAKTGSVVLTKEDSVSKATLSGAEFELQNATGTKVKDNLTTNADGKLEVTDLA 1248

Query: 172  TNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAV 224
              +Y+           +        +E  +   V +          +    +       +
Sbjct: 1249 PGDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNL 1308

Query: 225  ADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVL 274
            A   + + T  G       V E+        L+ GDY ++       Y  +     F++ 
Sbjct: 1309 AGAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIE 1368

Query: 275  TGKSTIVEVLMRQ 287
              +   ++V    
Sbjct: 1369 FNQKAPIQVTKTN 1381



 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 76/284 (26%), Gaps = 27/284 (9%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              +       +         S +  SG  + + ++    K   + T    G     DL P
Sbjct: 1192 TKENTAKTGSVVLTKED-SVSKATLSGAEFELQNAT-GTKVKDNLTTNADGKLEVTDLAP 1249

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDD 141
            GDY    +    G          T+   +     V   N    G  + +     S     
Sbjct: 1250 GDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLA 1309

Query: 142  ELTFSIYSNPNHKAL--LITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKV 194
               F + +         ++T+      +  L   +YQ+               V   ++ 
Sbjct: 1310 GAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEF 1369

Query: 195  EPGKIIDVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASGDTV----GESANASPS 248
                 I VT  N      +            +A+  + ++    +       +++     
Sbjct: 1370 NQKAPIQVTKTNTMSTGSVLLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEI 1429

Query: 249  MVLSEGDYTVIARNKERNYS-----REFSVLTGKSTIVEVLMRQ 287
              L+ GDY +I       Y       +  +   +   ++V    
Sbjct: 1430 TNLAPGDYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTN 1473



 Score = 71.9 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 39/230 (16%), Positives = 72/230 (31%), Gaps = 14/230 (6%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
            T + + Y       T +   N   +    K  V         +L   S S  +G  + + 
Sbjct: 1257 TKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQ 1316

Query: 62   DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQK 116
                          +  G     +L PGDY +  +    G        + T+   +K   
Sbjct: 1317 T-KLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPI 1375

Query: 117  QVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYS-NPNHKALLITDKVRSGTLVRLGTN 173
            QV   N    G  L +     +  +    TF +   + N    L TD      +  L   
Sbjct: 1376 QVTKTNTMSTGSVLLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEITNLAPG 1435

Query: 174  NYQITSHYGKYNAIVST-----VVKVEPGKIIDVTIQNRAAKITFKLVSE 218
            +YQ+          + T      +  +  + + VT  N    ++ K+++E
Sbjct: 1436 DYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTNLKTVVSGKVIAE 1485


>gi|290893126|ref|ZP_06556114.1| peptidoglycan binding protein [Listeria monocytogenes FSL J2-071]
 gi|290557288|gb|EFD90814.1| peptidoglycan binding protein [Listeria monocytogenes FSL J2-071]
          Length = 1624

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 37/302 (12%), Positives = 88/302 (29%), Gaps = 28/302 (9%)

Query: 13   NMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLS 72
               + +T ++   + G G        +       ++++   +G  + ++    +K     
Sbjct: 998  TYKSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKKLTGAKFQLYTLEGDKAGQ-E 1056

Query: 73   TTKKIIGGKVSFDLFPGDYLISASFGHVGVV--------KKITVSSKEKNQKQVFILNAG 124
             T    G  V   L  G Y +  +    G          K+ITV++       +      
Sbjct: 1057 ATTDSDGKIVMDGLQSGKYKLVETEAPTGYTISDEYKDGKEITVTADAVTNVTIENTEQT 1116

Query: 125  GIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYG 182
            G  + +     S        F + +    K    L T+      +  L   +Y+      
Sbjct: 1117 GSVVLTKEDSVSKATLSGAEFELQNAAGTKVQANLTTNADGKLEVSDLAPGDYKFVETKA 1176

Query: 183  KYNAIVST---VVKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTAS 235
                 +        +E  +  +V +          +       +    ++   + +  A+
Sbjct: 1177 PTGYELDATPVTFTIEFNQATEVNVTKENVAKTGSVVLTKEDSVSKATLSGAEFELQNAA 1236

Query: 236  GDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLM 285
            G +V       +        L+ G+Y  +       Y  +     F++   ++T V V  
Sbjct: 1237 GTSVQANLTTNADGKLEVSDLAPGNYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTK 1296

Query: 286  RQ 287
              
Sbjct: 1297 DN 1298



 Score = 70.7 bits (171), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 36/230 (15%), Positives = 68/230 (29%), Gaps = 14/230 (6%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
            T + + Y       T +   N   +    K  V         +L   S S  +G  + + 
Sbjct: 1267 TKAPTGYELDATPVTFTIEFNQATAVNVTKDNVAKTGSVVLTKLDSKSRSNLAGAEFELQ 1326

Query: 62   DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKIT-------VSSKEKN 114
                          +  G     DL PGDY +  +    G     T        + +   
Sbjct: 1327 T-KLGVSLKDKVVTEANGQLQIDDLAPGDYQLVETKAPTGYELDATPEEFTIAFNQQAPI 1385

Query: 115  QKQVFILNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA-LLITDKVRSGTLVRLGTN 173
            Q       + G  + +     +       TF +    N+    L TD      +  L   
Sbjct: 1386 QVTKTNTMSTGSVVLTKTDAETKTPLANATFKLVDEDNNVTENLTTDASGKLEITDLVPG 1445

Query: 174  NYQITSHYGKYNAIVST-----VVKVEPGKIIDVTIQNRAAKITFKLVSE 218
            +YQ+          + T      +  +  + + VT  N    ++ K+++E
Sbjct: 1446 DYQLIETKAPAGYELDTVPVDVKIAFDQKETLQVTKTNLKTVVSGKVIAE 1495


>gi|254899121|ref|ZP_05259045.1| peptidoglycan binding protein [Listeria monocytogenes J0161]
 gi|254912738|ref|ZP_05262750.1| conserved hypothetical protein [Listeria monocytogenes J2818]
 gi|254937065|ref|ZP_05268762.1| peptidoglycan binding protein [Listeria monocytogenes F6900]
 gi|258609668|gb|EEW22276.1| peptidoglycan binding protein [Listeria monocytogenes F6900]
 gi|293590733|gb|EFF99067.1| conserved hypothetical protein [Listeria monocytogenes J2818]
          Length = 1612

 Score =  133 bits (333), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 39/302 (12%), Positives = 88/302 (29%), Gaps = 28/302 (9%)

Query: 13   NMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLS 72
               + +T ++   + G G        +       ++++   +G  + ++    +K     
Sbjct: 988  TYKSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKKLTGAKFQLYTLEGDKAGQ-E 1046

Query: 73   TTKKIIGGKVSFDLFPGDYLISASFGHVGVV--------KKITVSSKEKNQKQVFILNAG 124
             T    G  V   L  G Y +  +    G          K+ITV++       +      
Sbjct: 1047 ATTDSDGKIVMDGLQSGKYKLVETEAPTGYTISDEYKDGKEITVTADIATSVTIENTEQT 1106

Query: 125  GIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYG 182
            G  +       +        F + +    K    L+++      +  L   +YQ      
Sbjct: 1107 GSVVLLKEDSATKDAIAGAEFELQNADGTKVADNLVSNADGKIEVTDLAPGDYQFVETKA 1166

Query: 183  KYNAIVS---TVVKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTAS 235
                ++    T   VE  +   V +          +       +    ++   + +  A+
Sbjct: 1167 PTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVLTKEDSVSKATLSGAEFELQNAT 1226

Query: 236  GDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLM 285
            G  V       +        L+ GDY  +       Y  +     F++   ++T V V  
Sbjct: 1227 GTKVKDNLTTNADGKLEVTDLAPGDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTK 1286

Query: 286  RQ 287
              
Sbjct: 1287 EN 1288



 Score =  111 bits (278), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 41/297 (13%), Positives = 81/297 (27%), Gaps = 37/297 (12%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            TS  + N    G    + +             +    +G  + + ++    K   +    
Sbjct: 1096 TSVTIENTEQTGSVVLLKEDSA----------TKDAIAGAEFELQNAD-GTKVADNLVSN 1144

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G     DL PGDY    +    G        K TV   ++    V   N    G  + 
Sbjct: 1145 ADGKIEVTDLAPGDYQFVETKAPTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVL 1204

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            +     S        F + +    K    L T+      +  L   +Y+           
Sbjct: 1205 TKEDSVSKATLSGAEFELQNATGTKVKDNLTTNADGKLEVTDLAPGDYKFVETKAPTGYE 1264

Query: 188  VSTV---VKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTASG---- 236
            +        +E  +   V +          +    +       +A   + + T  G    
Sbjct: 1265 LDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQTKLGVSLK 1324

Query: 237  -DTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
               V E+        L+ GDY ++       Y  +     F++   +   ++V    
Sbjct: 1325 DKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPIQVTKTN 1381



 Score =  105 bits (261), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 76/284 (26%), Gaps = 27/284 (9%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              +       +         S +  SG  + + ++    K   + T    G     DL P
Sbjct: 1192 TKENTAKTGSVVLTKED-SVSKATLSGAEFELQNAT-GTKVKDNLTTNADGKLEVTDLAP 1249

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDD 141
            GDY    +    G          T+   +     V   N    G  + +     S     
Sbjct: 1250 GDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLA 1309

Query: 142  ELTFSIYSNPNHKAL--LITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKV 194
               F + +         ++T+      +  L   +YQ+               V   ++ 
Sbjct: 1310 GAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEF 1369

Query: 195  EPGKIIDVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASGDTV----GESANASPS 248
                 I VT  N      +            +A+  + ++    +       +++     
Sbjct: 1370 NQKAPIQVTKTNTMSTGSVVLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEI 1429

Query: 249  MVLSEGDYTVIARNKERNYS-----REFSVLTGKSTIVEVLMRQ 287
              L+ GDY +I       Y       +  +   +   ++V    
Sbjct: 1430 TNLAPGDYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTN 1473



 Score = 71.5 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/230 (16%), Positives = 72/230 (31%), Gaps = 14/230 (6%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
            T + + Y       T +   N   +    K  V         +L   S S  +G  + + 
Sbjct: 1257 TKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQ 1316

Query: 62   DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQK 116
                          +  G     +L PGDY +  +    G        + T+   +K   
Sbjct: 1317 T-KLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPI 1375

Query: 117  QVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYS-NPNHKALLITDKVRSGTLVRLGTN 173
            QV   N    G  + +     +  +    TF +   + N    L TD      +  L   
Sbjct: 1376 QVTKTNTMSTGSVVLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEITNLAPG 1435

Query: 174  NYQITSHYGKYNAIVST-----VVKVEPGKIIDVTIQNRAAKITFKLVSE 218
            +YQ+          + T      +  +  + + VT  N    ++ K+++E
Sbjct: 1436 DYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTNLKTVVSGKVIAE 1485


>gi|284802625|ref|YP_003414490.1| peptidoglycan binding protein [Listeria monocytogenes 08-5578]
 gi|284995767|ref|YP_003417535.1| peptidoglycan binding protein [Listeria monocytogenes 08-5923]
 gi|284058187|gb|ADB69128.1| peptidoglycan binding protein [Listeria monocytogenes 08-5578]
 gi|284061234|gb|ADB72173.1| peptidoglycan binding protein [Listeria monocytogenes 08-5923]
          Length = 1612

 Score =  132 bits (332), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 38/302 (12%), Positives = 87/302 (28%), Gaps = 28/302 (9%)

Query: 13   NMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLS 72
               + +T ++   + G G        +       ++++   +G  + ++    +K     
Sbjct: 988  TYKSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKKLTGAKFQLYTLEGDKAGQ-E 1046

Query: 73   TTKKIIGGKVSFDLFPGDYLISASFGHVGVV--------KKITVSSKEKNQKQVFILNAG 124
             T    G  V   L  G Y +  +    G          K+ITV++       +      
Sbjct: 1047 ATTDSDGKIVMDGLQSGKYKLVETEAPTGYTISDEYKDGKEITVTADIATSVTIENTEQT 1106

Query: 125  GIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYG 182
            G  +       +        F + +    K    L+++      +  L   +YQ      
Sbjct: 1107 GSVVLLKEDSATKDAIAGAEFELQNADGTKVADNLVSNADGKIEVTDLAPGDYQFVETKA 1166

Query: 183  KYNAIVS---TVVKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTAS 235
                ++    T   VE  +   V +          +       +    ++   + +   +
Sbjct: 1167 PTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVLTKEDSVSKATLSGAEFELQNTT 1226

Query: 236  GDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLM 285
            G  V       +        L+ GDY  +       Y  +     F++   ++T V V  
Sbjct: 1227 GTKVKDNLTTNADGKLEVTDLAPGDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTK 1286

Query: 286  RQ 287
              
Sbjct: 1287 EN 1288



 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/297 (13%), Positives = 81/297 (27%), Gaps = 37/297 (12%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            TS  + N    G    + +             +    +G  + + ++    K   +    
Sbjct: 1096 TSVTIENTEQTGSVVLLKEDSA----------TKDAIAGAEFELQNAD-GTKVADNLVSN 1144

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G     DL PGDY    +    G        K TV   ++    V   N    G  + 
Sbjct: 1145 ADGKIEVTDLAPGDYQFVETKAPTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVL 1204

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            +     S        F + +    K    L T+      +  L   +Y+           
Sbjct: 1205 TKEDSVSKATLSGAEFELQNTTGTKVKDNLTTNADGKLEVTDLAPGDYKFVETKAPTGYE 1264

Query: 188  VSTV---VKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTASG---- 236
            +        +E  +   V +          +    +       +A   + + T  G    
Sbjct: 1265 LDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQTKLGVSLK 1324

Query: 237  -DTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
               V E+        L+ GDY ++       Y  +     F++   +   ++V    
Sbjct: 1325 DKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPIQVTKTN 1381



 Score =  105 bits (262), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 76/284 (26%), Gaps = 27/284 (9%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              +       +         S +  SG  + + +  +  K   + T    G     DL P
Sbjct: 1192 TKENTAKTGSVVLTKED-SVSKATLSGAEFELQN-TTGTKVKDNLTTNADGKLEVTDLAP 1249

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDD 141
            GDY    +    G          T+   +     V   N    G  + +     S     
Sbjct: 1250 GDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLA 1309

Query: 142  ELTFSIYSNPNHKAL--LITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKV 194
               F + +         ++T+      +  L   +YQ+               V   ++ 
Sbjct: 1310 GAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEF 1369

Query: 195  EPGKIIDVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASGDTV----GESANASPS 248
                 I VT  N      +            +A+  + ++    +       +++     
Sbjct: 1370 NQKAPIQVTKTNTMSTGSVVLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEI 1429

Query: 249  MVLSEGDYTVIARNKERNYS-----REFSVLTGKSTIVEVLMRQ 287
              L+ GDY +I       Y       +  +   +   ++V    
Sbjct: 1430 TNLAPGDYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTN 1473



 Score = 71.5 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/230 (16%), Positives = 72/230 (31%), Gaps = 14/230 (6%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
            T + + Y       T +   N   +    K  V         +L   S S  +G  + + 
Sbjct: 1257 TKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQ 1316

Query: 62   DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQK 116
                          +  G     +L PGDY +  +    G        + T+   +K   
Sbjct: 1317 T-KLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPI 1375

Query: 117  QVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYS-NPNHKALLITDKVRSGTLVRLGTN 173
            QV   N    G  + +     +  +    TF +   + N    L TD      +  L   
Sbjct: 1376 QVTKTNTMSTGSVVLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEITNLAPG 1435

Query: 174  NYQITSHYGKYNAIVST-----VVKVEPGKIIDVTIQNRAAKITFKLVSE 218
            +YQ+          + T      +  +  + + VT  N    ++ K+++E
Sbjct: 1436 DYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTNLKTVVSGKVIAE 1485


>gi|229187261|ref|ZP_04314406.1| Cell wall surface anchor [Bacillus cereus BGSC 6E1]
 gi|228596271|gb|EEK53946.1| Cell wall surface anchor [Bacillus cereus BGSC 6E1]
          Length = 723

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 47/307 (15%), Positives = 100/307 (32%), Gaps = 27/307 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           ++  +E +  T+ LL  N  K     VV+ + + + +         I  G  + +    S
Sbjct: 258 AFKGSEKVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKEILKGAVFEV----S 313

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
           N+    + T    G     +L  G Y +       G      VKKI V + E    ++  
Sbjct: 314 NENFKQNVTTSDKGIAELGNLPIGIYSVKEIQAPAGYVLDRSVKKIEVKTGETAVLELKN 373

Query: 121 LNAGG-IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITS 179
            N  G + +  +             F+IY+    + +      +     +L    Y    
Sbjct: 374 ENVKGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTDEKGVAKFKLPYGKYTYKE 433

Query: 180 HYGKYNAIVS-TVVKVEPGKIID-----VTIQNRAAKITFKLVS-EMGGEAVADTAWSIL 232
                  +++      E  +  +     V  +    ++    V    G   + +  ++I 
Sbjct: 434 TIAPNGYVINEETFAFEIKENGEILKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 493

Query: 233 TASGDTV----GESANASPSMVLSEGDY---TVIARNKERNYSREFSVLTGKS-TIVEVL 284
              G  V     +    +    L  G Y     IA N        F+    ++  I++ +
Sbjct: 494 NEQGKEVVKGKTDEKGVAKFK-LPYGKYKYKETIAPNGYVINEETFAFEIKENGQIIKRI 552

Query: 285 MRQKRMD 291
           ++ K+++
Sbjct: 553 VQDKKVE 559



 Score =  103 bits (255), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/281 (10%), Positives = 74/281 (26%), Gaps = 26/281 (9%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +        +  +      + I++    +           G    F L  G Y    
Sbjct: 377 KGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGK--TDEKG-VAKFKLPYGKYTYKE 433

Query: 96  SFGHVGVVKK-----ITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIY 148
           +    G V         +    +  K +       G + +  +             F+IY
Sbjct: 434 TIAPNGYVINEETFAFEIKENGEILKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 493

Query: 149 SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIID---V 202
           +    + +      +     +L    Y+          +++      +++    I    V
Sbjct: 494 NEQGKEVVKGKTDEKGVAKFKLPYGKYKYKETIAPNGYVINEETFAFEIKENGQIIKRIV 553

Query: 203 TIQNRAAKITFKLVSEMGGE-AVADTAWSILTASGDTV----GESANASPSMVLSEGDYT 257
             +    ++    V    G   + +  ++I    G  V               L  G YT
Sbjct: 554 QDKKVEGELEITKVDIADGNMKLPNAEFTIYNEQGKEVVKGKTNEQG-IAKFKLPYGKYT 612

Query: 258 VIARNKERNY---SREFSVLTGKSTIV-EVLMRQKRMDKNG 294
                    Y      F+    ++  + + +++ K+ +K  
Sbjct: 613 YKETIAPNGYVVNEETFAFEIKENGEILKHIVKNKKEEKAS 653



 Score = 42.2 bits (97), Expect = 0.086,   Method: Composition-based stats.
 Identities = 19/144 (13%), Positives = 34/144 (23%), Gaps = 6/144 (4%)

Query: 2   TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
           TI+ + Y   E         N  I K   +       +        +         + I+
Sbjct: 525 TIAPNGYVINEETFAFEIKENGQIIKRIVQDKKVEGELEITKVDIADGNMKLPNAEFTIY 584

Query: 62  DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK---KITVSSKEKNQKQV 118
           +    +            G   F L  G Y    +    G V          KE  +   
Sbjct: 585 NEQGKEVVKGK---TNEQGIAKFKLPYGKYTYKETIAPNGYVVNEETFAFEIKENGEILK 641

Query: 119 FILNAGGIRLYSIYKPGSPIVDDE 142
            I+        S+    +    + 
Sbjct: 642 HIVKNKKEEKASLPSKPNKPTPNG 665


>gi|224498926|ref|ZP_03667275.1| peptidoglycan binding protein [Listeria monocytogenes Finland 1988]
          Length = 1609

 Score =  132 bits (332), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 39/302 (12%), Positives = 88/302 (29%), Gaps = 28/302 (9%)

Query: 13   NMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLS 72
               + +T ++   + G G        +       ++++   +G  + ++    +K     
Sbjct: 988  TYKSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKKLTGAKFQLYTLEGDKAGQ-E 1046

Query: 73   TTKKIIGGKVSFDLFPGDYLISASFGHVGVV--------KKITVSSKEKNQKQVFILNAG 124
             T    G  V   L  G Y +  +    G          K+ITV++       +      
Sbjct: 1047 ATTDSDGKIVMDGLQSGKYKLVETEAPTGYTISDEYKDGKEITVTADIATNVTIENTEQT 1106

Query: 125  GIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYG 182
            G  +       +        F + +    K    L+++      +  L   +YQ      
Sbjct: 1107 GSVVLLKEDSATKDAIAGAEFELQNADGTKVADNLVSNADGKIEVTDLAPGDYQFVETKA 1166

Query: 183  KYNAIVS---TVVKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTAS 235
                ++    T   VE  +   V +          +       +    ++   + +  A+
Sbjct: 1167 PTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVLTKEDSVSKATLSGAEFELQNAT 1226

Query: 236  GDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLM 285
            G  V       +        L+ GDY  +       Y  +     F++   ++T V V  
Sbjct: 1227 GTKVKDNLTTNADGKLEVTDLAPGDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTK 1286

Query: 286  RQ 287
              
Sbjct: 1287 EN 1288



 Score =  111 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/313 (12%), Positives = 86/313 (27%), Gaps = 28/313 (8%)

Query: 2    TISFSSYAKAENMHT-TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHI 60
            T + + Y  ++         +  +I+        +        +    +    +G  + +
Sbjct: 1070 TEAPTGYTISDEYKDGKEITVTADIATNVTIENTEQTGSVVLLKEDSATKDAIAGAEFEL 1129

Query: 61   FDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQ 115
             ++    K   +      G     DL PGDY    +    G        K TV   ++  
Sbjct: 1130 QNAD-GTKVADNLVSNADGKIEVTDLAPGDYQFVETKAPTGYVLDGAPTKFTVEFNQEAA 1188

Query: 116  KQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLG 171
              V   N    G  + +     S        F + +    K    L T+      +  L 
Sbjct: 1189 VIVTKENTAKTGSVVLTKEDSVSKATLSGAEFELQNATGTKVKDNLTTNADGKLEVTDLA 1248

Query: 172  TNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAV 224
              +Y+           +        +E  +   V +          +    +       +
Sbjct: 1249 PGDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNL 1308

Query: 225  ADTAWSILTASG-----DTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVL 274
            A   + + T  G       V E+        L+ GDY ++       Y  +     F++ 
Sbjct: 1309 AGAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIE 1368

Query: 275  TGKSTIVEVLMRQ 287
              +   ++V    
Sbjct: 1369 FNQKAPIQVTKTN 1381



 Score =  104 bits (259), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 76/284 (26%), Gaps = 27/284 (9%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              +       +         S +  SG  + + ++    K   + T    G     DL P
Sbjct: 1192 TKENTAKTGSVVLTKED-SVSKATLSGAEFELQNAT-GTKVKDNLTTNADGKLEVTDLAP 1249

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDD 141
            GDY    +    G          T+   +     V   N    G  + +     S     
Sbjct: 1250 GDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLA 1309

Query: 142  ELTFSIYSNPNHKAL--LITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKV 194
               F + +         ++T+      +  L   +YQ+               V   ++ 
Sbjct: 1310 GAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEF 1369

Query: 195  EPGKIIDVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASGDTV----GESANASPS 248
                 I VT  N      +            +A+  + ++    +       +++     
Sbjct: 1370 NQKAPIQVTKTNTMSTGSVVLTKTDGKTKALLANATFKLVDEDNNVTENLTTDASGKLEI 1429

Query: 249  MVLSEGDYTVIARNKERNYS-----REFSVLTGKSTIVEVLMRQ 287
              L+ GDY +I       Y       +  +   +   ++V    
Sbjct: 1430 TNLAPGDYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTN 1473



 Score = 71.5 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/230 (16%), Positives = 72/230 (31%), Gaps = 14/230 (6%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
            T + + Y       T +   N   +    K  V         +L   S S  +G  + + 
Sbjct: 1257 TKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQ 1316

Query: 62   DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQK 116
                          +  G     +L PGDY +  +    G        + T+   +K   
Sbjct: 1317 T-KLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPI 1375

Query: 117  QVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA-LLITDKVRSGTLVRLGTN 173
            QV   N    G  + +     +  +    TF +    N+    L TD      +  L   
Sbjct: 1376 QVTKTNTMSTGSVVLTKTDGKTKALLANATFKLVDEDNNVTENLTTDASGKLEITNLAPG 1435

Query: 174  NYQITSHYGKYNAIVST-----VVKVEPGKIIDVTIQNRAAKITFKLVSE 218
            +YQ+          + T      +  +  + + VT  N    ++ K+++E
Sbjct: 1436 DYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTNLKTVVSGKVIAE 1485


>gi|255025097|ref|ZP_05297083.1| peptidoglycan binding protein [Listeria monocytogenes FSL J2-003]
          Length = 1612

 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 39/302 (12%), Positives = 88/302 (29%), Gaps = 28/302 (9%)

Query: 13   NMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLS 72
               + +T ++   + G G        +       ++++   +G  + ++    +K     
Sbjct: 988  TYKSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKKLTGAKFQLYTLEGDKAGQ-E 1046

Query: 73   TTKKIIGGKVSFDLFPGDYLISASFGHVGVV--------KKITVSSKEKNQKQVFILNAG 124
             T    G  V   L  G Y +  +    G          K+ITV++       +      
Sbjct: 1047 ATTDSDGKIVMDGLQSGKYKLVETEAPTGYTISDEYKDGKEITVTADIATSVTIENTEQT 1106

Query: 125  GIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYG 182
            G  +       +        F + +    K    L+++      +  L   +YQ      
Sbjct: 1107 GSVVLLKEDSATKDAIAGAEFELQNADGTKVADNLVSNADGKIEVTDLAPGDYQFVETKA 1166

Query: 183  KYNAIVS---TVVKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTAS 235
                ++    T   VE  +   V +          +       +    ++   + +  A+
Sbjct: 1167 PTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVLTKEDSVSKATLSGAEFELQNAT 1226

Query: 236  GDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLM 285
            G  V       +        L+ GDY  +       Y  +     F++   ++T V V  
Sbjct: 1227 GTKVKDNLTTSADGKLEVTDLAPGDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTK 1286

Query: 286  RQ 287
              
Sbjct: 1287 EN 1288



 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/297 (13%), Positives = 80/297 (26%), Gaps = 37/297 (12%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            TS  + N    G    + +             +    +G  + + ++    K   +    
Sbjct: 1096 TSVTIENTEQTGSVVLLKEDSA----------TKDAIAGAEFELQNAD-GTKVADNLVSN 1144

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G     DL PGDY    +    G        K TV   ++    V   N    G  + 
Sbjct: 1145 ADGKIEVTDLAPGDYQFVETKAPTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVL 1204

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            +     S        F + +    K    L T       +  L   +Y+           
Sbjct: 1205 TKEDSVSKATLSGAEFELQNATGTKVKDNLTTSADGKLEVTDLAPGDYKFVETKAPTGYE 1264

Query: 188  VSTV---VKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTASG---- 236
            +        +E  +   V +          +    +       +A   + + T  G    
Sbjct: 1265 LDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQTKLGVSLK 1324

Query: 237  -DTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
               V E+        L+ GDY ++       Y  +     F++   +   ++V    
Sbjct: 1325 DKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPIQVTKTN 1381



 Score =  105 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 76/284 (26%), Gaps = 27/284 (9%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              +       +         S +  SG  + + ++    K   + T    G     DL P
Sbjct: 1192 TKENTAKTGSVVLTKED-SVSKATLSGAEFELQNAT-GTKVKDNLTTSADGKLEVTDLAP 1249

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDD 141
            GDY    +    G          T+   +     V   N    G  + +     S     
Sbjct: 1250 GDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLA 1309

Query: 142  ELTFSIYSNPNHKAL--LITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKV 194
               F + +         ++T+      +  L   +YQ+               V   ++ 
Sbjct: 1310 GAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEF 1369

Query: 195  EPGKIIDVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASGDTV----GESANASPS 248
                 I VT  N      +            +A+  + ++    +       +++     
Sbjct: 1370 NQKAPIQVTKTNTMSTGSVVLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEI 1429

Query: 249  MVLSEGDYTVIARNKERNYS-----REFSVLTGKSTIVEVLMRQ 287
              L+ GDY +I       Y       +  +   +   ++V    
Sbjct: 1430 TNLAPGDYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTN 1473



 Score = 71.5 bits (173), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 38/230 (16%), Positives = 72/230 (31%), Gaps = 14/230 (6%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
            T + + Y       T +   N   +    K  V         +L   S S  +G  + + 
Sbjct: 1257 TKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQ 1316

Query: 62   DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQK 116
                          +  G     +L PGDY +  +    G        + T+   +K   
Sbjct: 1317 T-KLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPI 1375

Query: 117  QVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYS-NPNHKALLITDKVRSGTLVRLGTN 173
            QV   N    G  + +     +  +    TF +   + N    L TD      +  L   
Sbjct: 1376 QVTKTNTMSTGSVVLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEITNLAPG 1435

Query: 174  NYQITSHYGKYNAIVST-----VVKVEPGKIIDVTIQNRAAKITFKLVSE 218
            +YQ+          + T      +  +  + + VT  N    ++ K+++E
Sbjct: 1436 DYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTNLKTVVSGKVIAE 1485


>gi|324328951|gb|ADY24211.1| cell wall surface anchor family protein [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 718

 Score =  132 bits (332), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 46/307 (14%), Positives = 98/307 (31%), Gaps = 27/307 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           ++  +E +  T+ LL  N  K     VV+ + + + +         +  G  + +    S
Sbjct: 253 AFKGSEKVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKELLKGAVFEV----S 308

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
           N+    + T    G     +L  G Y +       G      VKKI V + E    ++  
Sbjct: 309 NENFKQNVTTNDKGIAELGNLPIGIYSVKEIQAPAGYVLDGSVKKIEVKTGETAVLELKN 368

Query: 121 LNAGG-IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITS 179
            N  G + +  +             F+IY+    + +      +     +L    Y    
Sbjct: 369 ENVKGELEITKVDIADENTKLPNAEFTIYNEQGKEVVKGKTDEKGIAKFKLSYGKYTYKE 428

Query: 180 HYGKYNAIVS-TVVKVEPGKIID-----VTIQNRAAKITFKLVSE-MGGEAVADTAWSIL 232
                  ++S      E  +  +     V  +    ++    V    G   + +  ++I 
Sbjct: 429 TIAPNGYVISEETFAFEIKEDGEIIKHIVQDKKVEGELEITKVDIADGNTKLPNAEFTIY 488

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKS-TIVEVL 284
              G  V     +         L  G YT         Y      F+    ++  I++ +
Sbjct: 489 NEQGKEVVKGKTDEKG-IAKFKLPYGKYTYKETIAPNGYVINEETFAFEIKENGQIIKHI 547

Query: 285 MRQKRMD 291
           ++ K+++
Sbjct: 548 VQDKKVE 554



 Score =  102 bits (253), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 30/281 (10%), Positives = 71/281 (25%), Gaps = 26/281 (9%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +        +  +      + I++    +           G    F L  G Y    
Sbjct: 372 KGELEITKVDIADENTKLPNAEFTIYNEQGKEVVKGK--TDEKG-IAKFKLSYGKYTYKE 428

Query: 96  SFGHVGVVKK-----ITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIY 148
           +    G V         +    +  K +       G + +  +             F+IY
Sbjct: 429 TIAPNGYVISEETFAFEIKEDGEIIKHIVQDKKVEGELEITKVDIADGNTKLPNAEFTIY 488

Query: 149 SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIID---V 202
           +    + +      +     +L    Y           +++      +++    I    V
Sbjct: 489 NEQGKEVVKGKTDEKGIAKFKLPYGKYTYKETIAPNGYVINEETFAFEIKENGQIIKHIV 548

Query: 203 TIQNRAAKITFKLVSE-MGGEAVADTAWSILTASGDTV----GESANASPSMVLSEGDYT 257
             +    ++    V    G   + +  ++I    G  V               L  G YT
Sbjct: 549 QDKKVEGELEITKVDIADGNTKLPNAEFTIYNEQGKEVVKGKTNEQG-IAKFKLPYGKYT 607

Query: 258 VIARNKERNY---SREFSVLTGKSTI-VEVLMRQKRMDKNG 294
                    Y      F     +    ++ +++ K+ +K  
Sbjct: 608 YKETIAPNGYVINEETFGFEIKEDGEIIKHIVKNKKEEKPS 648



 Score = 43.0 bits (99), Expect = 0.046,   Method: Composition-based stats.
 Identities = 20/179 (11%), Positives = 40/179 (22%), Gaps = 13/179 (7%)

Query: 2   TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
           TI+ + Y   E         N  I K   +       +        +  +      + I+
Sbjct: 520 TIAPNGYVINEETFAFEIKENGQIIKHIVQDKKVEGELEITKVDIADGNTKLPNAEFTIY 579

Query: 62  DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKK-----ITVSSKEKNQK 116
           +    +            G   F L  G Y    +    G V         +    +  K
Sbjct: 580 NEQGKEVVKGK---TNEQGIAKFKLPYGKYTYKETIAPNGYVINEETFGFEIKEDGEIIK 636

Query: 117 QVFILNAGG-----IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRL 170
            +             +       G      ++      N +++  L            L
Sbjct: 637 HIVKNKKEEKPSLPSKPNKPTSNGEVKPSADVKQVQQHNTHNEVRLPATGGVGNEFTVL 695


>gi|196032702|ref|ZP_03100115.1| cell wall surface anchor family protein [Bacillus cereus W]
 gi|195994131|gb|EDX58086.1| cell wall surface anchor family protein [Bacillus cereus W]
          Length = 723

 Score =  132 bits (331), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 46/307 (14%), Positives = 98/307 (31%), Gaps = 27/307 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           ++  +E +  T+ LL  N  K     VV+ + + + +         +  G  + +    S
Sbjct: 258 AFKGSEKVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKEVLKGAVFEV----S 313

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
           N+    + T    G     +L  G Y +       G      VKKI V + E    ++  
Sbjct: 314 NENFKQNVTTNDKGIAELGNLPIGIYSVKEIQAPAGYVLDGSVKKIEVKTGETAVLELKN 373

Query: 121 LNAGG-IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITS 179
            N  G + +  +             F+IY+    + +      +     +L    Y    
Sbjct: 374 ENVKGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTDEKGVAKFKLPYGKYTYKE 433

Query: 180 HYGKYNAIVS-TVVKVEPGKIID-----VTIQNRAAKITFKLVS-EMGGEAVADTAWSIL 232
                  +++      E  +  +     V  +    ++    V    G   + +  ++I 
Sbjct: 434 TIAPNGYVINEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 493

Query: 233 TASGDTV----GESANASPSMVLSEGDYT---VIARNKERNYSREFSVLTGKSTIV-EVL 284
              G  V               L  G YT    IA N        F+    ++  + + +
Sbjct: 494 NEQGKEVVKGKTNEQG-IAKFKLPYGKYTYKETIAPNGYVVNEETFAFEIKENGEILKHI 552

Query: 285 MRQKRMD 291
           ++ K+++
Sbjct: 553 VQDKKVE 559



 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/281 (11%), Positives = 72/281 (25%), Gaps = 26/281 (9%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +        +  +      + I++    +           G    F L  G Y    
Sbjct: 377 KGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGK--TDEKG-VAKFKLPYGKYTYKE 433

Query: 96  SFGHVGVVKK-----ITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIY 148
           +    G V         +    +  K +       G + +  +             F+IY
Sbjct: 434 TIAPNGYVINEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 493

Query: 149 SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST-VVKVEPGKIID-----V 202
           +    + +      +     +L    Y           +V+      E  +  +     V
Sbjct: 494 NEQGKEVVKGKTNEQGIAKFKLPYGKYTYKETIAPNGYVVNEETFAFEIKENGEILKHIV 553

Query: 203 TIQNRAAKITFKLVS-EMGGEAVADTAWSILTASGDTV----GESANASPSMVLSEGDYT 257
             +    ++    V    G   + +  ++I    G  V               L  G YT
Sbjct: 554 QDKKVEGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTNEQG-IAKFKLPYGKYT 612

Query: 258 VIARNKERNY---SREFSVLTGKSTI-VEVLMRQKRMDKNG 294
                    Y     +F     ++   ++ +++ K+ +K  
Sbjct: 613 YKETIAPNGYVINEEKFGFEIKENGEIIKHIVKNKKEEKAS 653



 Score = 41.1 bits (94), Expect = 0.19,   Method: Composition-based stats.
 Identities = 20/144 (13%), Positives = 35/144 (24%), Gaps = 6/144 (4%)

Query: 2   TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
           TI+ + Y   E         N  I K   +       +        +  +      + I+
Sbjct: 525 TIAPNGYVVNEETFAFEIKENGEILKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 584

Query: 62  DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK---KITVSSKEKNQKQV 118
           +    +            G   F L  G Y    +    G V    K     KE  +   
Sbjct: 585 NEQGKEVVKGK---TNEQGIAKFKLPYGKYTYKETIAPNGYVINEEKFGFEIKENGEIIK 641

Query: 119 FILNAGGIRLYSIYKPGSPIVDDE 142
            I+        S     +    + 
Sbjct: 642 HIVKNKKEEKASFPSKPNKPTPNG 665


>gi|315160858|gb|EFU04875.1| LPXTG-motif protein cell wall anchor domain protein [Enterococcus
           faecalis TX0645]
          Length = 1182

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 44/293 (15%), Positives = 85/293 (29%), Gaps = 28/293 (9%)

Query: 22  NNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGK 81
            N   + +         +       E +     G  + I +S S +    +    + G  
Sbjct: 548 ENEKIQLEKSNTATTGSVELIKTD-EKTKERLQGAVFEIRNS-SGEIVRSALQTNLEGKI 605

Query: 82  VSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILN--AGGIRLYSIYKP 134
           V   L  G+Y    +    G        K  +   +    QV + N    G  + +    
Sbjct: 606 VVDGLKAGEYSFIETKAPTGYVLDNTPIKFMIKKDQTEAVQVSMSNKLTPGGVILNKTDA 665

Query: 135 GSPIVDDELTFSIYSNPNH--KALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVSTV- 191
            +        F + S      ++ L TD      +  L   +YQ           +    
Sbjct: 666 KTGKTLQGAVFELQSKDGKILQSGLKTDASGKLAVEGLEPGDYQFVETKAPTGYDLDQTP 725

Query: 192 --VKVEPGKIIDV----TIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTV-----G 240
               +E G+   V    T +     +         GE +    + +   +G  +      
Sbjct: 726 VKFAIEKGQTEAVQVSMTNKLTPGGVVLSKSDAKTGETLQGAVFELQDKNGKVLQSGLKT 785

Query: 241 ESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQK 288
           +++       L  GDY  I       Y  +     F++  G++  V+V M  K
Sbjct: 786 DASGKLAVEELEPGDYQFIETQAPTGYDLDQTPVKFAIEKGQTEAVQVSMTNK 838



 Score =  125 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 45/320 (14%), Positives = 89/320 (27%), Gaps = 41/320 (12%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENS----------TSIDS 54
            F             T +   I KG+ + V    +++   +LT                  
Sbjct: 710  FVETKAPTGYDLDQTPVKFAIEKGQTEAV----QVSMTNKLTPGGVVLSKSDAKTGETLQ 765

Query: 55   GVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVS 109
            G  + +    + K           G     +L PGDY    +    G        K  + 
Sbjct: 766  GAVFEL-QDKNGKVLQSGLKTDASGKLAVEELEPGDYQFIETQAPTGYDLDQTPVKFAIE 824

Query: 110  SKEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNH--KALLITDKVRSG 165
              +    QV + N    G  + S     +  V     F +        ++ L TD     
Sbjct: 825  KGQTEAVQVSMTNKLTPGGVVLSKTDAKTGEVLQGAVFELKDKNGKVLQSGLKTDISGKL 884

Query: 166  TLVRLGTNNYQITSHYGKYNAIVSTV---VKVEPGKIIDVTIQNRA----AKITFKLVSE 218
             +  L   +YQ           +        +E G+   V +          +    +  
Sbjct: 885  AVEGLEPGDYQFVETQAPTGYDLDQTPVKFAIEKGQTEAVQVSMTNKPTVGSVVLNKIDS 944

Query: 219  MGGEAVADTAWSILTASGDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE--- 270
              G+ +A   + +   + + +      ++        L  G Y ++       Y+ +   
Sbjct: 945  ETGDKLAGAVFELRDNNRNIILEDLKTDNNGKLAINDLKPGTYELVETKAPDGYTLDSTP 1004

Query: 271  --FSVLTGKSTIVEVLMRQK 288
              F + +  ST  +V    K
Sbjct: 1005 VEFIIKSNASTQKKVTKTNK 1024



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/299 (14%), Positives = 79/299 (26%), Gaps = 36/299 (12%)

Query: 5    FSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENS----------TSIDS 54
            F             T +   I KG+ + V    +++   +LT               +  
Sbjct: 803  FIETQAPTGYDLDQTPVKFAIEKGQTEAV----QVSMTNKLTPGGVVLSKTDAKTGEVLQ 858

Query: 55   GVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVS 109
            G  + +    + K         I G      L PGDY    +    G        K  + 
Sbjct: 859  GAVFEL-KDKNGKVLQSGLKTDISGKLAVEGLEPGDYQFVETQAPTGYDLDQTPVKFAIE 917

Query: 110  SKEKNQKQVFILN--AGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSG 165
              +    QV + N    G  + +     +        F +  N  +     L TD     
Sbjct: 918  KGQTEAVQVSMTNKPTVGSVVLNKIDSETGDKLAGAVFELRDNNRNIILEDLKTDNNGKL 977

Query: 166  TLVRLGTNNYQITSHYGKYNAIVSTV-----VKVEPGKIIDVTIQNRA--AKITFKLVSE 218
             +  L    Y++          + +      +K        VT  N+     +  +    
Sbjct: 978  AINDLKPGTYELVETKAPDGYTLDSTPVEFIIKSNASTQKKVTKTNKGKVTSVRLEKRDS 1037

Query: 219  MGGEAVADTAWSILTASGDT-----VGESANASPSMVLSEGDYTVIARNKERNYSREFS 272
               E +    + +L   G       V           L EG Y ++       Y  + +
Sbjct: 1038 RTNEMLVGAKFKLLNFEGKIIKDDLVTNRDGVIIIDELKEGYYQLVEVQAPTGYVLDET 1096



 Score = 78.4 bits (191), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/179 (15%), Positives = 53/179 (29%), Gaps = 19/179 (10%)

Query: 129 YSIYKPGSPIVDDELTFSIYSNPNHKALLI--TDKVRSGTLVRLGTNNYQITSHYGKYNA 186
                  +     +  F + +   ++ +    +D      +  L   NY +T        
Sbjct: 474 LLKVDKDTREPLAKAKFQLINITTNEIIGTFSSDNDGLIIINNLNPGNYSLTEIEAPEGY 533

Query: 187 -----IVSTVVKVEPGKIIDVTIQNRA--AKITFKLVSEMGGEAVADTAWSILTASGDTV 239
                 +S +V     + I +   N A    +      E   E +    + I  +SG+ V
Sbjct: 534 ILDNTPISFIVHGTENEKIQLEKSNTATTGSVELIKTDEKTKERLQGAVFEIRNSSGEIV 593

Query: 240 -----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQK 288
                           L  G+Y+ I       Y  +     F +   ++  V+V M  K
Sbjct: 594 RSALQTNLEGKIVVDGLKAGEYSFIETKAPTGYVLDNTPIKFMIKKDQTEAVQVSMSNK 652


>gi|49478852|ref|YP_039036.1| cell wall surface anchor family protein [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|49330408|gb|AAT61054.1| cell wall surface anchor family protein [Bacillus thuringiensis
           serovar konkukian str. 97-27]
          Length = 718

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 44/307 (14%), Positives = 98/307 (31%), Gaps = 27/307 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           ++  +E +  T+ LL  N  K     VV+ + + + +         +  G  + +    S
Sbjct: 253 AFKGSEKVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKEVLKGAVFEV----S 308

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
           N+    + T    G     +L  G Y +       G      VKKI V + E    ++  
Sbjct: 309 NENFKQNVTTNDKGIAELGNLPIGIYSVKEIQAPAGYVLDGSVKKIEVKTGETAVLELKN 368

Query: 121 LNAGG-IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITS 179
            N  G + +  +             F+IY+    + +      +     +L    Y    
Sbjct: 369 ENVKGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTDEKGVAKFKLPYGKYTYKE 428

Query: 180 HYGKYNAIVS-TVVKVEPGKIID-----VTIQNRAAKITFKLVS-EMGGEAVADTAWSIL 232
                  +++      E  +  +     V  +    ++    V    G   + +  ++I 
Sbjct: 429 TIAPNGYVINEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 488

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKSTI-VEVL 284
              G  V     +    +    L  G YT         Y      F+    ++   ++ +
Sbjct: 489 NEQGKEVVKGKTDEKGVAKFK-LPYGKYTYKETIAPNGYVINEETFAFEIKENGEIIKHI 547

Query: 285 MRQKRMD 291
           ++ K+++
Sbjct: 548 VQDKKVE 554



 Score =  101 bits (250), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/281 (10%), Positives = 72/281 (25%), Gaps = 26/281 (9%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +        +  +      + I++    +            G   F L  G Y    
Sbjct: 372 KGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGK---TDEKGVAKFKLPYGKYTYKE 428

Query: 96  SFGHVGVVKK-----ITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIY 148
           +    G V         +    +  K +       G + +  +             F+IY
Sbjct: 429 TIAPNGYVINEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 488

Query: 149 SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST-VVKVEPGKIID-----V 202
           +    + +      +     +L    Y           +++      E  +  +     V
Sbjct: 489 NEQGKEVVKGKTDEKGVAKFKLPYGKYTYKETIAPNGYVINEETFAFEIKENGEIIKHIV 548

Query: 203 TIQNRAAKITFKLVS-EMGGEAVADTAWSILTASGDTV----GESANASPSMVLSEGDYT 257
             +    ++    V    G   + +  ++I    G  V               L  G YT
Sbjct: 549 QDKKVEGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTNEQG-IAKFKLPYGKYT 607

Query: 258 VIARNKERNY---SREFSVLTGKSTI-VEVLMRQKRMDKNG 294
                    Y     +F     ++   ++ +++ K+ +K  
Sbjct: 608 YKETIAPNGYVINEEKFGFEIKENGEIIKHIVKNKKEEKAS 648



 Score = 41.8 bits (96), Expect = 0.11,   Method: Composition-based stats.
 Identities = 20/144 (13%), Positives = 35/144 (24%), Gaps = 6/144 (4%)

Query: 2   TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
           TI+ + Y   E         N  I K   +       +        +  +      + I+
Sbjct: 520 TIAPNGYVINEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 579

Query: 62  DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVK---KITVSSKEKNQKQV 118
           +    +            G   F L  G Y    +    G V    K     KE  +   
Sbjct: 580 NEQGKEVVKGK---TNEQGIAKFKLPYGKYTYKETIAPNGYVINEEKFGFEIKENGEIIK 636

Query: 119 FILNAGGIRLYSIYKPGSPIVDDE 142
            I+        S     +    + 
Sbjct: 637 HIVKNKKEEKASFPSKPNKPTPNG 660


>gi|47095752|ref|ZP_00233358.1| cell wall surface anchor family protein [Listeria monocytogenes str.
            1/2a F6854]
 gi|47015895|gb|EAL06822.1| cell wall surface anchor family protein [Listeria monocytogenes str.
            1/2a F6854]
          Length = 1599

 Score =  131 bits (330), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 39/302 (12%), Positives = 88/302 (29%), Gaps = 28/302 (9%)

Query: 13   NMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLS 72
               + +T ++   + G G        +       ++++   +G  + ++    +K     
Sbjct: 975  TYKSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKKLTGAKFQLYTLEGDKAGQ-E 1033

Query: 73   TTKKIIGGKVSFDLFPGDYLISASFGHVGVV--------KKITVSSKEKNQKQVFILNAG 124
             T    G  V   L  G Y +  +    G          K+ITV++       +      
Sbjct: 1034 ATTDSDGKIVMDGLQSGKYKLVETEAPTGYTISDEYKDGKEITVTADIATSVTIENTEQT 1093

Query: 125  GIRLYSIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYG 182
            G  +       +        F + +    K    L+++      +  L   +YQ      
Sbjct: 1094 GSVVLLKEDSATKDAIAGAEFELQNADGTKVADNLVSNADGKIEVTDLAPGDYQFVETKA 1153

Query: 183  KYNAIVS---TVVKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTAS 235
                ++    T   VE  +   V +          +       +    ++   + +  A+
Sbjct: 1154 PTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVLTKEDSVSKATLSGAEFELQNAT 1213

Query: 236  GDTV-----GESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLM 285
            G  V       +        L+ GDY  +       Y  +     F++   ++T V V  
Sbjct: 1214 GTKVKDNLTTNADGKLEVTDLAPGDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTK 1273

Query: 286  RQ 287
              
Sbjct: 1274 EN 1275



 Score =  110 bits (275), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/297 (13%), Positives = 81/297 (27%), Gaps = 37/297 (12%)

Query: 17   TSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKK 76
            TS  + N    G    + +             +    +G  + + ++    K   +    
Sbjct: 1083 TSVTIENTEQTGSVVLLKEDSA----------TKDAIAGAEFELQNAD-GTKVADNLVSN 1131

Query: 77   IIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLY 129
              G     DL PGDY    +    G        K TV   ++    V   N    G  + 
Sbjct: 1132 ADGKIEVTDLAPGDYQFVETKAPTGYVLDGAPTKFTVEFNQEAAVIVTKENTAKTGSVVL 1191

Query: 130  SIYKPGSPIVDDELTFSIYSNPNHKA--LLITDKVRSGTLVRLGTNNYQITSHYGKYNAI 187
            +     S        F + +    K    L T+      +  L   +Y+           
Sbjct: 1192 TKEDSVSKATLSGAEFELQNATGTKVKDNLTTNADGKLEVTDLAPGDYKFVETKAPTGYE 1251

Query: 188  VSTV---VKVEPGKIIDVTIQNR----AAKITFKLVSEMGGEAVADTAWSILTASG---- 236
            +        +E  +   V +          +    +       +A   + + T  G    
Sbjct: 1252 LDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQTKLGVSLK 1311

Query: 237  -DTVGESANASPSMVLSEGDYTVIARNKERNYSRE-----FSVLTGKSTIVEVLMRQ 287
               V E+        L+ GDY ++       Y  +     F++   +   ++V    
Sbjct: 1312 DKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPIQVTKTN 1368



 Score =  104 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/284 (12%), Positives = 76/284 (26%), Gaps = 27/284 (9%)

Query: 29   KGKRVVDAQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFP 88
              +       +         S +  SG  + + ++    K   + T    G     DL P
Sbjct: 1179 TKENTAKTGSVVLTKED-SVSKATLSGAEFELQNAT-GTKVKDNLTTNADGKLEVTDLAP 1236

Query: 89   GDYLISASFGHVGV-----VKKITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDD 141
            GDY    +    G          T+   +     V   N    G  + +     S     
Sbjct: 1237 GDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLA 1296

Query: 142  ELTFSIYSNPNHKAL--LITDKVRSGTLVRLGTNNYQITSHYGKYNA-----IVSTVVKV 194
               F + +         ++T+      +  L   +YQ+               V   ++ 
Sbjct: 1297 GAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEF 1356

Query: 195  EPGKIIDVTIQNR--AAKITFKLVSEMGGEAVADTAWSILTASGDTV----GESANASPS 248
                 I VT  N      +            +A+  + ++    +       +++     
Sbjct: 1357 NQKAPIQVTKTNTMSTGSVVLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEI 1416

Query: 249  MVLSEGDYTVIARNKERNYS-----REFSVLTGKSTIVEVLMRQ 287
              L+ GDY +I       Y       +  +   +   ++V    
Sbjct: 1417 TNLAPGDYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTN 1460



 Score = 71.1 bits (172), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 38/230 (16%), Positives = 72/230 (31%), Gaps = 14/230 (6%)

Query: 2    TISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHIF 61
            T + + Y       T +   N   +    K  V         +L   S S  +G  + + 
Sbjct: 1244 TKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQ 1303

Query: 62   DSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQK 116
                          +  G     +L PGDY +  +    G        + T+   +K   
Sbjct: 1304 T-KLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPI 1362

Query: 117  QVFILNA--GGIRLYSIYKPGSPIVDDELTFSIYS-NPNHKALLITDKVRSGTLVRLGTN 173
            QV   N    G  + +     +  +    TF +   + N    L TD      +  L   
Sbjct: 1363 QVTKTNTMSTGSVVLTKTDGETKALLANATFKLVDEDNNVTENLTTDASGKLEITNLAPG 1422

Query: 174  NYQITSHYGKYNAIVST-----VVKVEPGKIIDVTIQNRAAKITFKLVSE 218
            +YQ+          + T      +  +  + + VT  N    ++ K+++E
Sbjct: 1423 DYQLIETKAPAGYELDTVPVDVKITFDQKETLQVTKTNLKTVVSGKVIAE 1472


>gi|254725364|ref|ZP_05187147.1| cell wall surface anchor family protein [Bacillus anthracis str.
           A1055]
          Length = 718

 Score =  131 bits (330), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 44/307 (14%), Positives = 99/307 (32%), Gaps = 27/307 (8%)

Query: 7   SYAKAENMHTTSTLLNNNISKGKGKRVVDAQRI-TCEARLTENSTSIDSGVSWHIFDSIS 65
           ++  +E +  T+ LL  N  K     VV+ + + + +         +  G  + +    S
Sbjct: 253 AFKGSEKVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKEVLKGAVFEV----S 308

Query: 66  NKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGV-----VKKITVSSKEKNQKQVFI 120
           N+    + T    G     +L  G Y +       G      VKKI V + E    ++  
Sbjct: 309 NENFKQNVTTSDKGIAELGNLPIGIYSVKEIQAPAGYVLDRSVKKIEVKTGETAVLELKN 368

Query: 121 LNAGG-IRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITS 179
            N  G + +  +             F+IY+    + +      +     +L    Y+   
Sbjct: 369 ENVKGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTDEKGVAKFKLPYGKYKYKE 428

Query: 180 HYGKYNAIVS-TVVKVEPGKIID-----VTIQNRAAKITFKLVS-EMGGEAVADTAWSIL 232
                  +++      E  +  +     V  +    ++    V    G   + +  ++I 
Sbjct: 429 TIAPNGYVINEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 488

Query: 233 TASGDTV----GESANASPSMVLSEGDYTVIARNKERNY---SREFSVLTGKSTI-VEVL 284
              G  V     +    +    L  G YT         Y      F+    ++   ++ +
Sbjct: 489 NEQGKEVVKGKTDEKGVAKFK-LPYGKYTYKETIAPNGYVINEETFAFEIKENGEIIKHI 547

Query: 285 MRQKRMD 291
           ++ K+++
Sbjct: 548 VQDKKVE 554



 Score =  100 bits (249), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/281 (10%), Positives = 72/281 (25%), Gaps = 26/281 (9%)

Query: 36  AQRITCEARLTENSTSIDSGVSWHIFDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISA 95
              +        +  +      + I++    +           G    F L  G Y    
Sbjct: 372 KGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGK--TDEKG-VAKFKLPYGKYKYKE 428

Query: 96  SFGHVGVVKK-----ITVSSKEKNQKQVFILNA--GGIRLYSIYKPGSPIVDDELTFSIY 148
           +    G V         +    +  K +       G + +  +             F+IY
Sbjct: 429 TIAPNGYVINEETFAFEIKENGEIIKHIVQDKKVEGELEITKVDVADGNTKLPNAEFTIY 488

Query: 149 SNPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST-VVKVEPGKIID-----V 202
           +    + +      +     +L    Y           +++      E  +  +     V
Sbjct: 489 NEQGKEVVKGKTDEKGVAKFKLPYGKYTYKETIAPNGYVINEETFAFEIKENGEIIKHIV 548

Query: 203 TIQNRAAKITFKLVS-EMGGEAVADTAWSILTASGDTV----GESANASPSMVLSEGDYT 257
             +    ++    V    G   + +  ++I    G  V               L  G YT
Sbjct: 549 QDKKVEGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTNEQG-IAKFKLPYGKYT 607

Query: 258 VIARNKERNY---SREFSVLTGKSTI-VEVLMRQKRM