HHsearch alignment for GI: 254780163 and conserved domain: CHL00095

>CHL00095 clpC Clp protease ATP binding subunit.
Probab=100.00  E-value=0  Score=1872.78  Aligned_cols=727  Identities=42%  Similarity=0.694  Sum_probs=674.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCHH--HHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             343899999999999999828995119999999820746--899999859998999999999964136545778886776
Q gi|254780163|r    3 FFSENLEKVLHQALVLANERNHEYATLEHLLLALIDDSD--AAIVMLSCNVDLKVLKNNLLNYIDNDSSNKLKNGFRVEC   80 (798)
Q Consensus         3 mfS~~a~~vL~~A~~lAk~~~H~~Vt~EHLLLaLL~d~~--~~~iL~~~giD~~~Lk~~Le~~L~~~~~~~~~~~~~~ei   80 (798)
T Consensus         4 kfT~~a~~~L~~A~~~A~~~~h~~V~~eHLLlaLl~~~~~~~~~~L~~~~vd~~~l~~~l~~~~~~~~~-----~~~~~~   78 (823)
T CHL00095          4 RFTEKAIKVIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAARALKSLNVNLKDARKEVEKYIGRGSG-----FVAVEI   78 (823)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCCC-----CCCCCC
T ss_conf             366999999999999999859894089999999974998479999998699999999999999842699-----887886


Q ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCC
Q ss_conf             46989999999999999980998125999878787377429999999849998999999983000000011121102443
Q gi|254780163|r   81 KPTSSFQRVVQRAVLHVQSTGRGIVTGANILVALFSEPDSHATYFLQEQEMTLYDAVNFISHGISKRKEFANFQSKLNVD  160 (798)
Q Consensus        81 ~~S~~l~rVL~~A~~~A~~~G~~~I~~eHLLLALL~e~ds~a~~iL~~~gis~~~v~~~i~~~~~~~~~~~~~~~~~~~~  160 (798)
T Consensus        79 ~~s~~~~~vL~~A~~~a~~~~~~~I~~ehLllall~e~~~~a~~iL~~~gi~~~~~~~~~~~~~~~~~~~----------  148 (823)
T CHL00095         79 PFTPRAKRVLELSLEEARILGHNYIGTEHLLLGLIREGEGVAARVLENLNVDLPKVRSLIINLIGEIAEV----------  148 (823)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCEECHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCCCCC----------
T ss_conf             8887999999999999998299804399999999708974799999987999999999999984545655----------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHH
Q ss_conf             21000001244444445555445530356544258877548611222178999999998622677874896676411668
Q gi|254780163|r  161 GSSAGSDGEGFVNDYQAKTDLNLFPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTA  240 (798)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~LdkFg~DLTe~AreGKLDPVIGRd~EI~riiqIL~RR~KNn~~lvG~~gvGkta  240 (798)
T Consensus       149 -------------~~~~~~~~~~~~~L~ky~~dLT~~A~~GklDpvIGRd~EI~r~i~IL~RR~KNNpiLvGepGVGKTA  215 (823)
T CHL00095        149 -------------ILGGGTSREKTPTLEEFGNNLTKMAYEGNLDPVIGRDKEIERVIQILGRRTKNNPILIGEPGVGKTA  215 (823)
T ss_pred             -------------CCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEECCCCCCHHH
T ss_conf             -------------6788666656556999978889999838999875956999999999977324885023799987999


Q ss_pred             HHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCCCCCCCCCC
Q ss_conf             99999999854898834520144554046753063431237899999998720389839997361663015544434477
Q gi|254780163|r  241 IAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIHTLVGAGSASGISVD  320 (798)
Q Consensus       241 ive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih~ligag~~~g~~~d  320 (798)
T Consensus       216 IvEGLA~rI~~g~VP~~L~~~~i~sLDl~~L~AGtkyRGeFEeRlk~il~ei~~~~~iILFIDEiHtlvGaG~~~g-~~D  294 (823)
T CHL00095        216 IAEGLAQRIANRDVPDILEDKLVLTLDIGLLLAGTKYRGEFEERIKKIMDEIKKANNIILVIDEIHTLIGAGAAEG-AID  294 (823)
T ss_pred             HHHHHHHHHHCCCCCHHHCCCCEEEEEHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCHHHHCCCCCCCC-CHH
T ss_conf             9999999760889986875993688428877533422267999999999999857986999735165328897666-431


Q ss_pred             HHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHH
Q ss_conf             78888766302660388730489999985201114320014430687868999999861276654103512111789999
Q gi|254780163|r  321 ASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKIDVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAV  400 (798)
Q Consensus       321 ~an~lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~rrF~~i~v~ep~~~~~~~iL~~~~~~ye~~h~v~~~~~al~~av  400 (798)
T Consensus       295 aaNlLKPaLarGel~~IGATT~~EYrk~iEkD~AL~RRFq~V~V~EPs~e~t~~IL~gl~~~yE~~H~V~i~d~Ai~aav  374 (823)
T CHL00095        295 AANILKPALARGKLQCIGATTLEEYRKHIEKDPALERRFQPVYVGEPSVEETIEILLGLRDRYEKHHNLSISDKALEAAA  374 (823)
T ss_pred             HHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             78876578648986699707889999985305889962684102899879999999999999987508850478999999


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH-----------------------------------------------
Q ss_conf             986542015556467988998653333211443-----------------------------------------------
Q gi|254780163|r  401 QLSVRHFTSRKLPDKAIDVIDEAGASQILQPLS-----------------------------------------------  433 (798)
Q Consensus       401 ~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~-----------------------------------------------  433 (798)
T Consensus       375 ~LS~RYi~dr~LPDKAIDllDeA~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  454 (823)
T CHL00095        375 KLSDQYIKDRFLPDKAIDLLDEAGSRVRLINKQLPPAARELDKELRHILKDKDEAIRSQDFETAKQLRDREMEVRTQIAA  454 (823)
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             98776403777821788889999899998732586789999999999999999999674499999999889999999999


Q ss_pred             ------------HHHCCCCHHHHHHHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             ------------22113657899986631024531011100112334210000246653458999999999877520445
Q gi|254780163|r  434 ------------KRRKFITEKDIKKTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKIARAGLS  501 (798)
Q Consensus       434 ------------~~~~~~~~~~i~~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~~~~gl~  501 (798)
T Consensus       455 ~~~~~~~~~~~~~~~~~v~~~dI~~vvs~~t-giPv~~~~~~e~~~l~~le~~L~~~ViGQd~AI~~vs~ai~rsraGl~  533 (823)
T CHL00095        455 MKQSKKTEEELQKEVPVVTEKDIAEIVSAWT-GIPVNKLTKSESEKLIHMEETLHKRIIGQDEAVVAVSKAIRRARVGLK  533 (823)
T ss_pred             HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHH-CCCHHHHCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             9999874044323677207999999999986-898476334588999878887877840769999999999999970899


Q ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHH---HHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCCCCCCHHHHHCCCE
Q ss_conf             657874068861432003889999987---30477337720688612465301104780002564443100355515851
Q gi|254780163|r  502 DPNKPIGCYVFSGPTGVGKTEISKQLA---FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYS  578 (798)
Q Consensus       502 ~~~rP~g~flf~GptGvGKTelak~la---~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~egg~Lte~vr~~P~s  578 (798)
T Consensus       534 ~~~rPigsFlf~GPTGvGKTElAK~LA~~LFg~e~~liR~DMSEy~E~hsvsrLIGaPPGYVGy~eGG~LTeaVrr~Pys  613 (823)
T CHL00095        534 NPNRPIASFIFCGPTGVGKTELTKALASYFFGSEEAMIRLDMSEYMEKHTVSKLIGSPPGYVGYNEGGQLTEAVRKKPYT  613 (823)
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCHHHHCCCCCCCCCCCCCCCHHHHHHCCCCE
T ss_conf             89997468998789988779999999999747820258853510155420767458998766778788201988719986


Q ss_pred             EEEECCHHHCCHHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHC--CCCCCCCCC------------H
Q ss_conf             77740445502899999999877750217799776125429999424214553303--689882111------------4
Q gi|254780163|r  579 VVLLDEIEKSHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKA--RIGFGSSRN------------D  644 (798)
Q Consensus       579 Vvl~DEiEKAh~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~--~~g~~~~~~------------~  644 (798)
T Consensus       614 VvLfDEIEKAHpdV~nilLQvlDdG~LtD~~Gr~vdF~NtIIImTSNlGs~~i~~~~~~~gf~~~~~~~~~~~~~~~~~~  693 (823)
T CHL00095        614 VVLFDEIEKAHPDIFNLLLQILDDGRLTDSKGRTIDFKNTLIIMTSNLGSKVIEKGGGSLGFKLLEDGTKLDEKQYKRLS  693 (823)
T ss_pred             EEEECHHHHCCHHHHHHHHHHCCCCCCCCCCCCEEECEEEEEEECCCCCHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             99862131138899998876516884348999988431039997165055888741344343334454322023589999


Q ss_pred             HHHHHHHHHHCCHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEECHHHHHHHHHCCCCCCCCCHHHH
Q ss_conf             88999998728878817768289628899999999999999999999986698899988999999971898101532679
Q gi|254780163|r  645 DADKEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVINWLVSHGYDVKMG