HHsearch alignment for GI: 254780163 and conserved domain: CHL00195

>CHL00195 ycf46 Ycf46; Provisional.
Probab=99.60  E-value=1.9e-12  Score=108.61  Aligned_cols=210  Identities=22%  Similarity=0.289  Sum_probs=136.9

Q ss_pred             CEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCCCEEEEECCHH
Q ss_conf             74896676411668999999998548988345201445540467530634312378999999987203898399973616
Q gi|254780163|r  227 NPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYANAILYIDEIH  306 (798)
Q Consensus       227 n~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~~~ilfideih  306 (798)
T Consensus       261 GvLL~GpPG~GKtl~AKAvA~e----------~~~p~l~l~~~~l~~--~~vGesE~~~r~~f~~A~~~aP~ilfiDEid  328 (491)
T CHL00195        261 GLLLVGIQGTGKSLTAKAIANE----------WNLPLLRLDVGKLFG--GIVGESESRMRQMIQLAETISPCILWIDEID  328 (491)
T ss_pred             EEEEECCCCCCHHHHHHHHHHH----------HCCCEEEEEHHHHHH--HHCCHHHHHHHHHHHHHHHHCCEEEEEEHHH
T ss_conf             7999799998789999999866----------389469966799756--0067049999999999986198589974654


Q ss_pred             HHHCCCCCCCCC-CC--HHHHHHHHHC-C-CCEEEEEECCHHHHHHHHHCCHHHHH--HCE-EEEECCCCHHHHHHHHHH
Q ss_conf             630155444344-77--7888876630-2-66038873048999998520111432--001-443068786899999986
Q gi|254780163|r  307 TLVGAGSASGIS-VD--ASNLLKPALS-S-GAVRCIGSTTYSEYRQFFEKDKALVR--RFQ-KIDVSEPSIEDAIEIVKG  378 (798)
Q Consensus       307 ~ligag~~~g~~-~d--~an~lkP~L~-r-g~~~~IgatT~~ey~~~~e~d~al~r--rF~-~i~v~ep~~~~~~~iL~~  378 (798)
T Consensus       329 k~~~~~~~~~d~g~s~rv~~~~Lt~m~e~~~~VfViattN~-----~~~L~pellR~GRFD~~~~v~lP~~~~R~~I~~i  403 (491)
T CHL00195        329 KAFSGLDSKGDSGTSNRVLATFITWLSEKKSPVFVVATANN-----IDSLPLELLRKGRFDEIFFLDLPNLEERELIFKI  403 (491)
T ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCC-----CCCCCHHHCCCCCCCEEEECCCCCHHHHHHHHHH
T ss_conf             54258888888723289999999986468997699995899-----7558987708987770476489598999999999


Q ss_pred             HHHHHHHHCCCEECCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCHH
Q ss_conf             12766541035121117899999865420155564679889986533332114432211365789998663102453101
Q gi|254780163|r  379 IKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQPLSKRRKFITEKDIKKTIASMNRSIHTT  458 (798)
Q Consensus       379 ~~~~ye~~h~v~~~~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~gip~~  458 (798)
T Consensus       404 hl~~~---~~~~~~~~d~~~la~~t~gfsG------AeI---e~~v~~A~~~A~~~~-r~~~~~dl~~a~~~---~~Pls  467 (491)
T CHL00195        404 HLKRF---RPN