HHsearch alignment for GI: 254780163 and conserved domain: COG0464

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones].
Probab=99.77  E-value=2.8e-16  Score=136.10  Aligned_cols=429  Identities=22%  Similarity=0.289  Sum_probs=230.1

Q ss_pred             HHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCHHHHEEEEEEEEHHHHHCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             99862267787489667641166899999999854898834520144554046753063431237899999998720389
Q gi|254780163|r  217 IQILCRRSKNNPLYVGDPGVGKTAIAEGFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESYA  296 (798)
Q Consensus       217 iqIL~RR~KNn~~lvG~~gvGktaive~la~~i~~~~vp~~l~~~~i~~ld~~~l~ag~~~rg~fe~r~~~~~~~~~~~~  296 (798)
T Consensus        10 ~~~~~~~~~~~v~~~g~~~~~~t~~~~~~a~~---~~~~--------~~~~~~~--~~~~~~~~~~~~~~~~~~~a~~~~   76 (494)
T COG0464          10 FKKLGIEPPKGVLLHGPPGTGKTLLARALANE---GAEF--------LSINGPE--ILSKYVGESELRLRELFEEAEKLA   76 (494)
T ss_pred             HHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHC---CCCC--------CCCCCCH--HHHHHCCHHHHHHHHHHHHHHHCC
T ss_conf             98706676421000368876503665676512---5410--------1356522--432220510899999989998639


Q ss_pred             CEEEEECCHHHHHCCCCCCCCCCC---HHHH--HHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHH--HCEE-EEECCCC
Q ss_conf             839997361663015544434477---7888--876630266038873048999998520111432--0014-4306878
Q gi|254780163|r  297 NAILYIDEIHTLVGAGSASGISVD---ASNL--LKPALSSGAVRCIGSTTYSEYRQFFEKDKALVR--RFQK-IDVSEPS  368 (798)
Q Consensus       297 ~~ilfideih~ligag~~~g~~~d---~an~--lkP~L~rg~~~~IgatT~~ey~~~~e~d~al~r--rF~~-i~v~ep~  368 (798)
T Consensus        77 ~~ii~~d~~~~~~~~~~~~~~~~~~~v~~~l~~~~d~~~~~~v~~~~~~-----~~~~~~~~a~~~~~~~~~~~~~~~~~  151 (494)
T COG0464          77 PSIIFIDEIDALAPKRSSDQGEVERRVVAQLLALMDGLKRGQVIVIGAT-----NRPDGLDPAKRRPGRFDREIEVNLPD  151 (494)
T ss_pred             CCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEECC-----CCCCCHHHHHHCCHHHHHHHHHCCCC
T ss_conf             7636404433212344444210457899989987642465634674134-----45321127775313767887633654


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEC-CHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH--HHHHHHCCCCHHHHH
Q ss_conf             689999998612766541035121-11789999986542015556467988998653333211--443221136578999
Q gi|254780163|r  369 IEDAIEIVKGIKPYFEEHHQLRYS-KEAIRAAVQLSVRHFTSRKLPDKAIDVIDEAGASQILQ--PLSKRRKFITEKDIK  445 (798)
Q Consensus       369 ~~~~~~iL~~~~~~ye~~h~v~~~-~~al~~av~ls~ryi~~r~lPdkAidllDea~a~~~~~--~~~~~~~~~~~~~i~  445 (798)
T Consensus       152 ~~~~~~i~~~~------~~~~~~~~~~~~~~~a~~~~~~~~~~-----~~~l~~~~~~~~~~r~~~~~~~~~~~~~~~~~  220 (494)
T COG0464         152 EAGRLEILQIH------TRLMFLGPPGTGKTLAARTVGKSGAD-----LGALAKEAALRELRRAIDLVGEYIGVTEDDFE  220 (494)
T ss_pred             HHCCHHHHHHH------HHCCCCCCCCCHHHHHHHHCCHHHHH-----HHHHHHHHHHHHHHHCCCCCHHHHHCCHHHHH
T ss_conf             10142465101------11012578642788998732321324-----88774178888875002333033202199999


Q ss_pred             HHHHHCCCCCCHHHHHCCHHHHHHHHCCHHHHHHHCHHHHHHHHHHHHHH----HHCCCCC-CCCCCCEEEEECCCCHHH
Q ss_conf             86631024531011100112334210000246653458999999999877----5204456-578740688614320038
Q gi|254780163|r  446 KTIASMNRSIHTTSFSRDDDSVLSNLEKNLGTVVYGQEEAIKKLSSSIKI----ARAGLSD-PNKPIGCYVFSGPTGVGK  520 (798)
Q Consensus       446 ~~~~~~~~gip~~~~~~~~~~~l~~l~~~l~~~v~GQ~~ai~~v~~~i~~----~~~gl~~-~~rP~g~flf~GptGvGK  520 (798)
T Consensus       221 ~~l~~~~-~~-~~~~~~~~~v~~~--------diggl~~~k~~l~e~v~~~~~~~e~-~~~~~~~~~~giLl~GpPGtGK  289 (494)
T COG0464         221 EALKKVL-PS-RGVLFEDEDVTLD--------DIGGLEEAKEELKEAIETPLKRPEL-FRKLGLRPPKGVLLYGPPGTGK  289 (494)
T ss_pred             HHHHHCC-CC-CCCEECCCCCEEE--------EECCHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCCCEEEEECCCCCCH
T ss_conf             9998612-45-5630036885145--------3236377999999999999970887-6325898883699988999758


Q ss_pred             HHHHHHHHHHCCCCEEEEEHHHHHCCCCCCHHCCCCCHHCCCCCC--CCCCHHHHHCCCEEEEECCHHHCC---------
Q ss_conf             899999873047733772068861246530110478000256444--310035551585177740445502---------
Q gi|254780163|r  521 TEISKQLAFALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQG--GILADSVDQNPYSVVLLDEIEKSH---------  589 (798)
Q Consensus       521 Telak~la~~~~~~lir~dmsey~e~~~vs~LiGappGYvG~~eg--g~Lte~vr~~P~sVvl~DEiEKAh---------  589 (798)
T Consensus       290 T~lAkava~~~~~~fi~v~~~~l~sk------------~vGesek~ir~~F~~A~~~~p~iifiDEiDs~~~~r~~~~~~  357 (494)
T COG0464         290 TLLAKAVALESRSRFISVKGSELLSK------------WVGESEKNIRELFEKARKLAPSIIFIDEIDSLASGRGPSEDG  357 (494)
T ss_pred             HHHHHHHHHHCCCCEEEECCHHHHHH------------HHHHHHHHHHHHHHHHHHCCCCEEEHHHHHHHHCCCCCCCCC
T ss_conf             99999987544982488433555407------------765999999999999996699889748866674128998763


Q ss_pred             --HHHHHHHHHHHHHHHCCCCCCCEECCCCEEEEEECCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCEEE
Q ss_conf             --899999999877750217799776125429999424214553303689882111488999998728878817768289
Q gi|254780163|r  590 --PDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDADKEALRNFLSPEFLNRLDSII  667 (798)
Q Consensus       590 --~~v~~~llqild~G~ltd~~Gr~vdf~n~iii~TsN~G~~~~~~~~~g~~~~~~~~~~~~~l~~~f~peflnRid~ii  667 (798)
T Consensus       358 ~~~rv~~~ll~~~d~--~e-------~~~~v~vi~aTN~p~-------------~l----d~a---~lR~---gRfd~~i  405 (494)
T COG0464         358 SGRRVVGQLLTELDG--IE-------KAEGVLVIAATNRPD-------------DL----DPA---LLRP---GRFDRLI  405 (494)
T ss_pred             HHHHHHHHHHHHHHC--CC-------CCCCEEEEECCCCCC-------------CC----CHH---HHCC---CCCEEEE
T ss_conf             799999999999747--54-------4376489964