BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780160|ref|YP_003064573.1| hypothetical protein
CLIBASIA_00215 [Candidatus Liberibacter asiaticus str. psy62]
         (298 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780160|ref|YP_003064573.1| hypothetical protein CLIBASIA_00215 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 298

 Score =  608 bits (1568), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 298/298 (100%), Positives = 298/298 (100%)

Query: 1   MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHI 60
           MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHI
Sbjct: 1   MTISFSSYAKAENMHTTSTLLNNNISKGKGKRVVDAQRITCEARLTENSTSIDSGVSWHI 60

Query: 61  FDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFI 120
           FDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFI
Sbjct: 61  FDSISNKKNTLSTTKKIIGGKVSFDLFPGDYLISASFGHVGVVKKITVSSKEKNQKQVFI 120

Query: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSH 180
           LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSH
Sbjct: 121 LNAGGIRLYSIYKPGSPIVDDELTFSIYSNPNHKALLITDKVRSGTLVRLGTNNYQITSH 180

Query: 181 YGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVG 240
           YGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVG
Sbjct: 181 YGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTAWSILTASGDTVG 240

Query: 241 ESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHNT 298
           ESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHNT
Sbjct: 241 ESANASPSMVLSEGDYTVIARNKERNYSREFSVLTGKSTIVEVLMRQKRMDKNGQHNT 298


>gi|254780182|ref|YP_003064595.1| DNA gyrase subunit A [Candidatus Liberibacter asiaticus str. psy62]
          Length = 910

 Score = 27.7 bits (60), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 8/51 (15%)

Query: 150 NPNHKALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIVST-----VVKVE 195
           N N + +L++DK   GTL+R+  N  +I S   K   I ST     VV VE
Sbjct: 848 NDNDQIILVSDK---GTLIRVPVNEIRIASRATKGVVIFSTAKDERVVSVE 895


>gi|254781037|ref|YP_003065450.1| porphobilinogen deaminase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 307

 Score = 26.9 bits (58), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/86 (20%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 169 RLGTNNYQIT-SHYGKYNAIVSTVVKVEPGKIIDVTIQNRAAKITFKLVSEMGGEAV--A 225
           R+GT    +  +H  +  + +  V K+ P  I+ + +  +  +IT + ++E+GG+ +   
Sbjct: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66

Query: 226 DTAWSILTASGDTVGESANASPSMVL 251
           +    +++   D    SA   P+ +L
Sbjct: 67  EIEKKLISGEIDCAVHSAKDMPTKLL 92


>gi|254780979|ref|YP_003065392.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 500

 Score = 23.1 bits (48), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 6/58 (10%)

Query: 199 IIDVTIQNRAAKITFKLVSEMGG------EAVADTAWSILTASGDTVGESANASPSMV 250
           IID TI  + AK  F ++ E GG      E +     + L+A    V E  N++P+ V
Sbjct: 401 IIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNV 458


>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 610

 Score = 23.1 bits (48), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 26/53 (49%), Gaps = 7/53 (13%)

Query: 154 KALLITDKVRSGTLVRLGTNNYQITSHYGKYNAIV-------STVVKVEPGKI 199
           K +L  DK+      RL   ++ +  HYG+   IV       +T++K+  GKI
Sbjct: 282 KLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKI 334


>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 262

 Score = 22.7 bits (47), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 9/51 (17%)

Query: 183 KYNAIVSTVVK-----VEPGKIIDVTIQNRAAKITFKLVSEMGGEAVADTA 228
           KYN++   VVK     V+PG+I+ +   N A K TF  +  M G   AD+ 
Sbjct: 34  KYNSV--YVVKGVDLYVKPGEIVGLLGPNGAGKTTFFYM--MTGLICADSG 80


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.313    0.129    0.353 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 184,178
Number of Sequences: 1233
Number of extensions: 7330
Number of successful extensions: 20
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 16
Number of HSP's gapped (non-prelim): 7
length of query: 298
length of database: 328,796
effective HSP length: 73
effective length of query: 225
effective length of database: 238,787
effective search space: 53727075
effective search space used: 53727075
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 38 (19.2 bits)